1COV4

Coxsackievirus b3 coat protein
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
55
Chain Sequence
GAQVSTQKTGIHYTNINYYKDAASNSANRQDFTQDPSKFTEPVKDIMIKSLPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords COXSACKIEVIRUS COAT PROTEIN
publication title Structure determination of coxsackievirus B3 to 3.5 A resolution.
pubmed doi rcsb
total genus 3
structure length 55
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1994-10-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1cov400
2PLV4 1OOPD 1RUH4 1PVC4 4Q4W4 1AR64 1RUF4 4Q4V4 1D4M4 1HRI4 1RHI4 1AR84 1RUJ4 2X5ID 1RUC4 1VBA4 4Q4Y4 1RMU4 4RHV4 1PIV4 2RMU4 1EV14 1H8TD 1K5MD 1NA1D 1RUI4 2HWB4 2RR14 1HRV4 1VRH4 2HWC4 1R084 1VBB4 1AR74 2RS34 1ASJ4 1HXS4 1MQTD 2R044 1VBC4 4GB34 1BEV4 1Z7S4 1EAH4 3JD74 1RUD4 1PO24 1VBD4 2R074 2RM24 1COV4 1PO14 3JBG4 2RS54 1RUE4 4Q4X4 2RS14 1AR94 1NCQD 1POV0 1RUG4 1R094 1RVF4 1VBE4 3J8F4 1AL24 2R064 4PDWD
chains in the Genus database with same CATH superfamily
2PLV4 1D4M4 1HRI4 3VRAA 2H89A 2B76A 4RHV4 3AECA 2RMU4 1EV14 1H8TD 1K5MD 1RUI4 3P4SA 1HRV4 1R084 4YTNA 2R7FA 1VBC4 4KX6A 3AEBA 1PO24 1PO14 4YSZA 2FBWA 2RS54 2PYJA 1XHXA 3AEEA 3AE3A 1POV0 3ABVA 2R064 3JBG4 3VR8A 1AR64 3CIRA 3AEGA 1AR84 1RUJ4 1XI1A 1NA1D 2HWB4 1YQ4A 3FI7A 2WU2A 1VRH4 3VR9A 3AE4A 1HXS4 1MQTD 1L0VA 2R044 4YXDA 1BEV4 1Z7S4 1EAH4 2EX3A 1VBD4 3SFEA 3AEFA 1XHZA 1COV4 4YTPA 5C2TA 1RUE4 3P4RA 3VRBA 4YSYA 3SFDA 1VBE4 1R094 1AL24 2WDRA 1OOPD 3AEDA 4Q4V4 4Q4Y4 1VBA4 1RMU4 3AE8A 1PIV4 2PW9A 2WU5A 1NENA 2HWC4 2RS34 1AR74 1ASJ4 3AE9A 4GB34 1RUD4 2PYLA 1NCQD 1RUG4 3J8F4 1RVF4 1KFYA 2WDQA 3SUCA 1YQ3A 1RUH4 1PVC4 3AE1A 4Q4W4 1RUF4 1ZP0A 1RHI4 4YTMA 2PY5A 2X5ID 1RUC4 3AE5A 2H88A 2RR14 2WS3A 3GQHA 2WDVA 1VBB4 1KF6A 2WP9A 3AE6A 1NEKA 2ACZA 3P4PA 4YT0A 3JD74 2R074 3P4QA 2RM24 4YSXA 2WQYA 3AE2A 2PZSA 3AE7A 1ZOYA 4Q4X4 2RS14 1AR94 3AEAA 4PDWD 5C3JA 3GQKA
chains in the Genus database with same CATH topology
2PLV4 1OOPD 1RUH4 1PVC4 4Q4W4 1AR64 1RUF4 4Q4V4 1D4M4 1HRI4 1RHI4 1AR84 1RUJ4 2X5ID 1RUC4 1VBA4 4Q4Y4 1RMU4 4RHV4 1PIV4 2RMU4 1EV14 1H8TD 1K5MD 1NA1D 1RUI4 2HWB4 2RR14 1HRV4 1VRH4 2HWC4 1R084 1VBB4 1AR74 2RS34 1ASJ4 1HXS4 1MQTD 2R044 1VBC4 4GB34 1BEV4 1Z7S4 1EAH4 3JD74 1RUD4 1PO24 1VBD4 2R074 2RM24 1COV4 1PO14 3JBG4 2RS54 1RUE4 4Q4X4 2RS14 1AR94 1NCQD 1POV0 1RUG4 1R094 1RVF4 1VBE4 3J8F4 1AL24 2R064 4PDWD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PLV 4;  1OOP D;  1RUH 4;  1PVC 4;  4Q4W 4;  1AR6 4;  1RUF 4;  4Q4V 4;  1D4M 4;  1HRI 4;  1RHI 4;  1AR8 4;  1RUJ 4;  2X5I D;  1RUC 4;  1VBA 4;  4Q4Y 4;  1RMU 4;  4RHV 4;  1PIV 4;  2RMU 4;  1EV1 4;  1H8T D;  1K5M D;  1NA1 D;  1RUI 4;  2HWB 4;  2RR1 4;  1HRV 4;  1VRH 4;  2HWC 4;  1R08 4;  1VBB 4;  1AR7 4;  2RS3 4;  1ASJ 4;  1HXS 4;  1MQT D;  2R04 4;  1VBC 4;  4GB3 4;  1BEV 4;  1Z7S 4;  1EAH 4;  3JD7 4;  1RUD 4;  1PO2 4;  1VBD 4;  2R07 4;  2RM2 4;  1COV 4;  1PO1 4;  3JBG 4;  2RS5 4;  1RUE 4;  4Q4X 4;  2RS1 4;  1AR9 4;  1NCQ D;  1POV 0;  1RUG 4;  1R09 4;  1RVF 4;  1VBE 4;  3J8F 4;  1AL2 4;  2R06 4;  4PDW D; 
#chains in the Genus database with same CATH topology
 2PLV 4;  1D4M 4;  1HRI 4;  3VRA A;  2H89 A;  2B76 A;  4RHV 4;  3AEC A;  2RMU 4;  1EV1 4;  1H8T D;  1K5M D;  1RUI 4;  3P4S A;  1HRV 4;  1R08 4;  4YTN A;  2R7F A;  1VBC 4;  4KX6 A;  3AEB A;  1PO2 4;  1PO1 4;  4YSZ A;  2FBW A;  2RS5 4;  2PYJ A;  1XHX A;  3AEE A;  3AE3 A;  1POV 0;  3ABV A;  2R06 4;  3JBG 4;  3VR8 A;  1AR6 4;  3CIR A;  3AEG A;  1AR8 4;  1RUJ 4;  1XI1 A;  1NA1 D;  2HWB 4;  1YQ4 A;  3FI7 A;  2WU2 A;  1VRH 4;  3VR9 A;  3AE4 A;  1HXS 4;  1MQT D;  1L0V A;  2R04 4;  4YXD A;  1BEV 4;  1Z7S 4;  1EAH 4;  2EX3 A;  1VBD 4;  3SFE A;  3AEF A;  1XHZ A;  1COV 4;  4YTP A;  5C2T A;  1RUE 4;  3P4R A;  3VRB A;  4YSY A;  3SFD A;  1VBE 4;  1R09 4;  1AL2 4;  2WDR A;  1OOP D;  3AED A;  4Q4V 4;  4Q4Y 4;  1VBA 4;  1RMU 4;  3AE8 A;  1PIV 4;  2PW9 A;  2WU5 A;  1NEN A;  2HWC 4;  2RS3 4;  1AR7 4;  1ASJ 4;  3AE9 A;  4GB3 4;  1RUD 4;  2PYL A;  1NCQ D;  1RUG 4;  3J8F 4;  1RVF 4;  1KFY A;  2WDQ A;  3SUC A;  1YQ3 A;  1RUH 4;  1PVC 4;  3AE1 A;  4Q4W 4;  1RUF 4;  1ZP0 A;  1RHI 4;  4YTM A;  2PY5 A;  2X5I D;  1RUC 4;  3AE5 A;  2H88 A;  2RR1 4;  2WS3 A;  3GQH A;  2WDV A;  1VBB 4;  1KF6 A;  2WP9 A;  3AE6 A;  1NEK A;  2ACZ A;  3P4P A;  4YT0 A;  3JD7 4;  2R07 4;  3P4Q A;  2RM2 4;  4YSX A;  2WQY A;  3AE2 A;  2PZS A;  3AE7 A;  1ZOY A;  4Q4X 4;  2RS1 4;  1AR9 4;  3AEA A;  4PDW D;  5C3J A;  3GQK A; 
#chains in the Genus database with same CATH homology
 2PLV 4;  1OOP D;  1RUH 4;  1PVC 4;  4Q4W 4;  1AR6 4;  1RUF 4;  4Q4V 4;  1D4M 4;  1HRI 4;  1RHI 4;  1AR8 4;  1RUJ 4;  2X5I D;  1RUC 4;  1VBA 4;  4Q4Y 4;  1RMU 4;  4RHV 4;  1PIV 4;  2RMU 4;  1EV1 4;  1H8T D;  1K5M D;  1NA1 D;  1RUI 4;  2HWB 4;  2RR1 4;  1HRV 4;  1VRH 4;  2HWC 4;  1R08 4;  1VBB 4;  1AR7 4;  2RS3 4;  1ASJ 4;  1HXS 4;  1MQT D;  2R04 4;  1VBC 4;  4GB3 4;  1BEV 4;  1Z7S 4;  1EAH 4;  3JD7 4;  1RUD 4;  1PO2 4;  1VBD 4;  2R07 4;  2RM2 4;  1COV 4;  1PO1 4;  3JBG 4;  2RS5 4;  1RUE 4;  4Q4X 4;  2RS1 4;  1AR9 4;  1NCQ D;  1POV 0;  1RUG 4;  1R09 4;  1RVF 4;  1VBE 4;  3J8F 4;  1AL2 4;  2R06 4;  4PDW D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...