1RUC4

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ruc400
1PVC4 1AR74 3J8F4 2R044 2R074 4Q4W4 1RUF4 1NA1D 2R064 1PO14 2RS54 1POV0 1RUD4 2RMU4 1R084 1VBC4 3JD74 1Z7S4 4GB34 1HRV4 1BEV4 1PO24 2RM24 1D4M4 1OOPD 1AR94 1RUC4 2HWB4 4Q4X4 1HXS4 1VBE4 1RUH4 1NCQD 1EV14 1RUJ4 1RVF4 1COV4 1RHI4 1RUE4 1AR64 1VRH4 4PDWD 4Q4V4 1K5MD 1PIV4 1RMU4 1VBA4 2X5ID 1AL24 1HRI4 4Q4Y4 4RHV4 1H8TD 1EAH4 1ASJ4 1RUI4 1R094 2RR14 2RS34 2RS14 3JBG4 1MQTD 1AR84 2HWC4 1RUG4 1VBD4 2PLV4 1VBB4
chains in the Genus database with same CATH superfamily
3VRAA 2R044 1RUF4 1NA1D 2R064 2RS54 1POV0 3SUCA 1VBC4 3FI7A 3GQKA 3VRBA 4GB34 1XHZA 1BEV4 1PO24 3AE3A 1RUC4 3P4SA 2HWB4 1HXS4 1RUH4 2FBWA 3AE4A 1EV14 3AEFA 1RUE4 2WDVA 2PYLA 1KFYA 2PW9A 4YXDA 3JBG4 1RUI4 1YQ4A 2HWC4 4YTMA 1RUG4 1VBD4 2H88A 2R074 2WDRA 4YSXA 1RUD4 2R7FA 4YSZA 4YTPA 3AE2A 1HRV4 4YT0A 3AEDA 3P4QA 1XHXA 2B76A 2RM24 4KX6A 1RUJ4 2EX3A 2PZSA 2PY5A 3AE1A 1VBA4 3CIRA 1HRI4 3AECA 2RS14 1H8TD 1ASJ4 2RR14 1NEKA 3GQHA 3AEBA 2PLV4 1AR74 3J8F4 3VR9A 1L0VA 2RMU4 1R084 3SFEA 1D4M4 1XI1A 3P4RA 4Q4X4 1VBE4 1NCQD 1KF6A 1RVF4 1RHI4 1AR64 1VRH4 4PDWD 4Q4V4 1PIV4 1RMU4 4Q4Y4 2WQYA 1ZOYA 2RS34 4YSYA 1YQ3A 2H89A 1MQTD 3ABVA 3AE6A 4YTNA 3AE5A 1PVC4 4Q4W4 1NENA 1PO14 2ACZA 3AE9A 2WP9A 5C3JA 1ZP0A 2WU5A 3JD74 3AEAA 1Z7S4 2WU2A 3P4PA 1OOPD 1AR94 2WDQA 3SFDA 3AE7A 2PYJA 3VR8A 3AE8A 1COV4 3AEEA 1K5MD 2X5ID 1AL24 4RHV4 1EAH4 2WS3A 1R094 5C2TA 3AEGA 1AR84 1VBB4
chains in the Genus database with same CATH topology
1PVC4 1AR74 3J8F4 2R044 2R074 4Q4W4 1RUF4 1NA1D 2R064 1PO14 2RS54 1POV0 1RUD4 2RMU4 1R084 1VBC4 3JD74 1Z7S4 4GB34 1HRV4 1BEV4 1PO24 2RM24 1D4M4 1OOPD 1AR94 1RUC4 2HWB4 4Q4X4 1HXS4 1VBE4 1RUH4 1NCQD 1EV14 1RUJ4 1RVF4 1COV4 1RHI4 1RUE4 1AR64 1VRH4 4PDWD 4Q4V4 1K5MD 1PIV4 1RMU4 1VBA4 2X5ID 1AL24 1HRI4 4Q4Y4 4RHV4 1H8TD 1EAH4 1ASJ4 1RUI4 1R094 2RR14 2RS34 2RS14 3JBG4 1MQTD 1AR84 2HWC4 1RUG4 1VBD4 2PLV4 1VBB4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVC 4;  1AR7 4;  3J8F 4;  2R04 4;  2R07 4;  4Q4W 4;  1RUF 4;  1NA1 D;  2R06 4;  1PO1 4;  2RS5 4;  1POV 0;  1RUD 4;  2RMU 4;  1R08 4;  1VBC 4;  3JD7 4;  1Z7S 4;  4GB3 4;  1HRV 4;  1BEV 4;  1PO2 4;  2RM2 4;  1D4M 4;  1OOP D;  1AR9 4;  1RUC 4;  2HWB 4;  4Q4X 4;  1HXS 4;  1VBE 4;  1RUH 4;  1NCQ D;  1EV1 4;  1RUJ 4;  1RVF 4;  1COV 4;  1RHI 4;  1RUE 4;  1AR6 4;  1VRH 4;  4PDW D;  4Q4V 4;  1K5M D;  1PIV 4;  1RMU 4;  1VBA 4;  2X5I D;  1AL2 4;  1HRI 4;  4Q4Y 4;  4RHV 4;  1H8T D;  1EAH 4;  1ASJ 4;  1RUI 4;  1R09 4;  2RR1 4;  2RS3 4;  2RS1 4;  3JBG 4;  1MQT D;  1AR8 4;  2HWC 4;  1RUG 4;  1VBD 4;  2PLV 4;  1VBB 4; 
#chains in the Genus database with same CATH topology
 3VRA A;  2R04 4;  1RUF 4;  1NA1 D;  2R06 4;  2RS5 4;  1POV 0;  3SUC A;  1VBC 4;  3FI7 A;  3GQK A;  3VRB A;  4GB3 4;  1XHZ A;  1BEV 4;  1PO2 4;  3AE3 A;  1RUC 4;  3P4S A;  2HWB 4;  1HXS 4;  1RUH 4;  2FBW A;  3AE4 A;  1EV1 4;  3AEF A;  1RUE 4;  2WDV A;  2PYL A;  1KFY A;  2PW9 A;  4YXD A;  3JBG 4;  1RUI 4;  1YQ4 A;  2HWC 4;  4YTM A;  1RUG 4;  1VBD 4;  2H88 A;  2R07 4;  2WDR A;  4YSX A;  1RUD 4;  2R7F A;  4YSZ A;  4YTP A;  3AE2 A;  1HRV 4;  4YT0 A;  3AED A;  3P4Q A;  1XHX A;  2B76 A;  2RM2 4;  4KX6 A;  1RUJ 4;  2EX3 A;  2PZS A;  2PY5 A;  3AE1 A;  1VBA 4;  3CIR A;  1HRI 4;  3AEC A;  2RS1 4;  1H8T D;  1ASJ 4;  2RR1 4;  1NEK A;  3GQH A;  3AEB A;  2PLV 4;  1AR7 4;  3J8F 4;  3VR9 A;  1L0V A;  2RMU 4;  1R08 4;  3SFE A;  1D4M 4;  1XI1 A;  3P4R A;  4Q4X 4;  1VBE 4;  1NCQ D;  1KF6 A;  1RVF 4;  1RHI 4;  1AR6 4;  1VRH 4;  4PDW D;  4Q4V 4;  1PIV 4;  1RMU 4;  4Q4Y 4;  2WQY A;  1ZOY A;  2RS3 4;  4YSY A;  1YQ3 A;  2H89 A;  1MQT D;  3ABV A;  3AE6 A;  4YTN A;  3AE5 A;  1PVC 4;  4Q4W 4;  1NEN A;  1PO1 4;  2ACZ A;  3AE9 A;  2WP9 A;  5C3J A;  1ZP0 A;  2WU5 A;  3JD7 4;  3AEA A;  1Z7S 4;  2WU2 A;  3P4P A;  1OOP D;  1AR9 4;  2WDQ A;  3SFD A;  3AE7 A;  2PYJ A;  3VR8 A;  3AE8 A;  1COV 4;  3AEE A;  1K5M D;  2X5I D;  1AL2 4;  4RHV 4;  1EAH 4;  2WS3 A;  1R09 4;  5C2T A;  3AEG A;  1AR8 4;  1VBB 4; 
#chains in the Genus database with same CATH homology
 1PVC 4;  1AR7 4;  3J8F 4;  2R04 4;  2R07 4;  4Q4W 4;  1RUF 4;  1NA1 D;  2R06 4;  1PO1 4;  2RS5 4;  1POV 0;  1RUD 4;  2RMU 4;  1R08 4;  1VBC 4;  3JD7 4;  1Z7S 4;  4GB3 4;  1HRV 4;  1BEV 4;  1PO2 4;  2RM2 4;  1D4M 4;  1OOP D;  1AR9 4;  1RUC 4;  2HWB 4;  4Q4X 4;  1HXS 4;  1VBE 4;  1RUH 4;  1NCQ D;  1EV1 4;  1RUJ 4;  1RVF 4;  1COV 4;  1RHI 4;  1RUE 4;  1AR6 4;  1VRH 4;  4PDW D;  4Q4V 4;  1K5M D;  1PIV 4;  1RMU 4;  1VBA 4;  2X5I D;  1AL2 4;  1HRI 4;  4Q4Y 4;  4RHV 4;  1H8T D;  1EAH 4;  1ASJ 4;  1RUI 4;  1R09 4;  2RR1 4;  2RS3 4;  2RS1 4;  3JBG 4;  1MQT D;  1AR8 4;  2HWC 4;  1RUG 4;  1VBD 4;  2PLV 4;  1VBB 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...