1NCQD

The structure of hrv14 when complexed with pleconaril, an antiviral compound
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAT PROTEIN VP1
publication title Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2002-12-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ncqD00
1R084 2R074 1AR74 1VBC4 1VBD4 2RMU4 1OOPD 1HRV4 1BEV4 2R064 1AL24 1VBA4 3JBG4 1RUI4 2HWC4 1COV4 1RUE4 2RS34 2RM24 3JD74 1RMU4 1H8TD 1K5MD 2PLV4 1MQTD 2R044 1EAH4 1RUG4 4GB34 1PO14 1RUF4 1HRI4 1VBB4 1PIV4 1PVC4 4PDWD 1PO24 1AR84 2RS14 2X5ID 2RR14 4Q4X4 1R094 1ASJ4 1HXS4 1NCQD 1RHI4 4RHV4 1RVF4 3J8F4 4Q4V4 1EV14 1RUD4 2RS54 1AR94 1Z7S4 1RUC4 2HWB4 4Q4Y4 1D4M4 4Q4W4 1AR64 1RUH4 1VBE4 1NA1D 1VRH4 1RUJ4 1POV0
chains in the Genus database with same CATH superfamily
2EX3A 2PYJA 2WS3A 3SFDA 1YQ4A 2ACZA 1COV4 2WU2A 3AEGA 3P4QA 1H8TD 2H88A 3AEAA 1XHZA 1VBB4 4PDWD 1PIV4 3GQKA 1PO24 1XHXA 2RR14 3AE4A 3AEEA 4YTNA 1RVF4 1EV14 1RUD4 3FI7A 1NEKA 1RUC4 2HWB4 4YSYA 3VR8A 1VBE4 3AE3A 4YTPA 1VBC4 1VBD4 1BEV4 5C2TA 1AL24 2PZSA 2WDRA 3VRAA 2HWC4 2WP9A 2RS34 5C3JA 3JD74 3AE6A 2H89A 1EAH4 1RUG4 3AE9A 1PO14 1RUF4 1HXS4 1KFYA 3AE1A 2WDQA 1ZOYA 3AE2A 2PYLA 4Q4Y4 1RUH4 3ABVA 1VRH4 1RUJ4 1R084 4YSXA 2R074 1AR74 3AE5A 1HRV4 2PY5A 1VBA4 3JBG4 1RUE4 1RMU4 1K5MD 4GB34 3AE7A 3AEDA 4YTMA 3P4SA 3P4RA 1AR84 2RS14 2X5ID 2WU5A 1ASJ4 1NCQD 1KF6A 1L0VA 2R7FA 3J8F4 3AE8A 1AR94 1D4M4 3VR9A 1AR64 1NA1D 3SUCA 4YT0A 2RMU4 1OOPD 2R064 3GQHA 4KX6A 3CIRA 1RUI4 3AEFA 2RM24 2PLV4 1MQTD 2R044 2B76A 1NENA 2FBWA 1ZP0A 3AEBA 1HRI4 2PW9A 1PVC4 3P4PA 4Q4X4 4YSZA 3VRBA 1YQ3A 1R094 2WDVA 1RHI4 4RHV4 2RS54 1Z7S4 1XI1A 3SFEA 4YXDA 4Q4W4 2WQYA 3AECA 4Q4V4 1POV0
chains in the Genus database with same CATH topology
1R084 2R074 1AR74 1VBC4 1VBD4 2RMU4 1OOPD 1HRV4 1BEV4 2R064 1AL24 1VBA4 3JBG4 1RUI4 2HWC4 1COV4 1RUE4 2RS34 2RM24 3JD74 1RMU4 1H8TD 1K5MD 2PLV4 1MQTD 2R044 1EAH4 1RUG4 4GB34 1PO14 1RUF4 1HRI4 1VBB4 1PIV4 1PVC4 4PDWD 1PO24 1AR84 2RS14 2X5ID 2RR14 4Q4X4 1R094 1ASJ4 1HXS4 1NCQD 1RHI4 4RHV4 1RVF4 3J8F4 4Q4V4 1EV14 1RUD4 2RS54 1AR94 1Z7S4 1RUC4 2HWB4 4Q4Y4 1D4M4 4Q4W4 1AR64 1RUH4 1VBE4 1NA1D 1VRH4 1RUJ4 1POV0
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R08 4;  2R07 4;  1AR7 4;  1VBC 4;  1VBD 4;  2RMU 4;  1OOP D;  1HRV 4;  1BEV 4;  2R06 4;  1AL2 4;  1VBA 4;  3JBG 4;  1RUI 4;  2HWC 4;  1COV 4;  1RUE 4;  2RS3 4;  2RM2 4;  3JD7 4;  1RMU 4;  1H8T D;  1K5M D;  2PLV 4;  1MQT D;  2R04 4;  1EAH 4;  1RUG 4;  4GB3 4;  1PO1 4;  1RUF 4;  1HRI 4;  1VBB 4;  1PIV 4;  1PVC 4;  4PDW D;  1PO2 4;  1AR8 4;  2RS1 4;  2X5I D;  2RR1 4;  4Q4X 4;  1R09 4;  1ASJ 4;  1HXS 4;  1NCQ D;  1RHI 4;  4RHV 4;  1RVF 4;  3J8F 4;  4Q4V 4;  1EV1 4;  1RUD 4;  2RS5 4;  1AR9 4;  1Z7S 4;  1RUC 4;  2HWB 4;  4Q4Y 4;  1D4M 4;  4Q4W 4;  1AR6 4;  1RUH 4;  1VBE 4;  1NA1 D;  1VRH 4;  1RUJ 4;  1POV 0; 
#chains in the Genus database with same CATH topology
 2EX3 A;  2PYJ A;  2WS3 A;  3SFD A;  1YQ4 A;  2ACZ A;  1COV 4;  2WU2 A;  3AEG A;  3P4Q A;  1H8T D;  2H88 A;  3AEA A;  1XHZ A;  1VBB 4;  4PDW D;  1PIV 4;  3GQK A;  1PO2 4;  1XHX A;  2RR1 4;  3AE4 A;  3AEE A;  4YTN A;  1RVF 4;  1EV1 4;  1RUD 4;  3FI7 A;  1NEK A;  1RUC 4;  2HWB 4;  4YSY A;  3VR8 A;  1VBE 4;  3AE3 A;  4YTP A;  1VBC 4;  1VBD 4;  1BEV 4;  5C2T A;  1AL2 4;  2PZS A;  2WDR A;  3VRA A;  2HWC 4;  2WP9 A;  2RS3 4;  5C3J A;  3JD7 4;  3AE6 A;  2H89 A;  1EAH 4;  1RUG 4;  3AE9 A;  1PO1 4;  1RUF 4;  1HXS 4;  1KFY A;  3AE1 A;  2WDQ A;  1ZOY A;  3AE2 A;  2PYL A;  4Q4Y 4;  1RUH 4;  3ABV A;  1VRH 4;  1RUJ 4;  1R08 4;  4YSX A;  2R07 4;  1AR7 4;  3AE5 A;  1HRV 4;  2PY5 A;  1VBA 4;  3JBG 4;  1RUE 4;  1RMU 4;  1K5M D;  4GB3 4;  3AE7 A;  3AED A;  4YTM A;  3P4S A;  3P4R A;  1AR8 4;  2RS1 4;  2X5I D;  2WU5 A;  1ASJ 4;  1NCQ D;  1KF6 A;  1L0V A;  2R7F A;  3J8F 4;  3AE8 A;  1AR9 4;  1D4M 4;  3VR9 A;  1AR6 4;  1NA1 D;  3SUC A;  4YT0 A;  2RMU 4;  1OOP D;  2R06 4;  3GQH A;  4KX6 A;  3CIR A;  1RUI 4;  3AEF A;  2RM2 4;  2PLV 4;  1MQT D;  2R04 4;  2B76 A;  1NEN A;  2FBW A;  1ZP0 A;  3AEB A;  1HRI 4;  2PW9 A;  1PVC 4;  3P4P A;  4Q4X 4;  4YSZ A;  3VRB A;  1YQ3 A;  1R09 4;  2WDV A;  1RHI 4;  4RHV 4;  2RS5 4;  1Z7S 4;  1XI1 A;  3SFE A;  4YXD A;  4Q4W 4;  2WQY A;  3AEC A;  4Q4V 4;  1POV 0; 
#chains in the Genus database with same CATH homology
 1R08 4;  2R07 4;  1AR7 4;  1VBC 4;  1VBD 4;  2RMU 4;  1OOP D;  1HRV 4;  1BEV 4;  2R06 4;  1AL2 4;  1VBA 4;  3JBG 4;  1RUI 4;  2HWC 4;  1COV 4;  1RUE 4;  2RS3 4;  2RM2 4;  3JD7 4;  1RMU 4;  1H8T D;  1K5M D;  2PLV 4;  1MQT D;  2R04 4;  1EAH 4;  1RUG 4;  4GB3 4;  1PO1 4;  1RUF 4;  1HRI 4;  1VBB 4;  1PIV 4;  1PVC 4;  4PDW D;  1PO2 4;  1AR8 4;  2RS1 4;  2X5I D;  2RR1 4;  4Q4X 4;  1R09 4;  1ASJ 4;  1HXS 4;  1NCQ D;  1RHI 4;  4RHV 4;  1RVF 4;  3J8F 4;  4Q4V 4;  1EV1 4;  1RUD 4;  2RS5 4;  1AR9 4;  1Z7S 4;  1RUC 4;  2HWB 4;  4Q4Y 4;  1D4M 4;  4Q4W 4;  1AR6 4;  1RUH 4;  1VBE 4;  1NA1 D;  1VRH 4;  1RUJ 4;  1POV 0; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...