The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
2
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule keywords |
COAT PROTEIN VP1
|
publication title |
Structural and virological studies of the stages of virus replication that are affected by antirhinovirus compounds
pubmed doi rcsb |
molecule tags |
Virus
|
total genus |
2
|
structure length |
40
|
sequence length |
40
|
ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
pdb deposition date | 2002-12-05 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
D | PF02226 | Pico_P1A | Picornavirus coat protein (VP4) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | Picornavirus coat protein VP4 |
#chains in the Genus database with same CATH superfamily 1R08 4; 2R07 4; 1AR7 4; 1VBC 4; 1VBD 4; 2RMU 4; 1OOP D; 1HRV 4; 1BEV 4; 2R06 4; 1AL2 4; 1VBA 4; 3JBG 4; 1RUI 4; 2HWC 4; 1COV 4; 1RUE 4; 2RS3 4; 2RM2 4; 3JD7 4; 1RMU 4; 1H8T D; 1K5M D; 2PLV 4; 1MQT D; 2R04 4; 1EAH 4; 1RUG 4; 4GB3 4; 1PO1 4; 1RUF 4; 1HRI 4; 1VBB 4; 1PIV 4; 1PVC 4; 4PDW D; 1PO2 4; 1AR8 4; 2RS1 4; 2X5I D; 2RR1 4; 4Q4X 4; 1R09 4; 1ASJ 4; 1HXS 4; 1NCQ D; 1RHI 4; 4RHV 4; 1RVF 4; 3J8F 4; 4Q4V 4; 1EV1 4; 1RUD 4; 2RS5 4; 1AR9 4; 1Z7S 4; 1RUC 4; 2HWB 4; 4Q4Y 4; 1D4M 4; 4Q4W 4; 1AR6 4; 1RUH 4; 1VBE 4; 1NA1 D; 1VRH 4; 1RUJ 4; 1POV 0; #chains in the Genus database with same CATH topology 2EX3 A; 2PYJ A; 2WS3 A; 3SFD A; 1YQ4 A; 2ACZ A; 1COV 4; 2WU2 A; 3AEG A; 3P4Q A; 1H8T D; 2H88 A; 3AEA A; 1XHZ A; 1VBB 4; 4PDW D; 1PIV 4; 3GQK A; 1PO2 4; 1XHX A; 2RR1 4; 3AE4 A; 3AEE A; 4YTN A; 1RVF 4; 1EV1 4; 1RUD 4; 3FI7 A; 1NEK A; 1RUC 4; 2HWB 4; 4YSY A; 3VR8 A; 1VBE 4; 3AE3 A; 4YTP A; 1VBC 4; 1VBD 4; 1BEV 4; 5C2T A; 1AL2 4; 2PZS A; 2WDR A; 3VRA A; 2HWC 4; 2WP9 A; 2RS3 4; 5C3J A; 3JD7 4; 3AE6 A; 2H89 A; 1EAH 4; 1RUG 4; 3AE9 A; 1PO1 4; 1RUF 4; 1HXS 4; 1KFY A; 3AE1 A; 2WDQ A; 1ZOY A; 3AE2 A; 2PYL A; 4Q4Y 4; 1RUH 4; 3ABV A; 1VRH 4; 1RUJ 4; 1R08 4; 4YSX A; 2R07 4; 1AR7 4; 3AE5 A; 1HRV 4; 2PY5 A; 1VBA 4; 3JBG 4; 1RUE 4; 1RMU 4; 1K5M D; 4GB3 4; 3AE7 A; 3AED A; 4YTM A; 3P4S A; 3P4R A; 1AR8 4; 2RS1 4; 2X5I D; 2WU5 A; 1ASJ 4; 1NCQ D; 1KF6 A; 1L0V A; 2R7F A; 3J8F 4; 3AE8 A; 1AR9 4; 1D4M 4; 3VR9 A; 1AR6 4; 1NA1 D; 3SUC A; 4YT0 A; 2RMU 4; 1OOP D; 2R06 4; 3GQH A; 4KX6 A; 3CIR A; 1RUI 4; 3AEF A; 2RM2 4; 2PLV 4; 1MQT D; 2R04 4; 2B76 A; 1NEN A; 2FBW A; 1ZP0 A; 3AEB A; 1HRI 4; 2PW9 A; 1PVC 4; 3P4P A; 4Q4X 4; 4YSZ A; 3VRB A; 1YQ3 A; 1R09 4; 2WDV A; 1RHI 4; 4RHV 4; 2RS5 4; 1Z7S 4; 1XI1 A; 3SFE A; 4YXD A; 4Q4W 4; 2WQY A; 3AEC A; 4Q4V 4; 1POV 0; #chains in the Genus database with same CATH homology 1R08 4; 2R07 4; 1AR7 4; 1VBC 4; 1VBD 4; 2RMU 4; 1OOP D; 1HRV 4; 1BEV 4; 2R06 4; 1AL2 4; 1VBA 4; 3JBG 4; 1RUI 4; 2HWC 4; 1COV 4; 1RUE 4; 2RS3 4; 2RM2 4; 3JD7 4; 1RMU 4; 1H8T D; 1K5M D; 2PLV 4; 1MQT D; 2R04 4; 1EAH 4; 1RUG 4; 4GB3 4; 1PO1 4; 1RUF 4; 1HRI 4; 1VBB 4; 1PIV 4; 1PVC 4; 4PDW D; 1PO2 4; 1AR8 4; 2RS1 4; 2X5I D; 2RR1 4; 4Q4X 4; 1R09 4; 1ASJ 4; 1HXS 4; 1NCQ D; 1RHI 4; 4RHV 4; 1RVF 4; 3J8F 4; 4Q4V 4; 1EV1 4; 1RUD 4; 2RS5 4; 1AR9 4; 1Z7S 4; 1RUC 4; 2HWB 4; 4Q4Y 4; 1D4M 4; 4Q4W 4; 1AR6 4; 1RUH 4; 1VBE 4; 1NA1 D; 1VRH 4; 1RUJ 4; 1POV 0;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...