2X5ID

Crystal structure echovirus 7
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
69
structure length
61
Chain Sequence
MGAQVSTQKTGAHETIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKTMPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VP1
publication title Interaction of Decay-Accelerating Factor with Echovirus 7.
pubmed doi rcsb
molecule tags Virus
total genus 4
structure length 61
sequence length 69
ec nomenclature
pdb deposition date 2010-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2x5iD00
1HRI4 2R044 1ASJ4 1VBA4 1RUI4 1PIV4 1VBE4 1D4M4 2RMU4 1AR64 1AR74 1AR84 1RHI4 1RMU4 1RUJ4 1VRH4 2RS54 1PVC4 4RHV4 2RM24 1RVF4 1RUC4 1POV0 2PLV4 3JD74 4Q4Y4 2RS34 1PO24 1OOPD 4Q4X4 2RS14 1AL24 1RUE4 1NCQD 1PO14 2X5ID 1RUD4 2RR14 1HXS4 1R084 1VBD4 1COV4 2R074 1Z7S4 3JBG4 4PDWD 1HRV4 2R064 4Q4V4 1H8TD 1BEV4 1NA1D 1AR94 1RUH4 1VBC4 1EAH4 1RUG4 1MQTD 4GB34 1EV14 1K5MD 1VBB4 1RUF4 4Q4W4 3J8F4 2HWC4 1R094 2HWB4
chains in the Genus database with same CATH superfamily
1HRI4 1ASJ4 1VBA4 2WDQA 1D4M4 1AR84 1AR74 1RUJ4 4RHV4 2PYLA 1POV0 3AEAA 3AE3A 3AE2A 1NCQD 2WU2A 1PO14 3AE1A 2X5ID 4YSXA 3AEBA 3AE8A 1VBD4 2R074 1NEKA 4YTMA 4PDWD 1HRV4 1H8TD 2FBWA 1MQTD 3AE4A 3SUCA 3FI7A 2WQYA 1R094 2WS3A 2RMU4 4KX6A 1RHI4 4YSYA 2RS54 3VRAA 2WU5A 2RM24 1RVF4 1KF6A 3AEEA 3JD74 1PO24 1OOPD 4Q4X4 1AL24 1RUE4 3SFDA 4YTPA 1HXS4 1L0VA 1YQ3A 2R7FA 5C3JA 2R064 4Q4V4 1NA1D 1YQ4A 3AEGA 3GQKA 2PYJA 3SFEA 1ZP0A 2R044 1PIV4 4YXDA 1RMU4 2H89A 1PVC4 1RUC4 2PLV4 4Q4Y4 3VR8A 2PY5A 1XHZA 4YT0A 4YSZA 3AE9A 3P4RA 3AE5A 1RUD4 1R084 2H88A 2WDRA 1COV4 3AE7A 2WDVA 3JBG4 3VR9A 2PW9A 1NENA 4YTNA 3AECA 1VBC4 1EV14 1K5MD 3AEDA 4Q4W4 3J8F4 2HWC4 3ABVA 2EX3A 2RS34 3VRBA 1RUI4 1VBE4 5C2TA 1AR64 1XHXA 1VRH4 2WP9A 2B76A 2ACZA 3P4PA 1XI1A 3P4SA 2RS14 1KFYA 2RR14 3CIRA 1Z7S4 2PZSA 3P4QA 3AE6A 1BEV4 1AR94 1RUH4 1EAH4 1RUG4 3AEFA 4GB34 1ZOYA 1VBB4 1RUF4 3GQHA 2HWB4
chains in the Genus database with same CATH topology
1HRI4 2R044 1ASJ4 1VBA4 1RUI4 1PIV4 1VBE4 1D4M4 2RMU4 1AR64 1AR74 1AR84 1RHI4 1RMU4 1RUJ4 1VRH4 2RS54 1PVC4 4RHV4 2RM24 1RVF4 1RUC4 1POV0 2PLV4 3JD74 4Q4Y4 2RS34 1PO24 1OOPD 4Q4X4 2RS14 1AL24 1RUE4 1NCQD 1PO14 2X5ID 1RUD4 2RR14 1HXS4 1R084 1VBD4 1COV4 2R074 1Z7S4 3JBG4 4PDWD 1HRV4 2R064 4Q4V4 1H8TD 1BEV4 1NA1D 1AR94 1RUH4 1VBC4 1EAH4 1RUG4 1MQTD 4GB34 1EV14 1K5MD 1VBB4 1RUF4 4Q4W4 3J8F4 2HWC4 1R094 2HWB4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HRI 4;  2R04 4;  1ASJ 4;  1VBA 4;  1RUI 4;  1PIV 4;  1VBE 4;  1D4M 4;  2RMU 4;  1AR6 4;  1AR7 4;  1AR8 4;  1RHI 4;  1RMU 4;  1RUJ 4;  1VRH 4;  2RS5 4;  1PVC 4;  4RHV 4;  2RM2 4;  1RVF 4;  1RUC 4;  1POV 0;  2PLV 4;  3JD7 4;  4Q4Y 4;  2RS3 4;  1PO2 4;  1OOP D;  4Q4X 4;  2RS1 4;  1AL2 4;  1RUE 4;  1NCQ D;  1PO1 4;  2X5I D;  1RUD 4;  2RR1 4;  1HXS 4;  1R08 4;  1VBD 4;  1COV 4;  2R07 4;  1Z7S 4;  3JBG 4;  4PDW D;  1HRV 4;  2R06 4;  4Q4V 4;  1H8T D;  1BEV 4;  1NA1 D;  1AR9 4;  1RUH 4;  1VBC 4;  1EAH 4;  1RUG 4;  1MQT D;  4GB3 4;  1EV1 4;  1K5M D;  1VBB 4;  1RUF 4;  4Q4W 4;  3J8F 4;  2HWC 4;  1R09 4;  2HWB 4; 
#chains in the Genus database with same CATH topology
 1HRI 4;  1ASJ 4;  1VBA 4;  2WDQ A;  1D4M 4;  1AR8 4;  1AR7 4;  1RUJ 4;  4RHV 4;  2PYL A;  1POV 0;  3AEA A;  3AE3 A;  3AE2 A;  1NCQ D;  2WU2 A;  1PO1 4;  3AE1 A;  2X5I D;  4YSX A;  3AEB A;  3AE8 A;  1VBD 4;  2R07 4;  1NEK A;  4YTM A;  4PDW D;  1HRV 4;  1H8T D;  2FBW A;  1MQT D;  3AE4 A;  3SUC A;  3FI7 A;  2WQY A;  1R09 4;  2WS3 A;  2RMU 4;  4KX6 A;  1RHI 4;  4YSY A;  2RS5 4;  3VRA A;  2WU5 A;  2RM2 4;  1RVF 4;  1KF6 A;  3AEE A;  3JD7 4;  1PO2 4;  1OOP D;  4Q4X 4;  1AL2 4;  1RUE 4;  3SFD A;  4YTP A;  1HXS 4;  1L0V A;  1YQ3 A;  2R7F A;  5C3J A;  2R06 4;  4Q4V 4;  1NA1 D;  1YQ4 A;  3AEG A;  3GQK A;  2PYJ A;  3SFE A;  1ZP0 A;  2R04 4;  1PIV 4;  4YXD A;  1RMU 4;  2H89 A;  1PVC 4;  1RUC 4;  2PLV 4;  4Q4Y 4;  3VR8 A;  2PY5 A;  1XHZ A;  4YT0 A;  4YSZ A;  3AE9 A;  3P4R A;  3AE5 A;  1RUD 4;  1R08 4;  2H88 A;  2WDR A;  1COV 4;  3AE7 A;  2WDV A;  3JBG 4;  3VR9 A;  2PW9 A;  1NEN A;  4YTN A;  3AEC A;  1VBC 4;  1EV1 4;  1K5M D;  3AED A;  4Q4W 4;  3J8F 4;  2HWC 4;  3ABV A;  2EX3 A;  2RS3 4;  3VRB A;  1RUI 4;  1VBE 4;  5C2T A;  1AR6 4;  1XHX A;  1VRH 4;  2WP9 A;  2B76 A;  2ACZ A;  3P4P A;  1XI1 A;  3P4S A;  2RS1 4;  1KFY A;  2RR1 4;  3CIR A;  1Z7S 4;  2PZS A;  3P4Q A;  3AE6 A;  1BEV 4;  1AR9 4;  1RUH 4;  1EAH 4;  1RUG 4;  3AEF A;  4GB3 4;  1ZOY A;  1VBB 4;  1RUF 4;  3GQH A;  2HWB 4; 
#chains in the Genus database with same CATH homology
 1HRI 4;  2R04 4;  1ASJ 4;  1VBA 4;  1RUI 4;  1PIV 4;  1VBE 4;  1D4M 4;  2RMU 4;  1AR6 4;  1AR7 4;  1AR8 4;  1RHI 4;  1RMU 4;  1RUJ 4;  1VRH 4;  2RS5 4;  1PVC 4;  4RHV 4;  2RM2 4;  1RVF 4;  1RUC 4;  1POV 0;  2PLV 4;  3JD7 4;  4Q4Y 4;  2RS3 4;  1PO2 4;  1OOP D;  4Q4X 4;  2RS1 4;  1AL2 4;  1RUE 4;  1NCQ D;  1PO1 4;  2X5I D;  1RUD 4;  2RR1 4;  1HXS 4;  1R08 4;  1VBD 4;  1COV 4;  2R07 4;  1Z7S 4;  3JBG 4;  4PDW D;  1HRV 4;  2R06 4;  4Q4V 4;  1H8T D;  1BEV 4;  1NA1 D;  1AR9 4;  1RUH 4;  1VBC 4;  1EAH 4;  1RUG 4;  1MQT D;  4GB3 4;  1EV1 4;  1K5M D;  1VBB 4;  1RUF 4;  4Q4W 4;  3J8F 4;  2HWC 4;  1R09 4;  2HWB 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...