1RUF4

Rhinovirus 14 (hrv14) (mutant with asn 1 219 replaced by ala (n219a in chain 1)
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords RHINOVIRUS 14
publication title Structural studies on human rhinovirus 14 drug-resistant compensation mutants.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1995-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ruf400
3J8F4 1R084 2R044 1RUG4 2RS34 1AR94 1RMU4 3JBG4 2RR14 4RHV4 4Q4X4 1NCQD 1VBC4 1AR64 2HWB4 1RUE4 1VBA4 1D4M4 4Q4V4 1EV14 1COV4 1EAH4 1RUF4 1K5MD 4PDWD 1HXS4 1OOPD 1PO24 2HWC4 4GB34 2RS14 1Z7S4 1POV0 1RUC4 4Q4W4 2R074 1H8TD 1RUJ4 1HRV4 2PLV4 1NA1D 2RM24 1AR84 1MQTD 1AR74 1AL24 1RUI4 1HRI4 1PIV4 1RUD4 1ASJ4 1VBD4 2X5ID 1RVF4 1VRH4 2RMU4 1PVC4 1RHI4 1VBB4 1VBE4 1BEV4 1RUH4 4Q4Y4 3JD74 2R064 1R094 2RS54 1PO14
chains in the Genus database with same CATH superfamily
1ZOYA 1R084 2R044 1RUG4 2RS34 2PW9A 3P4QA 2PYLA 4Q4X4 1AR64 2EX3A 4KX6A 1EV14 1OOPD 2HWC4 1YQ4A 2RS14 3GQHA 1H8TD 3AEAA 1KF6A 3AE6A 5C3JA 4YSXA 1NA1D 1AR84 3GQKA 2B76A 2H89A 3SFDA 4YTMA 3AE9A 2FBWA 4YTPA 3FI7A 2WDRA 2WDQA 1R094 1XHZA 1RUF4 1PO14 4YTNA 1RMU4 1VBC4 3AE2A 1XHXA 1VBA4 1D4M4 4Q4V4 3AEBA 4YSZA 4PDWD 1HXS4 2WP9A 3P4RA 2WDVA 1NENA 1RUJ4 3AE5A 2WS3A 2H88A 2PY5A 3AE1A 2RM24 1AR74 2WQYA 1AL24 1RUI4 1HRI4 1PIV4 2X5ID 1RVF4 2RMU4 1RHI4 3AE7A 4YT0A 3CIRA 2R064 3ABVA 3JBG4 1AR94 5C2TA 2R7FA 1NCQD 3VRBA 1RUE4 4YSYA 1YQ3A 1COV4 1EAH4 1ZP0A 1K5MD 1PO24 4GB34 4Q4W4 1RUC4 2R074 1HRV4 4YXDA 3AECA 3P4PA 3SUCA 3AEGA 1L0VA 1VBD4 1RUD4 1ASJ4 1KFYA 2PYJA 1NEKA 2WU2A 3P4SA 3AEFA 3SFEA 3AE8A 2WU5A 2PZSA 3J8F4 4RHV4 2RR14 3VR9A 2HWB4 1XI1A 3AE3A 1Z7S4 1POV0 2ACZA 2PLV4 1MQTD 3AEEA 3AEDA 1VRH4 1PVC4 1VBB4 1VBE4 3AE4A 1BEV4 1RUH4 4Q4Y4 3VRAA 3VR8A 3JD74 2RS54
chains in the Genus database with same CATH topology
3J8F4 1R084 2R044 1RUG4 2RS34 1AR94 1RMU4 3JBG4 2RR14 4RHV4 4Q4X4 1NCQD 1VBC4 1AR64 2HWB4 1RUE4 1VBA4 1D4M4 4Q4V4 1EV14 1COV4 1EAH4 1RUF4 1K5MD 4PDWD 1HXS4 1OOPD 1PO24 2HWC4 4GB34 2RS14 1Z7S4 1POV0 1RUC4 4Q4W4 2R074 1H8TD 1RUJ4 1HRV4 2PLV4 1NA1D 2RM24 1AR84 1MQTD 1AR74 1AL24 1RUI4 1HRI4 1PIV4 1RUD4 1ASJ4 1VBD4 2X5ID 1RVF4 1VRH4 2RMU4 1PVC4 1RHI4 1VBB4 1VBE4 1BEV4 1RUH4 4Q4Y4 3JD74 2R064 1R094 2RS54 1PO14
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J8F 4;  1R08 4;  2R04 4;  1RUG 4;  2RS3 4;  1AR9 4;  1RMU 4;  3JBG 4;  2RR1 4;  4RHV 4;  4Q4X 4;  1NCQ D;  1VBC 4;  1AR6 4;  2HWB 4;  1RUE 4;  1VBA 4;  1D4M 4;  4Q4V 4;  1EV1 4;  1COV 4;  1EAH 4;  1RUF 4;  1K5M D;  4PDW D;  1HXS 4;  1OOP D;  1PO2 4;  2HWC 4;  4GB3 4;  2RS1 4;  1Z7S 4;  1POV 0;  1RUC 4;  4Q4W 4;  2R07 4;  1H8T D;  1RUJ 4;  1HRV 4;  2PLV 4;  1NA1 D;  2RM2 4;  1AR8 4;  1MQT D;  1AR7 4;  1AL2 4;  1RUI 4;  1HRI 4;  1PIV 4;  1RUD 4;  1ASJ 4;  1VBD 4;  2X5I D;  1RVF 4;  1VRH 4;  2RMU 4;  1PVC 4;  1RHI 4;  1VBB 4;  1VBE 4;  1BEV 4;  1RUH 4;  4Q4Y 4;  3JD7 4;  2R06 4;  1R09 4;  2RS5 4;  1PO1 4; 
#chains in the Genus database with same CATH topology
 1ZOY A;  1R08 4;  2R04 4;  1RUG 4;  2RS3 4;  2PW9 A;  3P4Q A;  2PYL A;  4Q4X 4;  1AR6 4;  2EX3 A;  4KX6 A;  1EV1 4;  1OOP D;  2HWC 4;  1YQ4 A;  2RS1 4;  3GQH A;  1H8T D;  3AEA A;  1KF6 A;  3AE6 A;  5C3J A;  4YSX A;  1NA1 D;  1AR8 4;  3GQK A;  2B76 A;  2H89 A;  3SFD A;  4YTM A;  3AE9 A;  2FBW A;  4YTP A;  3FI7 A;  2WDR A;  2WDQ A;  1R09 4;  1XHZ A;  1RUF 4;  1PO1 4;  4YTN A;  1RMU 4;  1VBC 4;  3AE2 A;  1XHX A;  1VBA 4;  1D4M 4;  4Q4V 4;  3AEB A;  4YSZ A;  4PDW D;  1HXS 4;  2WP9 A;  3P4R A;  2WDV A;  1NEN A;  1RUJ 4;  3AE5 A;  2WS3 A;  2H88 A;  2PY5 A;  3AE1 A;  2RM2 4;  1AR7 4;  2WQY A;  1AL2 4;  1RUI 4;  1HRI 4;  1PIV 4;  2X5I D;  1RVF 4;  2RMU 4;  1RHI 4;  3AE7 A;  4YT0 A;  3CIR A;  2R06 4;  3ABV A;  3JBG 4;  1AR9 4;  5C2T A;  2R7F A;  1NCQ D;  3VRB A;  1RUE 4;  4YSY A;  1YQ3 A;  1COV 4;  1EAH 4;  1ZP0 A;  1K5M D;  1PO2 4;  4GB3 4;  4Q4W 4;  1RUC 4;  2R07 4;  1HRV 4;  4YXD A;  3AEC A;  3P4P A;  3SUC A;  3AEG A;  1L0V A;  1VBD 4;  1RUD 4;  1ASJ 4;  1KFY A;  2PYJ A;  1NEK A;  2WU2 A;  3P4S A;  3AEF A;  3SFE A;  3AE8 A;  2WU5 A;  2PZS A;  3J8F 4;  4RHV 4;  2RR1 4;  3VR9 A;  2HWB 4;  1XI1 A;  3AE3 A;  1Z7S 4;  1POV 0;  2ACZ A;  2PLV 4;  1MQT D;  3AEE A;  3AED A;  1VRH 4;  1PVC 4;  1VBB 4;  1VBE 4;  3AE4 A;  1BEV 4;  1RUH 4;  4Q4Y 4;  3VRA A;  3VR8 A;  3JD7 4;  2RS5 4; 
#chains in the Genus database with same CATH homology
 3J8F 4;  1R08 4;  2R04 4;  1RUG 4;  2RS3 4;  1AR9 4;  1RMU 4;  3JBG 4;  2RR1 4;  4RHV 4;  4Q4X 4;  1NCQ D;  1VBC 4;  1AR6 4;  2HWB 4;  1RUE 4;  1VBA 4;  1D4M 4;  4Q4V 4;  1EV1 4;  1COV 4;  1EAH 4;  1RUF 4;  1K5M D;  4PDW D;  1HXS 4;  1OOP D;  1PO2 4;  2HWC 4;  4GB3 4;  2RS1 4;  1Z7S 4;  1POV 0;  1RUC 4;  4Q4W 4;  2R07 4;  1H8T D;  1RUJ 4;  1HRV 4;  2PLV 4;  1NA1 D;  2RM2 4;  1AR8 4;  1MQT D;  1AR7 4;  1AL2 4;  1RUI 4;  1HRI 4;  1PIV 4;  1RUD 4;  1ASJ 4;  1VBD 4;  2X5I D;  1RVF 4;  1VRH 4;  2RMU 4;  1PVC 4;  1RHI 4;  1VBB 4;  1VBE 4;  1BEV 4;  1RUH 4;  4Q4Y 4;  3JD7 4;  2R06 4;  1R09 4;  2RS5 4;  1PO1 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...