2X5ID

Crystal structure echovirus 7
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
61
Chain Sequence
MGAQVSTQKTGAHETIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Interaction of Decay-Accelerating Factor with Echovirus 7.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 61
sequence length 69
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2x5iD00
2R074 2RS54 1POV0 2HWB4 1PO24 1VBE4 3J8F4 2RS34 1AR94 1HXS4 1PVC4 4Q4W4 1PO14 3JD74 1VBD4 1NA1D 4Q4X4 2HWC4 1ASJ4 1AR84 1R094 1RUC4 1RUE4 1RUH4 2X5ID 4Q4V4 4RHV4 1PIV4 1D4M4 4PDWD 1RUD4 2RMU4 1Z7S4 1AL24 2R044 1RUI4 1RMU4 4Q4Y4 1VBA4 1VBB4 2RR14 2PLV4 1RUF4 1AR64 1VRH4 1MQTD 1RUJ4 1HRI4 2RM24 1K5MD 1AR74 2R064 4GB34 1EAH4 1H8TD 1OOPD 3JBG4 1RHI4 2RS14 1RVF4 1HRV4 1EV14 1NCQD 1RUG4 1COV4 1VBC4 1BEV4 1R084
chains in the Genus database with same CATH superfamily
3VR9A 1PO24 4YSXA 1AR94 1HXS4 4Q4W4 4YSZA 1RUE4 1AR84 1RUH4 1NENA 2X5ID 1XHZA 5C2TA 2PYLA 2PW9A 3P4QA 1Z7S4 3SFDA 2B76A 3AEDA 3AEFA 4Q4Y4 2H89A 1ZOYA 1RUF4 1AR64 2WDQA 1KFYA 2WDVA 1K5MD 1EAH4 3AEGA 3AE5A 3SFEA 3AE4A 1H8TD 3JBG4 4YTNA 2PYJA 1RHI4 2PY5A 3GQHA 4YXDA 3AECA 4Q4X4 2RS54 3J8F4 4YSYA 1VBD4 1NA1D 2WU2A 3AEBA 1ASJ4 1YQ3A 1ZP0A 2PZSA 1VBB4 2R7FA 1HRI4 3AE7A 3VR8A 2WP9A 2WS3A 1OOPD 2FBWA 2H88A 1NCQD 1RUG4 2HWC4 1XHXA 2RMU4 1VBC4 1BEV4 1KF6A 3P4PA 5C3JA 1POV0 2HWB4 4YTPA 1L0VA 1PVC4 3JD74 4Q4V4 3P4RA 1D4M4 4PDWD 3ABVA 1RUD4 1AL24 2R044 1RMU4 3AE3A 2PLV4 3AE1A 1MQTD 1RUJ4 4KX6A 3VRAA 2RM24 1AR74 2R064 3FI7A 4GB34 2RS14 1HRV4 1RVF4 2WDRA 1EV14 4YT0A 3GQKA 1COV4 2WQYA 1R084 2R074 1VBE4 2RS34 3AEAA 1PO14 3AE9A 2ACZA 1R094 1RUC4 3VRBA 4RHV4 4YTMA 1PIV4 1RUI4 1XI1A 1VBA4 2RR14 1VRH4 2WU5A 3P4SA 2EX3A 1YQ4A 1NEKA 3AEEA 3AE2A 3CIRA 3AE8A 3AE6A 3SUCA
chains in the Genus database with same CATH topology
2R074 2RS54 1POV0 2HWB4 1PO24 1VBE4 3J8F4 2RS34 1AR94 1HXS4 1PVC4 4Q4W4 1PO14 3JD74 1VBD4 1NA1D 4Q4X4 2HWC4 1ASJ4 1AR84 1R094 1RUC4 1RUE4 1RUH4 2X5ID 4Q4V4 4RHV4 1PIV4 1D4M4 4PDWD 1RUD4 2RMU4 1Z7S4 1AL24 2R044 1RUI4 1RMU4 4Q4Y4 1VBA4 1VBB4 2RR14 2PLV4 1RUF4 1AR64 1VRH4 1MQTD 1RUJ4 1HRI4 2RM24 1K5MD 1AR74 2R064 4GB34 1EAH4 1H8TD 1OOPD 3JBG4 1RHI4 2RS14 1RVF4 1HRV4 1EV14 1NCQD 1RUG4 1COV4 1VBC4 1BEV4 1R084
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R07 4;  2RS5 4;  1POV 0;  2HWB 4;  1PO2 4;  1VBE 4;  3J8F 4;  2RS3 4;  1AR9 4;  1HXS 4;  1PVC 4;  4Q4W 4;  1PO1 4;  3JD7 4;  1VBD 4;  1NA1 D;  4Q4X 4;  2HWC 4;  1ASJ 4;  1AR8 4;  1R09 4;  1RUC 4;  1RUE 4;  1RUH 4;  2X5I D;  4Q4V 4;  4RHV 4;  1PIV 4;  1D4M 4;  4PDW D;  1RUD 4;  2RMU 4;  1Z7S 4;  1AL2 4;  2R04 4;  1RUI 4;  1RMU 4;  4Q4Y 4;  1VBA 4;  1VBB 4;  2RR1 4;  2PLV 4;  1RUF 4;  1AR6 4;  1VRH 4;  1MQT D;  1RUJ 4;  1HRI 4;  2RM2 4;  1K5M D;  1AR7 4;  2R06 4;  4GB3 4;  1EAH 4;  1H8T D;  1OOP D;  3JBG 4;  1RHI 4;  2RS1 4;  1RVF 4;  1HRV 4;  1EV1 4;  1NCQ D;  1RUG 4;  1COV 4;  1VBC 4;  1BEV 4;  1R08 4; 
#chains in the Genus database with same CATH topology
 3VR9 A;  1PO2 4;  4YSX A;  1AR9 4;  1HXS 4;  4Q4W 4;  4YSZ A;  1RUE 4;  1AR8 4;  1RUH 4;  1NEN A;  2X5I D;  1XHZ A;  5C2T A;  2PYL A;  2PW9 A;  3P4Q A;  1Z7S 4;  3SFD A;  2B76 A;  3AED A;  3AEF A;  4Q4Y 4;  2H89 A;  1ZOY A;  1RUF 4;  1AR6 4;  2WDQ A;  1KFY A;  2WDV A;  1K5M D;  1EAH 4;  3AEG A;  3AE5 A;  3SFE A;  3AE4 A;  1H8T D;  3JBG 4;  4YTN A;  2PYJ A;  1RHI 4;  2PY5 A;  3GQH A;  4YXD A;  3AEC A;  4Q4X 4;  2RS5 4;  3J8F 4;  4YSY A;  1VBD 4;  1NA1 D;  2WU2 A;  3AEB A;  1ASJ 4;  1YQ3 A;  1ZP0 A;  2PZS A;  1VBB 4;  2R7F A;  1HRI 4;  3AE7 A;  3VR8 A;  2WP9 A;  2WS3 A;  1OOP D;  2FBW A;  2H88 A;  1NCQ D;  1RUG 4;  2HWC 4;  1XHX A;  2RMU 4;  1VBC 4;  1BEV 4;  1KF6 A;  3P4P A;  5C3J A;  1POV 0;  2HWB 4;  4YTP A;  1L0V A;  1PVC 4;  3JD7 4;  4Q4V 4;  3P4R A;  1D4M 4;  4PDW D;  3ABV A;  1RUD 4;  1AL2 4;  2R04 4;  1RMU 4;  3AE3 A;  2PLV 4;  3AE1 A;  1MQT D;  1RUJ 4;  4KX6 A;  3VRA A;  2RM2 4;  1AR7 4;  2R06 4;  3FI7 A;  4GB3 4;  2RS1 4;  1HRV 4;  1RVF 4;  2WDR A;  1EV1 4;  4YT0 A;  3GQK A;  1COV 4;  2WQY A;  1R08 4;  2R07 4;  1VBE 4;  2RS3 4;  3AEA A;  1PO1 4;  3AE9 A;  2ACZ A;  1R09 4;  1RUC 4;  3VRB A;  4RHV 4;  4YTM A;  1PIV 4;  1RUI 4;  1XI1 A;  1VBA 4;  2RR1 4;  1VRH 4;  2WU5 A;  3P4S A;  2EX3 A;  1YQ4 A;  1NEK A;  3AEE A;  3AE2 A;  3CIR A;  3AE8 A;  3AE6 A;  3SUC A; 
#chains in the Genus database with same CATH homology
 2R07 4;  2RS5 4;  1POV 0;  2HWB 4;  1PO2 4;  1VBE 4;  3J8F 4;  2RS3 4;  1AR9 4;  1HXS 4;  1PVC 4;  4Q4W 4;  1PO1 4;  3JD7 4;  1VBD 4;  1NA1 D;  4Q4X 4;  2HWC 4;  1ASJ 4;  1AR8 4;  1R09 4;  1RUC 4;  1RUE 4;  1RUH 4;  2X5I D;  4Q4V 4;  4RHV 4;  1PIV 4;  1D4M 4;  4PDW D;  1RUD 4;  2RMU 4;  1Z7S 4;  1AL2 4;  2R04 4;  1RUI 4;  1RMU 4;  4Q4Y 4;  1VBA 4;  1VBB 4;  2RR1 4;  2PLV 4;  1RUF 4;  1AR6 4;  1VRH 4;  1MQT D;  1RUJ 4;  1HRI 4;  2RM2 4;  1K5M D;  1AR7 4;  2R06 4;  4GB3 4;  1EAH 4;  1H8T D;  1OOP D;  3JBG 4;  1RHI 4;  2RS1 4;  1RVF 4;  1HRV 4;  1EV1 4;  1NCQ D;  1RUG 4;  1COV 4;  1VBC 4;  1BEV 4;  1R08 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...