1D4M4

The crystal structure of coxsackievirus a9 to 2.9 a resolution
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
68
structure length
61
Chain Sequence
GAQVSTQKTGAHETSIIHYTNINYYKDAASNSANRQDFTQDPSKFTEPVKDVMIKSLPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PROTEIN (COXSACKIEVIRUS A9)
publication title The crystal structure of coxsackievirus A9: new insights into the uncoating mechanisms of enteroviruses.
pubmed doi rcsb
total genus 4
structure length 61
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1999-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1d4m400
1NA1D 1AR64 2PLV4 1COV4 1VRH4 4GB34 2X5ID 1VBD4 1Z7S4 1PVC4 1K5MD 2R064 1VBC4 1VBB4 4Q4X4 2R074 1AR84 1R094 1AR74 1OOPD 1PO14 1RUG4 1RUE4 1ASJ4 1MQTD 1RVF4 1RUH4 1RUI4 2RS54 1HRV4 4Q4V4 1H8TD 1RUJ4 1HXS4 4PDWD 1AR94 1EV14 1BEV4 1AL24 2RMU4 2RS14 3JD74 3J8F4 1POV0 2R044 4Q4Y4 1RMU4 2RS34 1PIV4 1R084 1RUC4 1RUF4 2HWC4 2HWB4 1VBA4 2RR14 3JBG4 1RUD4 1RHI4 1VBE4 2RM24 1HRI4 1D4M4 4Q4W4 1PO24 1NCQD 1EAH4 4RHV4
chains in the Genus database with same CATH superfamily
4GB34 2H88A 3AE5A 2WDRA 3VR9A 3AEBA 1AR74 1OOPD 3GQHA 1RVF4 1RUI4 2RS54 1KFYA 1ZP0A 2WS3A 4YTNA 1AR94 1BEV4 1XI1A 1POV0 2RR14 3SUCA 3JBG4 3P4PA 2WDQA 3GQKA 1PO24 4YTMA 2PYJA 4RHV4 1NA1D 2R7FA 2PLV4 4YTPA 2PYLA 4YSYA 3P4QA 1VBD4 3SFDA 1AR84 3AE6A 1R094 3AEAA 3AE2A 1RUJ4 3AEFA 3AEDA 4PDWD 2RMU4 3J8F4 2HWB4 2HWC4 2WU2A 1L0VA 1RUD4 1YQ4A 1NEKA 1VBE4 3AE1A 1D4M4 1NCQD 5C3JA 1COV4 2WP9A 2X5ID 1Z7S4 1YQ3A 4YSXA 1PO14 1RUE4 1NENA 1ASJ4 1RUH4 3VRBA 2ACZA 3AECA 4Q4V4 1H8TD 1HXS4 4KX6A 3AEEA 1EV14 3CIRA 4YT0A 2R044 2RS34 1XHXA 1PIV4 1RUC4 4Q4Y4 1RUF4 2WDVA 4YXDA 1VBA4 4YSZA 2FBWA 2EX3A 3AE8A 2H89A 2RM24 3P4SA 1AL24 3VRAA 3AE3A 1AR64 1VRH4 2B76A 2PW9A 3FI7A 1PVC4 1K5MD 2R064 1VBC4 1VBB4 4Q4X4 2R074 5C2TA 1RUG4 3VR8A 1MQTD 3AE9A 3P4RA 1HRV4 3AE7A 3ABVA 3AE4A 2WU5A 2PZSA 2RS14 3JD74 2PY5A 1RMU4 1R084 1RHI4 3AEGA 1XHZA 2WQYA 1HRI4 3SFEA 4Q4W4 1KF6A 1ZOYA 1EAH4
chains in the Genus database with same CATH topology
1NA1D 1AR64 2PLV4 1COV4 1VRH4 4GB34 2X5ID 1VBD4 1Z7S4 1PVC4 1K5MD 2R064 1VBC4 1VBB4 4Q4X4 2R074 1AR84 1R094 1AR74 1OOPD 1PO14 1RUG4 1RUE4 1ASJ4 1MQTD 1RVF4 1RUH4 1RUI4 2RS54 1HRV4 4Q4V4 1H8TD 1RUJ4 1HXS4 4PDWD 1AR94 1EV14 1BEV4 1AL24 2RMU4 2RS14 3JD74 3J8F4 1POV0 2R044 4Q4Y4 1RMU4 2RS34 1PIV4 1R084 1RUC4 1RUF4 2HWC4 2HWB4 1VBA4 2RR14 3JBG4 1RUD4 1RHI4 1VBE4 2RM24 1HRI4 1D4M4 4Q4W4 1PO24 1NCQD 1EAH4 4RHV4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NA1 D;  1AR6 4;  2PLV 4;  1COV 4;  1VRH 4;  4GB3 4;  2X5I D;  1VBD 4;  1Z7S 4;  1PVC 4;  1K5M D;  2R06 4;  1VBC 4;  1VBB 4;  4Q4X 4;  2R07 4;  1AR8 4;  1R09 4;  1AR7 4;  1OOP D;  1PO1 4;  1RUG 4;  1RUE 4;  1ASJ 4;  1MQT D;  1RVF 4;  1RUH 4;  1RUI 4;  2RS5 4;  1HRV 4;  4Q4V 4;  1H8T D;  1RUJ 4;  1HXS 4;  4PDW D;  1AR9 4;  1EV1 4;  1BEV 4;  1AL2 4;  2RMU 4;  2RS1 4;  3JD7 4;  3J8F 4;  1POV 0;  2R04 4;  4Q4Y 4;  1RMU 4;  2RS3 4;  1PIV 4;  1R08 4;  1RUC 4;  1RUF 4;  2HWC 4;  2HWB 4;  1VBA 4;  2RR1 4;  3JBG 4;  1RUD 4;  1RHI 4;  1VBE 4;  2RM2 4;  1HRI 4;  1D4M 4;  4Q4W 4;  1PO2 4;  1NCQ D;  1EAH 4;  4RHV 4; 
#chains in the Genus database with same CATH topology
 4GB3 4;  2H88 A;  3AE5 A;  2WDR A;  3VR9 A;  3AEB A;  1AR7 4;  1OOP D;  3GQH A;  1RVF 4;  1RUI 4;  2RS5 4;  1KFY A;  1ZP0 A;  2WS3 A;  4YTN A;  1AR9 4;  1BEV 4;  1XI1 A;  1POV 0;  2RR1 4;  3SUC A;  3JBG 4;  3P4P A;  2WDQ A;  3GQK A;  1PO2 4;  4YTM A;  2PYJ A;  4RHV 4;  1NA1 D;  2R7F A;  2PLV 4;  4YTP A;  2PYL A;  4YSY A;  3P4Q A;  1VBD 4;  3SFD A;  1AR8 4;  3AE6 A;  1R09 4;  3AEA A;  3AE2 A;  1RUJ 4;  3AEF A;  3AED A;  4PDW D;  2RMU 4;  3J8F 4;  2HWB 4;  2HWC 4;  2WU2 A;  1L0V A;  1RUD 4;  1YQ4 A;  1NEK A;  1VBE 4;  3AE1 A;  1D4M 4;  1NCQ D;  5C3J A;  1COV 4;  2WP9 A;  2X5I D;  1Z7S 4;  1YQ3 A;  4YSX A;  1PO1 4;  1RUE 4;  1NEN A;  1ASJ 4;  1RUH 4;  3VRB A;  2ACZ A;  3AEC A;  4Q4V 4;  1H8T D;  1HXS 4;  4KX6 A;  3AEE A;  1EV1 4;  3CIR A;  4YT0 A;  2R04 4;  2RS3 4;  1XHX A;  1PIV 4;  1RUC 4;  4Q4Y 4;  1RUF 4;  2WDV A;  4YXD A;  1VBA 4;  4YSZ A;  2FBW A;  2EX3 A;  3AE8 A;  2H89 A;  2RM2 4;  3P4S A;  1AL2 4;  3VRA A;  3AE3 A;  1AR6 4;  1VRH 4;  2B76 A;  2PW9 A;  3FI7 A;  1PVC 4;  1K5M D;  2R06 4;  1VBC 4;  1VBB 4;  4Q4X 4;  2R07 4;  5C2T A;  1RUG 4;  3VR8 A;  1MQT D;  3AE9 A;  3P4R A;  1HRV 4;  3AE7 A;  3ABV A;  3AE4 A;  2WU5 A;  2PZS A;  2RS1 4;  3JD7 4;  2PY5 A;  1RMU 4;  1R08 4;  1RHI 4;  3AEG A;  1XHZ A;  2WQY A;  1HRI 4;  3SFE A;  4Q4W 4;  1KF6 A;  1ZOY A;  1EAH 4; 
#chains in the Genus database with same CATH homology
 1NA1 D;  1AR6 4;  2PLV 4;  1COV 4;  1VRH 4;  4GB3 4;  2X5I D;  1VBD 4;  1Z7S 4;  1PVC 4;  1K5M D;  2R06 4;  1VBC 4;  1VBB 4;  4Q4X 4;  2R07 4;  1AR8 4;  1R09 4;  1AR7 4;  1OOP D;  1PO1 4;  1RUG 4;  1RUE 4;  1ASJ 4;  1MQT D;  1RVF 4;  1RUH 4;  1RUI 4;  2RS5 4;  1HRV 4;  4Q4V 4;  1H8T D;  1RUJ 4;  1HXS 4;  4PDW D;  1AR9 4;  1EV1 4;  1BEV 4;  1AL2 4;  2RMU 4;  2RS1 4;  3JD7 4;  3J8F 4;  1POV 0;  2R04 4;  4Q4Y 4;  1RMU 4;  2RS3 4;  1PIV 4;  1R08 4;  1RUC 4;  1RUF 4;  2HWC 4;  2HWB 4;  1VBA 4;  2RR1 4;  3JBG 4;  1RUD 4;  1RHI 4;  1VBE 4;  2RM2 4;  1HRI 4;  1D4M 4;  4Q4W 4;  1PO2 4;  1NCQ D;  1EAH 4;  4RHV 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...