1RVF4

Fab complexed with intact human rhinovirus
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN
publication title Neutralizing antibody to human rhinovirus 14 penetrates the receptor-binding canyon.
pubmed doi rcsb
molecule tags Virus/immune system
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1996-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1rvf400
1EV14 1R084 2R064 1D4M4 2RS14 1PVC4 4Q4X4 1HRI4 1VBE4 1VBC4 1RUI4 1AL24 1AR64 1OOPD 1RVF4 1RUD4 1VBB4 2HWC4 2RMU4 2X5ID 3J8F4 4Q4Y4 1EAH4 1PO24 1RUH4 1AR84 1HXS4 1AR74 1RUG4 1BEV4 2R044 3JBG4 4PDWD 1VBD4 1RUJ4 1RUF4 1H8TD 1VBA4 2RS34 2RR14 2RS54 1RHI4 4Q4V4 1ASJ4 1R094 1NA1D 1HRV4 1MQTD 1RUC4 1PIV4 1RUE4 1COV4 1AR94 4RHV4 2HWB4 4GB34 1VRH4 2RM24 1POV0 1K5MD 1PO14 2PLV4 2R074 3JD74 4Q4W4 1Z7S4 1RMU4 1NCQD
chains in the Genus database with same CATH superfamily
4YTPA 2H88A 2PZSA 3AE7A 1D4M4 4Q4X4 1XHXA 3GQHA 1VBE4 3J8F4 2X5ID 1RUG4 3JBG4 1L0VA 2WU2A 1KF6A 1VBA4 2FBWA 1ASJ4 1NA1D 4RHV4 1NEKA 2R074 4Q4W4 4YT0A 1EV14 3AE2A 2RS14 4YSXA 5C2TA 3AE4A 2R7FA 3SUCA 3VR9A 3ABVA 1OOPD 1AR64 1RUD4 2HWC4 2RMU4 3VRBA 3GQKA 1AR84 4PDWD 1RUJ4 1H8TD 2RS34 2RR14 1RHI4 2WDRA 3AEAA 1MQTD 1RUC4 1RUE4 3CIRA 1COV4 1AR94 1ZP0A 3AEDA 1VRH4 2RM24 3AE5A 2PLV4 2WDQA 3JD74 3AEFA 1XHZA 1RMU4 1NCQD 3AE8A 1ZOYA 1PVC4 1HRI4 1VBC4 3AEBA 3AECA 1RUI4 4YTNA 1KFYA 2PY5A 1PO24 3P4RA 3AE3A 1HXS4 1AR74 3SFDA 1YQ3A 2R044 3AEEA 4YXDA 2WU5A 1YQ4A 3AEGA 1R094 2ACZA 4YSYA 3AE1A 1POV0 5C3JA 1K5MD 3AE6A 3FI7A 4YTMA 1Z7S4 3P4PA 1R084 4KX6A 2R064 2PYJA 3P4QA 2WP9A 3VR8A 1AL24 1VBB4 1RVF4 2PW9A 2WS3A 3SFEA 1XI1A 3VRAA 4Q4Y4 1EAH4 1RUH4 1NENA 2EX3A 2WQYA 1BEV4 4YSZA 1VBD4 1RUF4 2WDVA 2RS54 4Q4V4 1HRV4 2H89A 1PIV4 2HWB4 4GB34 3P4SA 1PO14 2B76A 3AE9A 2PYLA
chains in the Genus database with same CATH topology
1EV14 1R084 2R064 1D4M4 2RS14 1PVC4 4Q4X4 1HRI4 1VBE4 1VBC4 1RUI4 1AL24 1AR64 1OOPD 1RVF4 1RUD4 1VBB4 2HWC4 2RMU4 2X5ID 3J8F4 4Q4Y4 1EAH4 1PO24 1RUH4 1AR84 1HXS4 1AR74 1RUG4 1BEV4 2R044 3JBG4 4PDWD 1VBD4 1RUJ4 1RUF4 1H8TD 1VBA4 2RS34 2RR14 2RS54 1RHI4 4Q4V4 1ASJ4 1R094 1NA1D 1HRV4 1MQTD 1RUC4 1PIV4 1RUE4 1COV4 1AR94 4RHV4 2HWB4 4GB34 1VRH4 2RM24 1POV0 1K5MD 1PO14 2PLV4 2R074 3JD74 4Q4W4 1Z7S4 1RMU4 1NCQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EV1 4;  1R08 4;  2R06 4;  1D4M 4;  2RS1 4;  1PVC 4;  4Q4X 4;  1HRI 4;  1VBE 4;  1VBC 4;  1RUI 4;  1AL2 4;  1AR6 4;  1OOP D;  1RVF 4;  1RUD 4;  1VBB 4;  2HWC 4;  2RMU 4;  2X5I D;  3J8F 4;  4Q4Y 4;  1EAH 4;  1PO2 4;  1RUH 4;  1AR8 4;  1HXS 4;  1AR7 4;  1RUG 4;  1BEV 4;  2R04 4;  3JBG 4;  4PDW D;  1VBD 4;  1RUJ 4;  1RUF 4;  1H8T D;  1VBA 4;  2RS3 4;  2RR1 4;  2RS5 4;  1RHI 4;  4Q4V 4;  1ASJ 4;  1R09 4;  1NA1 D;  1HRV 4;  1MQT D;  1RUC 4;  1PIV 4;  1RUE 4;  1COV 4;  1AR9 4;  4RHV 4;  2HWB 4;  4GB3 4;  1VRH 4;  2RM2 4;  1POV 0;  1K5M D;  1PO1 4;  2PLV 4;  2R07 4;  3JD7 4;  4Q4W 4;  1Z7S 4;  1RMU 4;  1NCQ D; 
#chains in the Genus database with same CATH topology
 4YTP A;  2H88 A;  2PZS A;  3AE7 A;  1D4M 4;  4Q4X 4;  1XHX A;  3GQH A;  1VBE 4;  3J8F 4;  2X5I D;  1RUG 4;  3JBG 4;  1L0V A;  2WU2 A;  1KF6 A;  1VBA 4;  2FBW A;  1ASJ 4;  1NA1 D;  4RHV 4;  1NEK A;  2R07 4;  4Q4W 4;  4YT0 A;  1EV1 4;  3AE2 A;  2RS1 4;  4YSX A;  5C2T A;  3AE4 A;  2R7F A;  3SUC A;  3VR9 A;  3ABV A;  1OOP D;  1AR6 4;  1RUD 4;  2HWC 4;  2RMU 4;  3VRB A;  3GQK A;  1AR8 4;  4PDW D;  1RUJ 4;  1H8T D;  2RS3 4;  2RR1 4;  1RHI 4;  2WDR A;  3AEA A;  1MQT D;  1RUC 4;  1RUE 4;  3CIR A;  1COV 4;  1AR9 4;  1ZP0 A;  3AED A;  1VRH 4;  2RM2 4;  3AE5 A;  2PLV 4;  2WDQ A;  3JD7 4;  3AEF A;  1XHZ A;  1RMU 4;  1NCQ D;  3AE8 A;  1ZOY A;  1PVC 4;  1HRI 4;  1VBC 4;  3AEB A;  3AEC A;  1RUI 4;  4YTN A;  1KFY A;  2PY5 A;  1PO2 4;  3P4R A;  3AE3 A;  1HXS 4;  1AR7 4;  3SFD A;  1YQ3 A;  2R04 4;  3AEE A;  4YXD A;  2WU5 A;  1YQ4 A;  3AEG A;  1R09 4;  2ACZ A;  4YSY A;  3AE1 A;  1POV 0;  5C3J A;  1K5M D;  3AE6 A;  3FI7 A;  4YTM A;  1Z7S 4;  3P4P A;  1R08 4;  4KX6 A;  2R06 4;  2PYJ A;  3P4Q A;  2WP9 A;  3VR8 A;  1AL2 4;  1VBB 4;  1RVF 4;  2PW9 A;  2WS3 A;  3SFE A;  1XI1 A;  3VRA A;  4Q4Y 4;  1EAH 4;  1RUH 4;  1NEN A;  2EX3 A;  2WQY A;  1BEV 4;  4YSZ A;  1VBD 4;  1RUF 4;  2WDV A;  2RS5 4;  4Q4V 4;  1HRV 4;  2H89 A;  1PIV 4;  2HWB 4;  4GB3 4;  3P4S A;  1PO1 4;  2B76 A;  3AE9 A;  2PYL A; 
#chains in the Genus database with same CATH homology
 1EV1 4;  1R08 4;  2R06 4;  1D4M 4;  2RS1 4;  1PVC 4;  4Q4X 4;  1HRI 4;  1VBE 4;  1VBC 4;  1RUI 4;  1AL2 4;  1AR6 4;  1OOP D;  1RVF 4;  1RUD 4;  1VBB 4;  2HWC 4;  2RMU 4;  2X5I D;  3J8F 4;  4Q4Y 4;  1EAH 4;  1PO2 4;  1RUH 4;  1AR8 4;  1HXS 4;  1AR7 4;  1RUG 4;  1BEV 4;  2R04 4;  3JBG 4;  4PDW D;  1VBD 4;  1RUJ 4;  1RUF 4;  1H8T D;  1VBA 4;  2RS3 4;  2RR1 4;  2RS5 4;  1RHI 4;  4Q4V 4;  1ASJ 4;  1R09 4;  1NA1 D;  1HRV 4;  1MQT D;  1RUC 4;  1PIV 4;  1RUE 4;  1COV 4;  1AR9 4;  4RHV 4;  2HWB 4;  4GB3 4;  1VRH 4;  2RM2 4;  1POV 0;  1K5M D;  1PO1 4;  2PLV 4;  2R07 4;  3JD7 4;  4Q4W 4;  1Z7S 4;  1RMU 4;  1NCQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...