1RUC4

Rhinovirus 14 mutant n1105s complexed with antiviral compound win 52035
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ruc400
2X5ID 1RUE4 1K5MD 1VBB4 1RMU4 2RMU4 1AR64 1R094 1AR74 1RUI4 1HRI4 1PIV4 1VBE4 2R064 3JBG4 1HXS4 1EAH4 1PO24 3J8F4 4GB34 1NA1D 2RM24 3JD74 1VBD4 2PLV4 4Q4Y4 1COV4 1RUF4 1ASJ4 1AR84 1MQTD 1EV14 1RUG4 1VBA4 4Q4W4 4Q4V4 1PO14 1Z7S4 4PDWD 4Q4X4 1OOPD 2HWB4 1H8TD 2HWC4 1R084 1RUD4 2RS54 1HRV4 2R074 1NCQD 1PVC4 1VBC4 2RS14 2RR14 4RHV4 1D4M4 1RHI4 1RUC4 1RUH4 1AL24 2R044 2RS34 1BEV4 1POV0 1AR94 1RVF4 1VRH4 1RUJ4
chains in the Genus database with same CATH superfamily
2PYLA 1KF6A 1K5MD 3AE6A 3CIRA 1AR74 1RUI4 2R064 4Q4X4 1VBE4 3JBG4 1EAH4 1XHZA 2WQYA 2RM24 3AE4A 3AEDA 1VBD4 4YSYA 1YQ4A 1AR84 4Q4V4 1VBA4 2WU5A 3AEAA 2PY5A 4PDWD 1OOPD 2HWB4 3AE8A 2HWC4 1RUD4 2B76A 3GQHA 3VRAA 4RHV4 3AE5A 3VR8A 3AEBA 3AEFA 1RUH4 3P4PA 3AEEA 2RS34 2PW9A 1RVF4 1XHXA 3P4SA 2X5ID 3SFDA 3P4QA 1R094 2WDRA 3VRBA 1HRI4 1ZP0A 1HXS4 1PO24 3J8F4 3JD74 1YQ3A 4YTNA 2PLV4 2EX3A 3AE1A 1COV4 1RUF4 1EV14 3SUCA 2WDQA 2H88A 2PYJA 3AE9A 4YSXA 1VBC4 1PVC4 1RUC4 3AE2A 1XI1A 2R044 1KFYA 1ZOYA 1NEKA 3SFEA 1AR94 3AE3A 2FBWA 1RUE4 1VBB4 1RMU4 1AR64 5C2TA 3VR9A 1PIV4 4YTPA 3FI7A 1NA1D 1RUG4 1PO14 3AE7A 1Z7S4 4YT0A 2H89A 1H8TD 2RS54 1HRV4 2R074 1NCQD 2RS14 1D4M4 1RHI4 2ACZA 3ABVA 3AEGA 5C3JA 4YSZA 2PZSA 1VRH4 1RUJ4 2RMU4 3AECA 2R7FA 3P4RA 4KX6A 1NENA 3GQKA 4YTMA 4Q4Y4 1ASJ4 1MQTD 4Q4W4 2WS3A 1L0VA 2WU2A 1R084 2RR14 4YXDA 1AL24 2WDVA 1BEV4 1POV0 2WP9A 4GB34
chains in the Genus database with same CATH topology
2X5ID 1RUE4 1K5MD 1VBB4 1RMU4 2RMU4 1AR64 1R094 1AR74 1RUI4 1HRI4 1PIV4 1VBE4 2R064 3JBG4 1HXS4 1EAH4 1PO24 3J8F4 4GB34 1NA1D 2RM24 3JD74 1VBD4 2PLV4 4Q4Y4 1COV4 1RUF4 1ASJ4 1AR84 1MQTD 1EV14 1RUG4 1VBA4 4Q4W4 4Q4V4 1PO14 1Z7S4 4PDWD 4Q4X4 1OOPD 2HWB4 1H8TD 2HWC4 1R084 1RUD4 2RS54 1HRV4 2R074 1NCQD 1PVC4 1VBC4 2RS14 2RR14 4RHV4 1D4M4 1RHI4 1RUC4 1RUH4 1AL24 2R044 2RS34 1BEV4 1POV0 1AR94 1RVF4 1VRH4 1RUJ4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X5I D;  1RUE 4;  1K5M D;  1VBB 4;  1RMU 4;  2RMU 4;  1AR6 4;  1R09 4;  1AR7 4;  1RUI 4;  1HRI 4;  1PIV 4;  1VBE 4;  2R06 4;  3JBG 4;  1HXS 4;  1EAH 4;  1PO2 4;  3J8F 4;  4GB3 4;  1NA1 D;  2RM2 4;  3JD7 4;  1VBD 4;  2PLV 4;  4Q4Y 4;  1COV 4;  1RUF 4;  1ASJ 4;  1AR8 4;  1MQT D;  1EV1 4;  1RUG 4;  1VBA 4;  4Q4W 4;  4Q4V 4;  1PO1 4;  1Z7S 4;  4PDW D;  4Q4X 4;  1OOP D;  2HWB 4;  1H8T D;  2HWC 4;  1R08 4;  1RUD 4;  2RS5 4;  1HRV 4;  2R07 4;  1NCQ D;  1PVC 4;  1VBC 4;  2RS1 4;  2RR1 4;  4RHV 4;  1D4M 4;  1RHI 4;  1RUC 4;  1RUH 4;  1AL2 4;  2R04 4;  2RS3 4;  1BEV 4;  1POV 0;  1AR9 4;  1RVF 4;  1VRH 4;  1RUJ 4; 
#chains in the Genus database with same CATH topology
 2PYL A;  1KF6 A;  1K5M D;  3AE6 A;  3CIR A;  1AR7 4;  1RUI 4;  2R06 4;  4Q4X 4;  1VBE 4;  3JBG 4;  1EAH 4;  1XHZ A;  2WQY A;  2RM2 4;  3AE4 A;  3AED A;  1VBD 4;  4YSY A;  1YQ4 A;  1AR8 4;  4Q4V 4;  1VBA 4;  2WU5 A;  3AEA A;  2PY5 A;  4PDW D;  1OOP D;  2HWB 4;  3AE8 A;  2HWC 4;  1RUD 4;  2B76 A;  3GQH A;  3VRA A;  4RHV 4;  3AE5 A;  3VR8 A;  3AEB A;  3AEF A;  1RUH 4;  3P4P A;  3AEE A;  2RS3 4;  2PW9 A;  1RVF 4;  1XHX A;  3P4S A;  2X5I D;  3SFD A;  3P4Q A;  1R09 4;  2WDR A;  3VRB A;  1HRI 4;  1ZP0 A;  1HXS 4;  1PO2 4;  3J8F 4;  3JD7 4;  1YQ3 A;  4YTN A;  2PLV 4;  2EX3 A;  3AE1 A;  1COV 4;  1RUF 4;  1EV1 4;  3SUC A;  2WDQ A;  2H88 A;  2PYJ A;  3AE9 A;  4YSX A;  1VBC 4;  1PVC 4;  1RUC 4;  3AE2 A;  1XI1 A;  2R04 4;  1KFY A;  1ZOY A;  1NEK A;  3SFE A;  1AR9 4;  3AE3 A;  2FBW A;  1RUE 4;  1VBB 4;  1RMU 4;  1AR6 4;  5C2T A;  3VR9 A;  1PIV 4;  4YTP A;  3FI7 A;  1NA1 D;  1RUG 4;  1PO1 4;  3AE7 A;  1Z7S 4;  4YT0 A;  2H89 A;  1H8T D;  2RS5 4;  1HRV 4;  2R07 4;  1NCQ D;  2RS1 4;  1D4M 4;  1RHI 4;  2ACZ A;  3ABV A;  3AEG A;  5C3J A;  4YSZ A;  2PZS A;  1VRH 4;  1RUJ 4;  2RMU 4;  3AEC A;  2R7F A;  3P4R A;  4KX6 A;  1NEN A;  3GQK A;  4YTM A;  4Q4Y 4;  1ASJ 4;  1MQT D;  4Q4W 4;  2WS3 A;  1L0V A;  2WU2 A;  1R08 4;  2RR1 4;  4YXD A;  1AL2 4;  2WDV A;  1BEV 4;  1POV 0;  2WP9 A;  4GB3 4; 
#chains in the Genus database with same CATH homology
 2X5I D;  1RUE 4;  1K5M D;  1VBB 4;  1RMU 4;  2RMU 4;  1AR6 4;  1R09 4;  1AR7 4;  1RUI 4;  1HRI 4;  1PIV 4;  1VBE 4;  2R06 4;  3JBG 4;  1HXS 4;  1EAH 4;  1PO2 4;  3J8F 4;  4GB3 4;  1NA1 D;  2RM2 4;  3JD7 4;  1VBD 4;  2PLV 4;  4Q4Y 4;  1COV 4;  1RUF 4;  1ASJ 4;  1AR8 4;  1MQT D;  1EV1 4;  1RUG 4;  1VBA 4;  4Q4W 4;  4Q4V 4;  1PO1 4;  1Z7S 4;  4PDW D;  4Q4X 4;  1OOP D;  2HWB 4;  1H8T D;  2HWC 4;  1R08 4;  1RUD 4;  2RS5 4;  1HRV 4;  2R07 4;  1NCQ D;  1PVC 4;  1VBC 4;  2RS1 4;  2RR1 4;  4RHV 4;  1D4M 4;  1RHI 4;  1RUC 4;  1RUH 4;  1AL2 4;  2R04 4;  2RS3 4;  1BEV 4;  1POV 0;  1AR9 4;  1RVF 4;  1VRH 4;  1RUJ 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...