1RVF4

Fab complexed with intact human rhinovirus
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rvf400
1RUJ4 1VBE4 1R094 4GB34 1ASJ4 1HRI4 4PDWD 4Q4W4 2RS54 1PVC4 3J8F4 1VBD4 2RS14 1AR74 3JBG4 4Q4Y4 4RHV4 1PO14 1RUE4 4Q4X4 1NCQD 1RMU4 1POV0 1Z7S4 2RS34 1K5MD 1VBB4 1COV4 1RHI4 2X5ID 1EV14 1H8TD 2R044 1R084 2RMU4 2RR14 1HXS4 1RUC4 1VBC4 2HWC4 1PIV4 1AR84 1RUF4 1RUD4 1RVF4 1AR94 2HWB4 2PLV4 1VBA4 2R074 1D4M4 1MQTD 1EAH4 1NA1D 1AR64 1OOPD 1RUG4 1VRH4 1PO24 1RUI4 1RUH4 3JD74 4Q4V4 1HRV4 2R064 2RM24 1AL24 1BEV4
chains in the Genus database with same CATH superfamily
4GB34 2WU5A 3AEEA 1HRI4 3P4RA 4Q4W4 3AE3A 1VBD4 1PO14 3VR9A 4Q4X4 5C3JA 2H88A 1Z7S4 2PYLA 2WDRA 3CIRA 3SFDA 1K5MD 1EV14 1NEKA 2RR14 3ABVA 1RUC4 1VBC4 2ACZA 2WU2A 3AE7A 3FI7A 4YSZA 2PZSA 1PIV4 1RUD4 1D4M4 1XI1A 1RUI4 1RUH4 1ZOYA 3AE9A 1HRV4 3AE5A 3SUCA 3AECA 2B76A 4YT0A 2WQYA 3AEFA 1KF6A 1ASJ4 2RS54 4Q4Y4 1YQ4A 3AEBA 4RHV4 1RUE4 3AE6A 3VR8A 1RHI4 3AE1A 3VRAA 3AEGA 1R084 2WDVA 4KX6A 4YSYA 1AR84 1RVF4 1AR94 2PLV4 1VBA4 4YTNA 1MQTD 2FBWA 3AE4A 2WDQA 3JD74 3AEDA 2RM24 3J8F4 3SFEA 1AL24 2R7FA 1BEV4 3AEAA 3P4SA 5C2TA 1VBE4 1R094 1ZP0A 4PDWD 2PW9A 1NENA 1XHXA 1YQ3A 2RS14 1AR74 1NCQD 1RMU4 2RS34 4YXDA 4YTPA 2WP9A 1VBB4 1COV4 2PYJA 1HXS4 2EX3A 3AE8A 3P4QA 2HWB4 1RUF4 1EAH4 1OOPD 1VRH4 1RUG4 3GQKA 4YTMA 2PY5A 2R064 1L0VA 4YSXA 1RUJ4 1PVC4 3AE2A 3JBG4 1POV0 1XHZA 2WS3A 3GQHA 2X5ID 1KFYA 1H8TD 2R044 2H89A 3P4PA 2RMU4 3VRBA 2HWC4 1NA1D 1AR64 1PO24 4Q4V4 2R074
chains in the Genus database with same CATH topology
1RUJ4 1VBE4 1R094 4GB34 1ASJ4 1HRI4 4PDWD 4Q4W4 2RS54 1PVC4 3J8F4 1VBD4 2RS14 1AR74 3JBG4 4Q4Y4 4RHV4 1PO14 1RUE4 4Q4X4 1NCQD 1RMU4 1POV0 1Z7S4 2RS34 1K5MD 1VBB4 1COV4 1RHI4 2X5ID 1EV14 1H8TD 2R044 1R084 2RMU4 2RR14 1HXS4 1RUC4 1VBC4 2HWC4 1PIV4 1AR84 1RUF4 1RUD4 1RVF4 1AR94 2HWB4 2PLV4 1VBA4 2R074 1D4M4 1MQTD 1EAH4 1NA1D 1AR64 1OOPD 1RUG4 1VRH4 1PO24 1RUI4 1RUH4 3JD74 4Q4V4 1HRV4 2R064 2RM24 1AL24 1BEV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUJ 4;  1VBE 4;  1R09 4;  4GB3 4;  1ASJ 4;  1HRI 4;  4PDW D;  4Q4W 4;  2RS5 4;  1PVC 4;  3J8F 4;  1VBD 4;  2RS1 4;  1AR7 4;  3JBG 4;  4Q4Y 4;  4RHV 4;  1PO1 4;  1RUE 4;  4Q4X 4;  1NCQ D;  1RMU 4;  1POV 0;  1Z7S 4;  2RS3 4;  1K5M D;  1VBB 4;  1COV 4;  1RHI 4;  2X5I D;  1EV1 4;  1H8T D;  2R04 4;  1R08 4;  2RMU 4;  2RR1 4;  1HXS 4;  1RUC 4;  1VBC 4;  2HWC 4;  1PIV 4;  1AR8 4;  1RUF 4;  1RUD 4;  1RVF 4;  1AR9 4;  2HWB 4;  2PLV 4;  1VBA 4;  2R07 4;  1D4M 4;  1MQT D;  1EAH 4;  1NA1 D;  1AR6 4;  1OOP D;  1RUG 4;  1VRH 4;  1PO2 4;  1RUI 4;  1RUH 4;  3JD7 4;  4Q4V 4;  1HRV 4;  2R06 4;  2RM2 4;  1AL2 4;  1BEV 4; 
#chains in the Genus database with same CATH topology
 4GB3 4;  2WU5 A;  3AEE A;  1HRI 4;  3P4R A;  4Q4W 4;  3AE3 A;  1VBD 4;  1PO1 4;  3VR9 A;  4Q4X 4;  5C3J A;  2H88 A;  1Z7S 4;  2PYL A;  2WDR A;  3CIR A;  3SFD A;  1K5M D;  1EV1 4;  1NEK A;  2RR1 4;  3ABV A;  1RUC 4;  1VBC 4;  2ACZ A;  2WU2 A;  3AE7 A;  3FI7 A;  4YSZ A;  2PZS A;  1PIV 4;  1RUD 4;  1D4M 4;  1XI1 A;  1RUI 4;  1RUH 4;  1ZOY A;  3AE9 A;  1HRV 4;  3AE5 A;  3SUC A;  3AEC A;  2B76 A;  4YT0 A;  2WQY A;  3AEF A;  1KF6 A;  1ASJ 4;  2RS5 4;  4Q4Y 4;  1YQ4 A;  3AEB A;  4RHV 4;  1RUE 4;  3AE6 A;  3VR8 A;  1RHI 4;  3AE1 A;  3VRA A;  3AEG A;  1R08 4;  2WDV A;  4KX6 A;  4YSY A;  1AR8 4;  1RVF 4;  1AR9 4;  2PLV 4;  1VBA 4;  4YTN A;  1MQT D;  2FBW A;  3AE4 A;  2WDQ A;  3JD7 4;  3AED A;  2RM2 4;  3J8F 4;  3SFE A;  1AL2 4;  2R7F A;  1BEV 4;  3AEA A;  3P4S A;  5C2T A;  1VBE 4;  1R09 4;  1ZP0 A;  4PDW D;  2PW9 A;  1NEN A;  1XHX A;  1YQ3 A;  2RS1 4;  1AR7 4;  1NCQ D;  1RMU 4;  2RS3 4;  4YXD A;  4YTP A;  2WP9 A;  1VBB 4;  1COV 4;  2PYJ A;  1HXS 4;  2EX3 A;  3AE8 A;  3P4Q A;  2HWB 4;  1RUF 4;  1EAH 4;  1OOP D;  1VRH 4;  1RUG 4;  3GQK A;  4YTM A;  2PY5 A;  2R06 4;  1L0V A;  4YSX A;  1RUJ 4;  1PVC 4;  3AE2 A;  3JBG 4;  1POV 0;  1XHZ A;  2WS3 A;  3GQH A;  2X5I D;  1KFY A;  1H8T D;  2R04 4;  2H89 A;  3P4P A;  2RMU 4;  3VRB A;  2HWC 4;  1NA1 D;  1AR6 4;  1PO2 4;  4Q4V 4;  2R07 4; 
#chains in the Genus database with same CATH homology
 1RUJ 4;  1VBE 4;  1R09 4;  4GB3 4;  1ASJ 4;  1HRI 4;  4PDW D;  4Q4W 4;  2RS5 4;  1PVC 4;  3J8F 4;  1VBD 4;  2RS1 4;  1AR7 4;  3JBG 4;  4Q4Y 4;  4RHV 4;  1PO1 4;  1RUE 4;  4Q4X 4;  1NCQ D;  1RMU 4;  1POV 0;  1Z7S 4;  2RS3 4;  1K5M D;  1VBB 4;  1COV 4;  1RHI 4;  2X5I D;  1EV1 4;  1H8T D;  2R04 4;  1R08 4;  2RMU 4;  2RR1 4;  1HXS 4;  1RUC 4;  1VBC 4;  2HWC 4;  1PIV 4;  1AR8 4;  1RUF 4;  1RUD 4;  1RVF 4;  1AR9 4;  2HWB 4;  2PLV 4;  1VBA 4;  2R07 4;  1D4M 4;  1MQT D;  1EAH 4;  1NA1 D;  1AR6 4;  1OOP D;  1RUG 4;  1VRH 4;  1PO2 4;  1RUI 4;  1RUH 4;  3JD7 4;  4Q4V 4;  1HRV 4;  2R06 4;  2RM2 4;  1AL2 4;  1BEV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...