2RMU4

Three-dimensional structures of drug-resistant mutants of human rhinovirus 14
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Three-dimensional structures of drug-resistant mutants of human rhinovirus 14.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rmu400
1K5MD 1VBB4 1AR94 2HWC4 2R064 1PVC4 1RUE4 1VBC4 2R044 1RVF4 4Q4Y4 1RUH4 4Q4V4 1NCQD 1VBA4 3J8F4 4GB34 1R084 4Q4W4 1RUD4 4PDWD 1AR64 1RUJ4 1RHI4 1HRV4 1R094 3JBG4 1BEV4 1RUC4 2RS54 1RUG4 1AL24 1PIV4 2RMU4 1VRH4 1HXS4 1HRI4 4RHV4 1H8TD 2RS34 1AR84 4Q4X4 1RUI4 1Z7S4 1D4M4 2HWB4 1RUF4 2X5ID 1VBE4 2RS14 1OOPD 1MQTD 1ASJ4 1EV14 1POV0 1PO24 2PLV4 1RMU4 2RR14 2R074 1PO14 3JD74 1COV4 1AR74 1VBD4 2RM24 1EAH4 1NA1D
chains in the Genus database with same CATH superfamily
2WP9A 1VBB4 2HWC4 4KX6A 3VR8A 1RVF4 3AE7A 4Q4Y4 4YT0A 1XI1A 1NCQD 3J8F4 3AE3A 3AEGA 1RUD4 2FBWA 3AECA 1R094 2WQYA 3P4QA 2PYLA 1RUG4 1PIV4 1VRH4 1RUI4 3P4PA 3AEDA 1D4M4 2HWB4 3AE8A 1VBE4 1MQTD 1OOPD 1POV0 3VRBA 1KFYA 2RR14 3AEFA 2PW9A 2WU5A 1AR74 1VBD4 3CIRA 3AE5A 4YSYA 4Q4V4 2ACZA 2PZSA 2R7FA 3FI7A 4YTMA 3GQHA 4YTPA 1RUJ4 1KF6A 1HRV4 1BEV4 1RUC4 4YXDA 1XHXA 2RMU4 2WDQA 1HRI4 3VR9A 2X5ID 1RUF4 1ASJ4 2WDVA 1EV14 1PO24 2R074 1PO14 3AEAA 3JD74 2PYJA 1AR94 1L0VA 2R064 1PVC4 4YSXA 3AEEA 1RUH4 3AE4A 4GB34 1YQ4A 4YSZA 2WDRA 3SFEA 3SUCA 3VRAA 3AE6A 3P4SA 2WU2A 3JBG4 3P4RA 1H8TD 1AR84 2B76A 3GQKA 4YTNA 2PLV4 1ZP0A 1NEKA 2RM24 3AE2A 1EAH4 2H88A 1Z7S4 1NA1D 1K5MD 2H89A 1RUE4 1VBC4 2R044 5C2TA 1ZOYA 3AE9A 1VBA4 1R084 2PY5A 4Q4W4 4PDWD 1AR64 3AE1A 1RHI4 3ABVA 1XHZA 2RS54 1AL24 1HXS4 4RHV4 3SFDA 5C3JA 2RS34 4Q4X4 1NENA 2RS14 2WS3A 1YQ3A 1RMU4 3AEBA 1COV4 2EX3A
chains in the Genus database with same CATH topology
1K5MD 1VBB4 1AR94 2HWC4 2R064 1PVC4 1RUE4 1VBC4 2R044 1RVF4 4Q4Y4 1RUH4 4Q4V4 1NCQD 1VBA4 3J8F4 4GB34 1R084 4Q4W4 1RUD4 4PDWD 1AR64 1RUJ4 1RHI4 1HRV4 1R094 3JBG4 1BEV4 1RUC4 2RS54 1RUG4 1AL24 1PIV4 2RMU4 1VRH4 1HXS4 1HRI4 4RHV4 1H8TD 2RS34 1AR84 4Q4X4 1RUI4 1Z7S4 1D4M4 2HWB4 1RUF4 2X5ID 1VBE4 2RS14 1OOPD 1MQTD 1ASJ4 1EV14 1POV0 1PO24 2PLV4 1RMU4 2RR14 2R074 1PO14 3JD74 1COV4 1AR74 1VBD4 2RM24 1EAH4 1NA1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K5M D;  1VBB 4;  1AR9 4;  2HWC 4;  2R06 4;  1PVC 4;  1RUE 4;  1VBC 4;  2R04 4;  1RVF 4;  4Q4Y 4;  1RUH 4;  4Q4V 4;  1NCQ D;  1VBA 4;  3J8F 4;  4GB3 4;  1R08 4;  4Q4W 4;  1RUD 4;  4PDW D;  1AR6 4;  1RUJ 4;  1RHI 4;  1HRV 4;  1R09 4;  3JBG 4;  1BEV 4;  1RUC 4;  2RS5 4;  1RUG 4;  1AL2 4;  1PIV 4;  2RMU 4;  1VRH 4;  1HXS 4;  1HRI 4;  4RHV 4;  1H8T D;  2RS3 4;  1AR8 4;  4Q4X 4;  1RUI 4;  1Z7S 4;  1D4M 4;  2HWB 4;  1RUF 4;  2X5I D;  1VBE 4;  2RS1 4;  1OOP D;  1MQT D;  1ASJ 4;  1EV1 4;  1POV 0;  1PO2 4;  2PLV 4;  1RMU 4;  2RR1 4;  2R07 4;  1PO1 4;  3JD7 4;  1COV 4;  1AR7 4;  1VBD 4;  2RM2 4;  1EAH 4;  1NA1 D; 
#chains in the Genus database with same CATH topology
 2WP9 A;  1VBB 4;  2HWC 4;  4KX6 A;  3VR8 A;  1RVF 4;  3AE7 A;  4Q4Y 4;  4YT0 A;  1XI1 A;  1NCQ D;  3J8F 4;  3AE3 A;  3AEG A;  1RUD 4;  2FBW A;  3AEC A;  1R09 4;  2WQY A;  3P4Q A;  2PYL A;  1RUG 4;  1PIV 4;  1VRH 4;  1RUI 4;  3P4P A;  3AED A;  1D4M 4;  2HWB 4;  3AE8 A;  1VBE 4;  1MQT D;  1OOP D;  1POV 0;  3VRB A;  1KFY A;  2RR1 4;  3AEF A;  2PW9 A;  2WU5 A;  1AR7 4;  1VBD 4;  3CIR A;  3AE5 A;  4YSY A;  4Q4V 4;  2ACZ A;  2PZS A;  2R7F A;  3FI7 A;  4YTM A;  3GQH A;  4YTP A;  1RUJ 4;  1KF6 A;  1HRV 4;  1BEV 4;  1RUC 4;  4YXD A;  1XHX A;  2RMU 4;  2WDQ A;  1HRI 4;  3VR9 A;  2X5I D;  1RUF 4;  1ASJ 4;  2WDV A;  1EV1 4;  1PO2 4;  2R07 4;  1PO1 4;  3AEA A;  3JD7 4;  2PYJ A;  1AR9 4;  1L0V A;  2R06 4;  1PVC 4;  4YSX A;  3AEE A;  1RUH 4;  3AE4 A;  4GB3 4;  1YQ4 A;  4YSZ A;  2WDR A;  3SFE A;  3SUC A;  3VRA A;  3AE6 A;  3P4S A;  2WU2 A;  3JBG 4;  3P4R A;  1H8T D;  1AR8 4;  2B76 A;  3GQK A;  4YTN A;  2PLV 4;  1ZP0 A;  1NEK A;  2RM2 4;  3AE2 A;  1EAH 4;  2H88 A;  1Z7S 4;  1NA1 D;  1K5M D;  2H89 A;  1RUE 4;  1VBC 4;  2R04 4;  5C2T A;  1ZOY A;  3AE9 A;  1VBA 4;  1R08 4;  2PY5 A;  4Q4W 4;  4PDW D;  1AR6 4;  3AE1 A;  1RHI 4;  3ABV A;  1XHZ A;  2RS5 4;  1AL2 4;  1HXS 4;  4RHV 4;  3SFD A;  5C3J A;  2RS3 4;  4Q4X 4;  1NEN A;  2RS1 4;  2WS3 A;  1YQ3 A;  1RMU 4;  3AEB A;  1COV 4;  2EX3 A; 
#chains in the Genus database with same CATH homology
 1K5M D;  1VBB 4;  1AR9 4;  2HWC 4;  2R06 4;  1PVC 4;  1RUE 4;  1VBC 4;  2R04 4;  1RVF 4;  4Q4Y 4;  1RUH 4;  4Q4V 4;  1NCQ D;  1VBA 4;  3J8F 4;  4GB3 4;  1R08 4;  4Q4W 4;  1RUD 4;  4PDW D;  1AR6 4;  1RUJ 4;  1RHI 4;  1HRV 4;  1R09 4;  3JBG 4;  1BEV 4;  1RUC 4;  2RS5 4;  1RUG 4;  1AL2 4;  1PIV 4;  2RMU 4;  1VRH 4;  1HXS 4;  1HRI 4;  4RHV 4;  1H8T D;  2RS3 4;  1AR8 4;  4Q4X 4;  1RUI 4;  1Z7S 4;  1D4M 4;  2HWB 4;  1RUF 4;  2X5I D;  1VBE 4;  2RS1 4;  1OOP D;  1MQT D;  1ASJ 4;  1EV1 4;  1POV 0;  1PO2 4;  2PLV 4;  1RMU 4;  2RR1 4;  2R07 4;  1PO1 4;  3JD7 4;  1COV 4;  1AR7 4;  1VBD 4;  2RM2 4;  1EAH 4;  1NA1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...