2X5ID

Crystal structure echovirus 7
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
61
Chain Sequence
MGAQVSTQKTGAHETIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords VP1
publication title Interaction of Decay-Accelerating Factor with Echovirus 7.
pubmed doi rcsb
total genus 4
structure length 61
sequence length 69
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2x5iD00
1PVC4 1HXS4 1H8TD 1PO14 4GB34 1D4M4 1AR94 3J8F4 1RVF4 2R044 1RUG4 1RUJ4 1NCQD 1HRI4 4Q4Y4 1ASJ4 2RS54 1AR74 1AR84 1POV0 1RUD4 1RUF4 1BEV4 1Z7S4 4RHV4 1RUH4 2RS14 1RMU4 4Q4W4 2RR14 4Q4X4 1VRH4 1R094 1EV14 1VBC4 2RS34 1NA1D 1RHI4 1AL24 1R084 2HWB4 1K5MD 1MQTD 1EAH4 2RM24 3JD74 1AR64 4Q4V4 1PO24 1VBA4 1VBB4 1HRV4 2HWC4 1RUE4 1VBE4 1VBD4 2PLV4 1COV4 1PIV4 2R064 1RUC4 2R074 2RMU4 2X5ID 3JBG4 1OOPD 4PDWD 1RUI4
chains in the Genus database with same CATH superfamily
3J8F4 2R044 4YTMA 1POV0 3P4RA 2PW9A 3AE4A 2RS14 3VRAA 1NENA 1ZP0A 2FBWA 1EV14 4YTPA 2B76A 1AL24 3ABVA 1R084 1EAH4 3GQHA 3AE1A 2WDRA 2R7FA 2WP9A 1VBD4 1PIV4 4YSXA 1KF6A 2X5ID 2WU5A 3JBG4 3AEEA 2PYJA 1COV4 1HXS4 3AE3A 1NCQD 4Q4Y4 1ASJ4 3VR8A 1NEKA 1L0VA 2EX3A 3AE6A 5C2TA 1Z7S4 1BEV4 1XHZA 1RMU4 3SUCA 2RR14 2WDVA 1R094 1XHXA 1MQTD 3AE9A 4Q4V4 1VBB4 1YQ3A 2HWC4 1RUE4 3FI7A 1VBE4 2PLV4 3AEDA 3GQKA 4YT0A 1PVC4 1RVF4 2PZSA 2WS3A 2WU2A 1YQ4A 1AR94 3AE5A 1RUG4 3AEAA 2RS54 1AR74 5C3JA 1AR84 1RUH4 3P4PA 4Q4W4 3P4QA 1VRH4 1VBC4 2RS34 1NA1D 4YXDA 3P4SA 2HWB4 3AE7A 1K5MD 3AEFA 2PYLA 1PO24 2ACZA 1KFYA 2WQYA 4YSZA 4YSYA 3VRBA 1RUC4 1OOPD 2R074 2PY5A 1RUI4 3AEBA 1H8TD 1PO14 3VR9A 4GB34 1D4M4 3AECA 1RUJ4 4YTNA 1HRI4 1XI1A 3SFEA 1RUD4 1RUF4 4RHV4 3AE2A 4Q4X4 2H88A 4KX6A 1RHI4 3AEGA 2WDQA 2RM24 2H89A 3JD74 1AR64 1VBA4 1HRV4 1ZOYA 2R064 3CIRA 3SFDA 2RMU4 3AE8A 4PDWD
chains in the Genus database with same CATH topology
1PVC4 1HXS4 1H8TD 1PO14 4GB34 1D4M4 1AR94 3J8F4 1RVF4 2R044 1RUG4 1RUJ4 1NCQD 1HRI4 4Q4Y4 1ASJ4 2RS54 1AR74 1AR84 1POV0 1RUD4 1RUF4 1BEV4 1Z7S4 4RHV4 1RUH4 2RS14 1RMU4 4Q4W4 2RR14 4Q4X4 1VRH4 1R094 1EV14 1VBC4 2RS34 1NA1D 1RHI4 1AL24 1R084 2HWB4 1K5MD 1MQTD 1EAH4 2RM24 3JD74 1AR64 4Q4V4 1PO24 1VBA4 1VBB4 1HRV4 2HWC4 1RUE4 1VBE4 1VBD4 2PLV4 1COV4 1PIV4 2R064 1RUC4 2R074 2RMU4 2X5ID 3JBG4 1OOPD 4PDWD 1RUI4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVC 4;  1HXS 4;  1H8T D;  1PO1 4;  4GB3 4;  1D4M 4;  1AR9 4;  3J8F 4;  1RVF 4;  2R04 4;  1RUG 4;  1RUJ 4;  1NCQ D;  1HRI 4;  4Q4Y 4;  1ASJ 4;  2RS5 4;  1AR7 4;  1AR8 4;  1POV 0;  1RUD 4;  1RUF 4;  1BEV 4;  1Z7S 4;  4RHV 4;  1RUH 4;  2RS1 4;  1RMU 4;  4Q4W 4;  2RR1 4;  4Q4X 4;  1VRH 4;  1R09 4;  1EV1 4;  1VBC 4;  2RS3 4;  1NA1 D;  1RHI 4;  1AL2 4;  1R08 4;  2HWB 4;  1K5M D;  1MQT D;  1EAH 4;  2RM2 4;  3JD7 4;  1AR6 4;  4Q4V 4;  1PO2 4;  1VBA 4;  1VBB 4;  1HRV 4;  2HWC 4;  1RUE 4;  1VBE 4;  1VBD 4;  2PLV 4;  1COV 4;  1PIV 4;  2R06 4;  1RUC 4;  2R07 4;  2RMU 4;  2X5I D;  3JBG 4;  1OOP D;  4PDW D;  1RUI 4; 
#chains in the Genus database with same CATH topology
 3J8F 4;  2R04 4;  4YTM A;  1POV 0;  3P4R A;  2PW9 A;  3AE4 A;  2RS1 4;  3VRA A;  1NEN A;  1ZP0 A;  2FBW A;  1EV1 4;  4YTP A;  2B76 A;  1AL2 4;  3ABV A;  1R08 4;  1EAH 4;  3GQH A;  3AE1 A;  2WDR A;  2R7F A;  2WP9 A;  1VBD 4;  1PIV 4;  4YSX A;  1KF6 A;  2X5I D;  2WU5 A;  3JBG 4;  3AEE A;  2PYJ A;  1COV 4;  1HXS 4;  3AE3 A;  1NCQ D;  4Q4Y 4;  1ASJ 4;  3VR8 A;  1NEK A;  1L0V A;  2EX3 A;  3AE6 A;  5C2T A;  1Z7S 4;  1BEV 4;  1XHZ A;  1RMU 4;  3SUC A;  2RR1 4;  2WDV A;  1R09 4;  1XHX A;  1MQT D;  3AE9 A;  4Q4V 4;  1VBB 4;  1YQ3 A;  2HWC 4;  1RUE 4;  3FI7 A;  1VBE 4;  2PLV 4;  3AED A;  3GQK A;  4YT0 A;  1PVC 4;  1RVF 4;  2PZS A;  2WS3 A;  2WU2 A;  1YQ4 A;  1AR9 4;  3AE5 A;  1RUG 4;  3AEA A;  2RS5 4;  1AR7 4;  5C3J A;  1AR8 4;  1RUH 4;  3P4P A;  4Q4W 4;  3P4Q A;  1VRH 4;  1VBC 4;  2RS3 4;  1NA1 D;  4YXD A;  3P4S A;  2HWB 4;  3AE7 A;  1K5M D;  3AEF A;  2PYL A;  1PO2 4;  2ACZ A;  1KFY A;  2WQY A;  4YSZ A;  4YSY A;  3VRB A;  1RUC 4;  1OOP D;  2R07 4;  2PY5 A;  1RUI 4;  3AEB A;  1H8T D;  1PO1 4;  3VR9 A;  4GB3 4;  1D4M 4;  3AEC A;  1RUJ 4;  4YTN A;  1HRI 4;  1XI1 A;  3SFE A;  1RUD 4;  1RUF 4;  4RHV 4;  3AE2 A;  4Q4X 4;  2H88 A;  4KX6 A;  1RHI 4;  3AEG A;  2WDQ A;  2RM2 4;  2H89 A;  3JD7 4;  1AR6 4;  1VBA 4;  1HRV 4;  1ZOY A;  2R06 4;  3CIR A;  3SFD A;  2RMU 4;  3AE8 A;  4PDW D; 
#chains in the Genus database with same CATH homology
 1PVC 4;  1HXS 4;  1H8T D;  1PO1 4;  4GB3 4;  1D4M 4;  1AR9 4;  3J8F 4;  1RVF 4;  2R04 4;  1RUG 4;  1RUJ 4;  1NCQ D;  1HRI 4;  4Q4Y 4;  1ASJ 4;  2RS5 4;  1AR7 4;  1AR8 4;  1POV 0;  1RUD 4;  1RUF 4;  1BEV 4;  1Z7S 4;  4RHV 4;  1RUH 4;  2RS1 4;  1RMU 4;  4Q4W 4;  2RR1 4;  4Q4X 4;  1VRH 4;  1R09 4;  1EV1 4;  1VBC 4;  2RS3 4;  1NA1 D;  1RHI 4;  1AL2 4;  1R08 4;  2HWB 4;  1K5M D;  1MQT D;  1EAH 4;  2RM2 4;  3JD7 4;  1AR6 4;  4Q4V 4;  1PO2 4;  1VBA 4;  1VBB 4;  1HRV 4;  2HWC 4;  1RUE 4;  1VBE 4;  1VBD 4;  2PLV 4;  1COV 4;  1PIV 4;  2R06 4;  1RUC 4;  2R07 4;  2RMU 4;  2X5I D;  3JBG 4;  1OOP D;  4PDW D;  1RUI 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...