1RVF4

Fab complexed with intact human rhinovirus
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rvf400
1HXS4 1RUD4 1RUC4 1RUJ4 1RMU4 1RUF4 1RUH4 4GB34 4PDWD 2RS14 1RHI4 1VBB4 1NA1D 1POV0 1K5MD 1COV4 2HWB4 3JD74 1Z7S4 1PO14 1H8TD 2HWC4 1AR94 1AR74 1BEV4 1MQTD 1EAH4 1HRI4 2RMU4 2R064 4RHV4 1R094 1D4M4 1AR64 2RS54 1OOPD 1PIV4 1VBD4 2X5ID 4Q4V4 4Q4Y4 1NCQD 1RUG4 1VRH4 2RR14 1ASJ4 1RVF4 1VBE4 3JBG4 4Q4W4 4Q4X4 1VBA4 2R044 1HRV4 1RUE4 1RUI4 2PLV4 2RS34 2RM24 1PVC4 1PO24 1AL24 1R084 1EV14 2R074 3J8F4 1VBC4 1AR84
chains in the Genus database with same CATH superfamily
1RUD4 2B76A 2FBWA 3AE5A 4KX6A 2WDRA 1L0VA 1VBB4 2PW9A 3GQHA 3AE7A 1K5MD 3P4SA 1COV4 3VR8A 4YT0A 2HWC4 2WP9A 1AR94 2WDQA 4YSXA 1NEKA 1YQ4A 2RMU4 2PZSA 4RHV4 1R094 1KF6A 4Q4V4 1VBD4 2WS3A 1VBE4 1RUE4 5C2TA 3P4QA 2R7FA 2RM24 3AE6A 1AL24 1EV14 4YSYA 3SFDA 3SUCA 3AEEA 1HXS4 2WQYA 1RUF4 2WDVA 3AEBA 3AE4A 3AE1A 1Z7S4 1PO14 4YTMA 1HRI4 1ZOYA 3P4PA 1XHZA 3VRBA 2H89A 3AE8A 2EX3A 1NENA 2WU2A 2RS14 2ACZA 3GQKA 4PDWD 3SFEA 1POV0 3AE3A 1H8TD 3FI7A 1AR74 1MQTD 3VR9A 4YTNA 2R064 1YQ3A 1AR64 3AE9A 2PYLA 1NCQD 1RUG4 4YXDA 1XI1A 2RR14 3JBG4 4Q4W4 4Q4X4 2R044 1HRV4 1ZP0A 5C3JA 2R074 1VRH4 1VBC4 1RUC4 1RUJ4 1RMU4 3AECA 1RUH4 4GB34 3P4RA 2PY5A 4YTPA 1RHI4 3AEGA 1NA1D 1KFYA 2HWB4 3JD74 3ABVA 2H88A 1XHXA 3VRAA 1BEV4 1EAH4 2WU5A 3CIRA 1D4M4 2X5ID 2RS54 1OOPD 1PIV4 3AEFA 4Q4Y4 1ASJ4 1RVF4 3AEAA 4YSZA 1VBA4 2RS34 1RUI4 2PLV4 3AEDA 1PVC4 1PO24 1R084 3AE2A 3J8F4 2PYJA 1AR84
chains in the Genus database with same CATH topology
1HXS4 1RUD4 1RUC4 1RUJ4 1RMU4 1RUF4 1RUH4 4GB34 4PDWD 2RS14 1RHI4 1VBB4 1NA1D 1POV0 1K5MD 1COV4 2HWB4 3JD74 1Z7S4 1PO14 1H8TD 2HWC4 1AR94 1AR74 1BEV4 1MQTD 1EAH4 1HRI4 2RMU4 2R064 4RHV4 1R094 1D4M4 1AR64 2RS54 1OOPD 1PIV4 1VBD4 2X5ID 4Q4V4 4Q4Y4 1NCQD 1RUG4 1VRH4 2RR14 1ASJ4 1RVF4 1VBE4 3JBG4 4Q4W4 4Q4X4 1VBA4 2R044 1HRV4 1RUE4 1RUI4 2PLV4 2RS34 2RM24 1PVC4 1PO24 1AL24 1R084 1EV14 2R074 3J8F4 1VBC4 1AR84
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXS 4;  1RUD 4;  1RUC 4;  1RUJ 4;  1RMU 4;  1RUF 4;  1RUH 4;  4GB3 4;  4PDW D;  2RS1 4;  1RHI 4;  1VBB 4;  1NA1 D;  1POV 0;  1K5M D;  1COV 4;  2HWB 4;  3JD7 4;  1Z7S 4;  1PO1 4;  1H8T D;  2HWC 4;  1AR9 4;  1AR7 4;  1BEV 4;  1MQT D;  1EAH 4;  1HRI 4;  2RMU 4;  2R06 4;  4RHV 4;  1R09 4;  1D4M 4;  1AR6 4;  2RS5 4;  1OOP D;  1PIV 4;  1VBD 4;  2X5I D;  4Q4V 4;  4Q4Y 4;  1NCQ D;  1RUG 4;  1VRH 4;  2RR1 4;  1ASJ 4;  1RVF 4;  1VBE 4;  3JBG 4;  4Q4W 4;  4Q4X 4;  1VBA 4;  2R04 4;  1HRV 4;  1RUE 4;  1RUI 4;  2PLV 4;  2RS3 4;  2RM2 4;  1PVC 4;  1PO2 4;  1AL2 4;  1R08 4;  1EV1 4;  2R07 4;  3J8F 4;  1VBC 4;  1AR8 4; 
#chains in the Genus database with same CATH topology
 1RUD 4;  2B76 A;  2FBW A;  3AE5 A;  4KX6 A;  2WDR A;  1L0V A;  1VBB 4;  2PW9 A;  3GQH A;  3AE7 A;  1K5M D;  3P4S A;  1COV 4;  3VR8 A;  4YT0 A;  2HWC 4;  2WP9 A;  1AR9 4;  2WDQ A;  4YSX A;  1NEK A;  1YQ4 A;  2RMU 4;  2PZS A;  4RHV 4;  1R09 4;  1KF6 A;  4Q4V 4;  1VBD 4;  2WS3 A;  1VBE 4;  1RUE 4;  5C2T A;  3P4Q A;  2R7F A;  2RM2 4;  3AE6 A;  1AL2 4;  1EV1 4;  4YSY A;  3SFD A;  3SUC A;  3AEE A;  1HXS 4;  2WQY A;  1RUF 4;  2WDV A;  3AEB A;  3AE4 A;  3AE1 A;  1Z7S 4;  1PO1 4;  4YTM A;  1HRI 4;  1ZOY A;  3P4P A;  1XHZ A;  3VRB A;  2H89 A;  3AE8 A;  2EX3 A;  1NEN A;  2WU2 A;  2RS1 4;  2ACZ A;  3GQK A;  4PDW D;  3SFE A;  1POV 0;  3AE3 A;  1H8T D;  3FI7 A;  1AR7 4;  1MQT D;  3VR9 A;  4YTN A;  2R06 4;  1YQ3 A;  1AR6 4;  3AE9 A;  2PYL A;  1NCQ D;  1RUG 4;  4YXD A;  1XI1 A;  2RR1 4;  3JBG 4;  4Q4W 4;  4Q4X 4;  2R04 4;  1HRV 4;  1ZP0 A;  5C3J A;  2R07 4;  1VRH 4;  1VBC 4;  1RUC 4;  1RUJ 4;  1RMU 4;  3AEC A;  1RUH 4;  4GB3 4;  3P4R A;  2PY5 A;  4YTP A;  1RHI 4;  3AEG A;  1NA1 D;  1KFY A;  2HWB 4;  3JD7 4;  3ABV A;  2H88 A;  1XHX A;  3VRA A;  1BEV 4;  1EAH 4;  2WU5 A;  3CIR A;  1D4M 4;  2X5I D;  2RS5 4;  1OOP D;  1PIV 4;  3AEF A;  4Q4Y 4;  1ASJ 4;  1RVF 4;  3AEA A;  4YSZ A;  1VBA 4;  2RS3 4;  1RUI 4;  2PLV 4;  3AED A;  1PVC 4;  1PO2 4;  1R08 4;  3AE2 A;  3J8F 4;  2PYJ A;  1AR8 4; 
#chains in the Genus database with same CATH homology
 1HXS 4;  1RUD 4;  1RUC 4;  1RUJ 4;  1RMU 4;  1RUF 4;  1RUH 4;  4GB3 4;  4PDW D;  2RS1 4;  1RHI 4;  1VBB 4;  1NA1 D;  1POV 0;  1K5M D;  1COV 4;  2HWB 4;  3JD7 4;  1Z7S 4;  1PO1 4;  1H8T D;  2HWC 4;  1AR9 4;  1AR7 4;  1BEV 4;  1MQT D;  1EAH 4;  1HRI 4;  2RMU 4;  2R06 4;  4RHV 4;  1R09 4;  1D4M 4;  1AR6 4;  2RS5 4;  1OOP D;  1PIV 4;  1VBD 4;  2X5I D;  4Q4V 4;  4Q4Y 4;  1NCQ D;  1RUG 4;  1VRH 4;  2RR1 4;  1ASJ 4;  1RVF 4;  1VBE 4;  3JBG 4;  4Q4W 4;  4Q4X 4;  1VBA 4;  2R04 4;  1HRV 4;  1RUE 4;  1RUI 4;  2PLV 4;  2RS3 4;  2RM2 4;  1PVC 4;  1PO2 4;  1AL2 4;  1R08 4;  1EV1 4;  2R07 4;  3J8F 4;  1VBC 4;  1AR8 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...