2RMU4

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rmu400
1BEV4 2R074 2HWB4 2RS54 1RVF4 1RUI4 1VBE4 1K5MD 4Q4X4 4Q4V4 1MQTD 1HXS4 4PDWD 1NCQD 1RHI4 1VBC4 1EV14 2RM24 2RS34 1R094 1COV4 1RUE4 2RMU4 1HRI4 1VRH4 4GB34 2PLV4 1POV0 3JD74 1VBD4 1PO14 2X5ID 2HWC4 1PO24 3JBG4 4Q4W4 4Q4Y4 1RUF4 1AR64 2RR14 1RUH4 1AL24 1OOPD 3J8F4 1RUG4 1RUJ4 2R064 1RMU4 1Z7S4 2R044 1VBB4 1EAH4 1H8TD 1PIV4 1R084 1RUC4 1ASJ4 1PVC4 1AR74 1AR84 1D4M4 1VBA4 1HRV4 1NA1D 2RS14 4RHV4 1RUD4 1AR94
chains in the Genus database with same CATH superfamily
3AEGA 2H88A 1HXS4 3AE2A 1YQ4A 4PDWD 2WU5A 1NEKA 1RHI4 2RM24 4GB34 3AE8A 3AE5A 1VBD4 3AEAA 3JBG4 3VRAA 1RUH4 1AL24 4YT0A 2R064 2R044 1XI1A 1H8TD 2H89A 1ASJ4 2WU2A 1YQ3A 1D4M4 4RHV4 1KF6A 4YXDA 1RUD4 1XHZA 2WQYA 3P4QA 3AEBA 1ZOYA 4KX6A 2PW9A 3AEEA 1RVF4 2PYJA 3VR8A 1K5MD 4Q4V4 3GQKA 1NCQD 1VBC4 1EV14 2RS34 2EX3A 2RMU4 3GQHA 3AECA 2B76A 4YTMA 1VBB4 2FBWA 1PIV4 3AE3A 1AR74 1AR84 4YSXA 1NA1D 3AEDA 1L0VA 3FI7A 2WS3A 5C2TA 3P4RA 4YSYA 2WDRA 1BEV4 2R074 2RS54 1RUI4 3CIRA 3SFEA 3P4SA 3VR9A 1R094 3AEFA 1VRH4 4YSZA 1PO24 2PZSA 3AE7A 4Q4W4 2WDQA 1AR64 1OOPD 1RMU4 1RUC4 1HRV4 1VBA4 2RS14 1XHXA 1ZP0A 2PYLA 2WP9A 3P4PA 1AR94 3SFDA 2HWB4 1VBE4 4Q4X4 1MQTD 3VRBA 1COV4 1RUE4 3ABVA 1HRI4 1NENA 2PLV4 1POV0 2WDVA 3JD74 1PO14 2X5ID 2ACZA 2HWC4 4YTPA 4Q4Y4 1RUF4 2R7FA 2RR14 3J8F4 1RUG4 1RUJ4 3AE6A 1Z7S4 3SUCA 1EAH4 3AE4A 1R084 1PVC4 2PY5A 3AE9A 4YTNA 3AE1A 1KFYA 5C3JA
chains in the Genus database with same CATH topology
1BEV4 2R074 2HWB4 2RS54 1RVF4 1RUI4 1VBE4 1K5MD 4Q4X4 4Q4V4 1MQTD 1HXS4 4PDWD 1NCQD 1RHI4 1VBC4 1EV14 2RM24 2RS34 1R094 1COV4 1RUE4 2RMU4 1HRI4 1VRH4 4GB34 2PLV4 1POV0 3JD74 1VBD4 1PO14 2X5ID 2HWC4 1PO24 3JBG4 4Q4W4 4Q4Y4 1RUF4 1AR64 2RR14 1RUH4 1AL24 1OOPD 3J8F4 1RUG4 1RUJ4 2R064 1RMU4 1Z7S4 2R044 1VBB4 1EAH4 1H8TD 1PIV4 1R084 1RUC4 1ASJ4 1PVC4 1AR74 1AR84 1D4M4 1VBA4 1HRV4 1NA1D 2RS14 4RHV4 1RUD4 1AR94
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BEV 4;  2R07 4;  2HWB 4;  2RS5 4;  1RVF 4;  1RUI 4;  1VBE 4;  1K5M D;  4Q4X 4;  4Q4V 4;  1MQT D;  1HXS 4;  4PDW D;  1NCQ D;  1RHI 4;  1VBC 4;  1EV1 4;  2RM2 4;  2RS3 4;  1R09 4;  1COV 4;  1RUE 4;  2RMU 4;  1HRI 4;  1VRH 4;  4GB3 4;  2PLV 4;  1POV 0;  3JD7 4;  1VBD 4;  1PO1 4;  2X5I D;  2HWC 4;  1PO2 4;  3JBG 4;  4Q4W 4;  4Q4Y 4;  1RUF 4;  1AR6 4;  2RR1 4;  1RUH 4;  1AL2 4;  1OOP D;  3J8F 4;  1RUG 4;  1RUJ 4;  2R06 4;  1RMU 4;  1Z7S 4;  2R04 4;  1VBB 4;  1EAH 4;  1H8T D;  1PIV 4;  1R08 4;  1RUC 4;  1ASJ 4;  1PVC 4;  1AR7 4;  1AR8 4;  1D4M 4;  1VBA 4;  1HRV 4;  1NA1 D;  2RS1 4;  4RHV 4;  1RUD 4;  1AR9 4; 
#chains in the Genus database with same CATH topology
 3AEG A;  2H88 A;  1HXS 4;  3AE2 A;  1YQ4 A;  4PDW D;  2WU5 A;  1NEK A;  1RHI 4;  2RM2 4;  4GB3 4;  3AE8 A;  3AE5 A;  1VBD 4;  3AEA A;  3JBG 4;  3VRA A;  1RUH 4;  1AL2 4;  4YT0 A;  2R06 4;  2R04 4;  1XI1 A;  1H8T D;  2H89 A;  1ASJ 4;  2WU2 A;  1YQ3 A;  1D4M 4;  4RHV 4;  1KF6 A;  4YXD A;  1RUD 4;  1XHZ A;  2WQY A;  3P4Q A;  3AEB A;  1ZOY A;  4KX6 A;  2PW9 A;  3AEE A;  1RVF 4;  2PYJ A;  3VR8 A;  1K5M D;  4Q4V 4;  3GQK A;  1NCQ D;  1VBC 4;  1EV1 4;  2RS3 4;  2EX3 A;  2RMU 4;  3GQH A;  3AEC A;  2B76 A;  4YTM A;  1VBB 4;  2FBW A;  1PIV 4;  3AE3 A;  1AR7 4;  1AR8 4;  4YSX A;  1NA1 D;  3AED A;  1L0V A;  3FI7 A;  2WS3 A;  5C2T A;  3P4R A;  4YSY A;  2WDR A;  1BEV 4;  2R07 4;  2RS5 4;  1RUI 4;  3CIR A;  3SFE A;  3P4S A;  3VR9 A;  1R09 4;  3AEF A;  1VRH 4;  4YSZ A;  1PO2 4;  2PZS A;  3AE7 A;  4Q4W 4;  2WDQ A;  1AR6 4;  1OOP D;  1RMU 4;  1RUC 4;  1HRV 4;  1VBA 4;  2RS1 4;  1XHX A;  1ZP0 A;  2PYL A;  2WP9 A;  3P4P A;  1AR9 4;  3SFD A;  2HWB 4;  1VBE 4;  4Q4X 4;  1MQT D;  3VRB A;  1COV 4;  1RUE 4;  3ABV A;  1HRI 4;  1NEN A;  2PLV 4;  1POV 0;  2WDV A;  3JD7 4;  1PO1 4;  2X5I D;  2ACZ A;  2HWC 4;  4YTP A;  4Q4Y 4;  1RUF 4;  2R7F A;  2RR1 4;  3J8F 4;  1RUG 4;  1RUJ 4;  3AE6 A;  1Z7S 4;  3SUC A;  1EAH 4;  3AE4 A;  1R08 4;  1PVC 4;  2PY5 A;  3AE9 A;  4YTN A;  3AE1 A;  1KFY A;  5C3J A; 
#chains in the Genus database with same CATH homology
 1BEV 4;  2R07 4;  2HWB 4;  2RS5 4;  1RVF 4;  1RUI 4;  1VBE 4;  1K5M D;  4Q4X 4;  4Q4V 4;  1MQT D;  1HXS 4;  4PDW D;  1NCQ D;  1RHI 4;  1VBC 4;  1EV1 4;  2RM2 4;  2RS3 4;  1R09 4;  1COV 4;  1RUE 4;  2RMU 4;  1HRI 4;  1VRH 4;  4GB3 4;  2PLV 4;  1POV 0;  3JD7 4;  1VBD 4;  1PO1 4;  2X5I D;  2HWC 4;  1PO2 4;  3JBG 4;  4Q4W 4;  4Q4Y 4;  1RUF 4;  1AR6 4;  2RR1 4;  1RUH 4;  1AL2 4;  1OOP D;  3J8F 4;  1RUG 4;  1RUJ 4;  2R06 4;  1RMU 4;  1Z7S 4;  2R04 4;  1VBB 4;  1EAH 4;  1H8T D;  1PIV 4;  1R08 4;  1RUC 4;  1ASJ 4;  1PVC 4;  1AR7 4;  1AR8 4;  1D4M 4;  1VBA 4;  1HRV 4;  1NA1 D;  2RS1 4;  4RHV 4;  1RUD 4;  1AR9 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...