1NCQD

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ncqD00
1POV0 1HXS4 1EAH4 2RS34 4GB34 1RUF4 1VBD4 2HWB4 2R044 1R084 1NA1D 1PVC4 1AR94 2R074 2RR14 2X5ID 1AL24 1VBC4 1RUJ4 3J8F4 2HWC4 4PDWD 1NCQD 1RHI4 1PIV4 2R064 4RHV4 3JBG4 1RUC4 1MQTD 2RS54 1VBE4 1RUI4 1VRH4 1AR74 1K5MD 4Q4W4 1D4M4 1RUE4 1RVF4 1COV4 4Q4Y4 1Z7S4 1AR84 2RMU4 3JD74 1ASJ4 1H8TD 1OOPD 1HRI4 1RMU4 1VBA4 2PLV4 2RS14 1VBB4 1PO14 1RUH4 1HRV4 1R094 4Q4V4 4Q4X4 2RM24 1BEV4 1EV14 1AR64 1RUG4 1RUD4 1PO24
chains in the Genus database with same CATH superfamily
3AE7A 1RUF4 2R044 1NA1D 1PVC4 2X5ID 2PYLA 2ACZA 3AE6A 1RHI4 1PIV4 1NEKA 3JBG4 1RUC4 1MQTD 2RS54 3AECA 3P4QA 3SUCA 4Q4Y4 1RUE4 3ABVA 4YTNA 2WU5A 3JD74 3SFEA 1VBB4 1PO14 4Q4V4 1YQ3A 3AE9A 4YSZA 1POV0 2B76A 3AE8A 1VBD4 4GB34 2R074 1HRV4 2WDRA 3J8F4 4PDWD 4YSXA 4RHV4 2PY5A 2H89A 1VRH4 1AR74 3VR9A 1K5MD 4Q4W4 2WQYA 1COV4 1Z7S4 1XHZA 3AEBA 2WU2A 1ASJ4 1YQ4A 1RMU4 1HRI4 2PLV4 3AE1A 2EX3A 4Q4X4 2RM24 1BEV4 4YXDA 3AE2A 1NENA 1AR64 1RUD4 2PZSA 3AEFA 4YT0A 1PO24 3AEAA 1HXS4 2HWB4 1KFYA 1XHXA 3AEEA 1AL24 1KF6A 1VBC4 3P4PA 2HWC4 4YSYA 3AE4A 4YTMA 3P4RA 3GQKA 1VBE4 1RUI4 3AE5A 3GQHA 3VRAA 2WP9A 1D4M4 3CIRA 1ZP0A 1AR84 1H8TD 1OOPD 2WS3A 3VR8A 4YTPA 1ZOYA 1R094 5C3JA 1RUG4 1L0VA 5C2TA 3P4SA 2RS34 1EAH4 1R084 2RR14 1AR94 1RUJ4 1NCQD 2R064 2WDVA 2R7FA 3AEGA 2WDQA 3FI7A 3SFDA 1RVF4 2PW9A 2RMU4 3VRBA 1VBA4 4KX6A 2RS14 2H88A 1RUH4 1XI1A 2FBWA 1EV14 3AE3A 2PYJA 3AEDA
chains in the Genus database with same CATH topology
1POV0 1HXS4 1EAH4 2RS34 4GB34 1RUF4 1VBD4 2HWB4 2R044 1R084 1NA1D 1PVC4 1AR94 2R074 2RR14 2X5ID 1AL24 1VBC4 1RUJ4 3J8F4 2HWC4 4PDWD 1NCQD 1RHI4 1PIV4 2R064 4RHV4 3JBG4 1RUC4 1MQTD 2RS54 1VBE4 1RUI4 1VRH4 1AR74 1K5MD 4Q4W4 1D4M4 1RUE4 1RVF4 1COV4 4Q4Y4 1Z7S4 1AR84 2RMU4 3JD74 1ASJ4 1H8TD 1OOPD 1HRI4 1RMU4 1VBA4 2PLV4 2RS14 1VBB4 1PO14 1RUH4 1HRV4 1R094 4Q4V4 4Q4X4 2RM24 1BEV4 1EV14 1AR64 1RUG4 1RUD4 1PO24
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POV 0;  1HXS 4;  1EAH 4;  2RS3 4;  4GB3 4;  1RUF 4;  1VBD 4;  2HWB 4;  2R04 4;  1R08 4;  1NA1 D;  1PVC 4;  1AR9 4;  2R07 4;  2RR1 4;  2X5I D;  1AL2 4;  1VBC 4;  1RUJ 4;  3J8F 4;  2HWC 4;  4PDW D;  1NCQ D;  1RHI 4;  1PIV 4;  2R06 4;  4RHV 4;  3JBG 4;  1RUC 4;  1MQT D;  2RS5 4;  1VBE 4;  1RUI 4;  1VRH 4;  1AR7 4;  1K5M D;  4Q4W 4;  1D4M 4;  1RUE 4;  1RVF 4;  1COV 4;  4Q4Y 4;  1Z7S 4;  1AR8 4;  2RMU 4;  3JD7 4;  1ASJ 4;  1H8T D;  1OOP D;  1HRI 4;  1RMU 4;  1VBA 4;  2PLV 4;  2RS1 4;  1VBB 4;  1PO1 4;  1RUH 4;  1HRV 4;  1R09 4;  4Q4V 4;  4Q4X 4;  2RM2 4;  1BEV 4;  1EV1 4;  1AR6 4;  1RUG 4;  1RUD 4;  1PO2 4; 
#chains in the Genus database with same CATH topology
 3AE7 A;  1RUF 4;  2R04 4;  1NA1 D;  1PVC 4;  2X5I D;  2PYL A;  2ACZ A;  3AE6 A;  1RHI 4;  1PIV 4;  1NEK A;  3JBG 4;  1RUC 4;  1MQT D;  2RS5 4;  3AEC A;  3P4Q A;  3SUC A;  4Q4Y 4;  1RUE 4;  3ABV A;  4YTN A;  2WU5 A;  3JD7 4;  3SFE A;  1VBB 4;  1PO1 4;  4Q4V 4;  1YQ3 A;  3AE9 A;  4YSZ A;  1POV 0;  2B76 A;  3AE8 A;  1VBD 4;  4GB3 4;  2R07 4;  1HRV 4;  2WDR A;  3J8F 4;  4PDW D;  4YSX A;  4RHV 4;  2PY5 A;  2H89 A;  1VRH 4;  1AR7 4;  3VR9 A;  1K5M D;  4Q4W 4;  2WQY A;  1COV 4;  1Z7S 4;  1XHZ A;  3AEB A;  2WU2 A;  1ASJ 4;  1YQ4 A;  1RMU 4;  1HRI 4;  2PLV 4;  3AE1 A;  2EX3 A;  4Q4X 4;  2RM2 4;  1BEV 4;  4YXD A;  3AE2 A;  1NEN A;  1AR6 4;  1RUD 4;  2PZS A;  3AEF A;  4YT0 A;  1PO2 4;  3AEA A;  1HXS 4;  2HWB 4;  1KFY A;  1XHX A;  3AEE A;  1AL2 4;  1KF6 A;  1VBC 4;  3P4P A;  2HWC 4;  4YSY A;  3AE4 A;  4YTM A;  3P4R A;  3GQK A;  1VBE 4;  1RUI 4;  3AE5 A;  3GQH A;  3VRA A;  2WP9 A;  1D4M 4;  3CIR A;  1ZP0 A;  1AR8 4;  1H8T D;  1OOP D;  2WS3 A;  3VR8 A;  4YTP A;  1ZOY A;  1R09 4;  5C3J A;  1RUG 4;  1L0V A;  5C2T A;  3P4S A;  2RS3 4;  1EAH 4;  1R08 4;  2RR1 4;  1AR9 4;  1RUJ 4;  1NCQ D;  2R06 4;  2WDV A;  2R7F A;  3AEG A;  2WDQ A;  3FI7 A;  3SFD A;  1RVF 4;  2PW9 A;  2RMU 4;  3VRB A;  1VBA 4;  4KX6 A;  2RS1 4;  2H88 A;  1RUH 4;  1XI1 A;  2FBW A;  1EV1 4;  3AE3 A;  2PYJ A;  3AED A; 
#chains in the Genus database with same CATH homology
 1POV 0;  1HXS 4;  1EAH 4;  2RS3 4;  4GB3 4;  1RUF 4;  1VBD 4;  2HWB 4;  2R04 4;  1R08 4;  1NA1 D;  1PVC 4;  1AR9 4;  2R07 4;  2RR1 4;  2X5I D;  1AL2 4;  1VBC 4;  1RUJ 4;  3J8F 4;  2HWC 4;  4PDW D;  1NCQ D;  1RHI 4;  1PIV 4;  2R06 4;  4RHV 4;  3JBG 4;  1RUC 4;  1MQT D;  2RS5 4;  1VBE 4;  1RUI 4;  1VRH 4;  1AR7 4;  1K5M D;  4Q4W 4;  1D4M 4;  1RUE 4;  1RVF 4;  1COV 4;  4Q4Y 4;  1Z7S 4;  1AR8 4;  2RMU 4;  3JD7 4;  1ASJ 4;  1H8T D;  1OOP D;  1HRI 4;  1RMU 4;  1VBA 4;  2PLV 4;  2RS1 4;  1VBB 4;  1PO1 4;  1RUH 4;  1HRV 4;  1R09 4;  4Q4V 4;  4Q4X 4;  2RM2 4;  1BEV 4;  1EV1 4;  1AR6 4;  1RUG 4;  1RUD 4;  1PO2 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...