2RMU4

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
b'INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rmu400
1AR74 1AR94 1RUC4 1RUG4 1NCQD 1RUE4 1VBC4 1VRH4 1H8TD 1Z7S4 2R074 1HRV4 1RVF4 2HWB4 1MQTD 2RMU4 1RUJ4 1D4M4 1AR84 1R094 1PVC4 1POV0 1RUH4 1RHI4 1K5MD 2HWC4 1OOPD 1NA1D 1BEV4 1HRI4 3J8F4 3JD74 1PO24 1VBB4 4PDWD 4RHV4 4Q4Y4 1ASJ4 1VBA4 1EAH4 1RUF4 2R064 1PO14 1VBE4 2RM24 1PIV4 2R044 2RR14 1HXS4 1RMU4 1AL24 4GB34 1VBD4 1COV4 1RUI4 2RS14 2RS34 2X5ID 2RS54 4Q4V4 4Q4X4 3JBG4 1RUD4 1R084 1AR64 2PLV4 4Q4W4 1EV14
chains in the Genus database with same CATH superfamily
1AR94 2PYJA 3AE7A 2WP9A 2PY5A 1D4M4 3SUCA 3VRAA 3AE5A 1K5MD 1OOPD 4YSXA 3VRBA 1PO24 4RHV4 1YQ4A 3AE1A 2RR14 1NENA 2WQYA 2RS14 2X5ID 4Q4V4 1RUD4 1AR64 3AEGA 1AR74 1RUE4 1RUG4 2R074 3P4QA 4YT0A 2WDVA 1Z7S4 2EX3A 5C2TA 4YTPA 2RMU4 1MQTD 2WU2A 1RUJ4 1PVC4 1RUH4 2PW9A 3AEFA 1XHXA 3AE2A 2PZSA 3P4RA 4YSZA 4Q4Y4 1RUF4 2R064 2B76A 3AEAA 4YSYA 3P4PA 3AE4A 3SFEA 3AECA 1L0VA 2WDQA 2H89A 2RS54 2WS3A 4Q4W4 3JD74 1H8TD 1NEKA 3P4SA 2HWB4 3VR8A 1AR84 1R094 1POV0 1RHI4 2HWC4 1BEV4 1HRI4 3CIRA 3J8F4 3AE9A 3AEEA 4PDWD 1ASJ4 2RM24 1VBE4 2R044 3ABVA 1HXS4 1RMU4 1AL24 4GB34 1COV4 3GQHA 3SFDA 1KFYA 2R7FA 1R084 2PLV4 1HRV4 1EV14 4YTNA 1VRH4 1RUC4 1NCQD 3GQKA 1VBC4 2PYLA 1YQ3A 1RVF4 2FBWA 4YXDA 3AE6A 1NA1D 1ZP0A 3AEDA 1VBB4 4KX6A 2ACZA 1VBA4 1EAH4 2WU5A 3AE8A 3FI7A 1PO14 1PIV4 3AEBA 1XHZA 1KF6A 1VBD4 1XI1A 4YTMA 1RUI4 1ZOYA 2RS34 3AE3A 5C3JA 4Q4X4 3JBG4 2WDRA 2H88A 3VR9A
chains in the Genus database with same CATH topology
1AR74 1AR94 1RUC4 1RUG4 1NCQD 1RUE4 1VBC4 1VRH4 1H8TD 1Z7S4 2R074 1HRV4 1RVF4 2HWB4 1MQTD 2RMU4 1RUJ4 1D4M4 1AR84 1R094 1PVC4 1POV0 1RUH4 1RHI4 1K5MD 2HWC4 1OOPD 1NA1D 1BEV4 1HRI4 3J8F4 3JD74 1PO24 1VBB4 4PDWD 4RHV4 4Q4Y4 1ASJ4 1VBA4 1EAH4 1RUF4 2R064 1PO14 1VBE4 2RM24 1PIV4 2R044 2RR14 1HXS4 1RMU4 1AL24 4GB34 1VBD4 1COV4 1RUI4 2RS14 2RS34 2X5ID 2RS54 4Q4V4 4Q4X4 3JBG4 1RUD4 1R084 1AR64 2PLV4 4Q4W4 1EV14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR7 4;  1AR9 4;  1RUC 4;  1RUG 4;  1NCQ D;  1RUE 4;  1VBC 4;  1VRH 4;  1H8T D;  1Z7S 4;  2R07 4;  1HRV 4;  1RVF 4;  2HWB 4;  1MQT D;  2RMU 4;  1RUJ 4;  1D4M 4;  1AR8 4;  1R09 4;  1PVC 4;  1POV 0;  1RUH 4;  1RHI 4;  1K5M D;  2HWC 4;  1OOP D;  1NA1 D;  1BEV 4;  1HRI 4;  3J8F 4;  3JD7 4;  1PO2 4;  1VBB 4;  4PDW D;  4RHV 4;  4Q4Y 4;  1ASJ 4;  1VBA 4;  1EAH 4;  1RUF 4;  2R06 4;  1PO1 4;  1VBE 4;  2RM2 4;  1PIV 4;  2R04 4;  2RR1 4;  1HXS 4;  1RMU 4;  1AL2 4;  4GB3 4;  1VBD 4;  1COV 4;  1RUI 4;  2RS1 4;  2RS3 4;  2X5I D;  2RS5 4;  4Q4V 4;  4Q4X 4;  3JBG 4;  1RUD 4;  1R08 4;  1AR6 4;  2PLV 4;  4Q4W 4;  1EV1 4; 
#chains in the Genus database with same CATH topology
 1AR9 4;  2PYJ A;  3AE7 A;  2WP9 A;  2PY5 A;  1D4M 4;  3SUC A;  3VRA A;  3AE5 A;  1K5M D;  1OOP D;  4YSX A;  3VRB A;  1PO2 4;  4RHV 4;  1YQ4 A;  3AE1 A;  2RR1 4;  1NEN A;  2WQY A;  2RS1 4;  2X5I D;  4Q4V 4;  1RUD 4;  1AR6 4;  3AEG A;  1AR7 4;  1RUE 4;  1RUG 4;  2R07 4;  3P4Q A;  4YT0 A;  2WDV A;  1Z7S 4;  2EX3 A;  5C2T A;  4YTP A;  2RMU 4;  1MQT D;  2WU2 A;  1RUJ 4;  1PVC 4;  1RUH 4;  2PW9 A;  3AEF A;  1XHX A;  3AE2 A;  2PZS A;  3P4R A;  4YSZ A;  4Q4Y 4;  1RUF 4;  2R06 4;  2B76 A;  3AEA A;  4YSY A;  3P4P A;  3AE4 A;  3SFE A;  3AEC A;  1L0V A;  2WDQ A;  2H89 A;  2RS5 4;  2WS3 A;  4Q4W 4;  3JD7 4;  1H8T D;  1NEK A;  3P4S A;  2HWB 4;  3VR8 A;  1AR8 4;  1R09 4;  1POV 0;  1RHI 4;  2HWC 4;  1BEV 4;  1HRI 4;  3CIR A;  3J8F 4;  3AE9 A;  3AEE A;  4PDW D;  1ASJ 4;  2RM2 4;  1VBE 4;  2R04 4;  3ABV A;  1HXS 4;  1RMU 4;  1AL2 4;  4GB3 4;  1COV 4;  3GQH A;  3SFD A;  1KFY A;  2R7F A;  1R08 4;  2PLV 4;  1HRV 4;  1EV1 4;  4YTN A;  1VRH 4;  1RUC 4;  1NCQ D;  3GQK A;  1VBC 4;  2PYL A;  1YQ3 A;  1RVF 4;  2FBW A;  4YXD A;  3AE6 A;  1NA1 D;  1ZP0 A;  3AED A;  1VBB 4;  4KX6 A;  2ACZ A;  1VBA 4;  1EAH 4;  2WU5 A;  3AE8 A;  3FI7 A;  1PO1 4;  1PIV 4;  3AEB A;  1XHZ A;  1KF6 A;  1VBD 4;  1XI1 A;  4YTM A;  1RUI 4;  1ZOY A;  2RS3 4;  3AE3 A;  5C3J A;  4Q4X 4;  3JBG 4;  2WDR A;  2H88 A;  3VR9 A; 
#chains in the Genus database with same CATH homology
 1AR7 4;  1AR9 4;  1RUC 4;  1RUG 4;  1NCQ D;  1RUE 4;  1VBC 4;  1VRH 4;  1H8T D;  1Z7S 4;  2R07 4;  1HRV 4;  1RVF 4;  2HWB 4;  1MQT D;  2RMU 4;  1RUJ 4;  1D4M 4;  1AR8 4;  1R09 4;  1PVC 4;  1POV 0;  1RUH 4;  1RHI 4;  1K5M D;  2HWC 4;  1OOP D;  1NA1 D;  1BEV 4;  1HRI 4;  3J8F 4;  3JD7 4;  1PO2 4;  1VBB 4;  4PDW D;  4RHV 4;  4Q4Y 4;  1ASJ 4;  1VBA 4;  1EAH 4;  1RUF 4;  2R06 4;  1PO1 4;  1VBE 4;  2RM2 4;  1PIV 4;  2R04 4;  2RR1 4;  1HXS 4;  1RMU 4;  1AL2 4;  4GB3 4;  1VBD 4;  1COV 4;  1RUI 4;  2RS1 4;  2RS3 4;  2X5I D;  2RS5 4;  4Q4V 4;  4Q4X 4;  3JBG 4;  1RUD 4;  1R08 4;  1AR6 4;  2PLV 4;  4Q4W 4;  1EV1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...