1K5MD

Crystal structure of a human rhinovirus type 14:human immunodeficiency virus type 1 v3 loop chimeric virus mn-iii-2
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAT PROTEIN VP1 (P1D)
publication title Crystal Structure of a Human Rhinovirus that Displays Part of the HIV-1 V3 Loop and Induces Neutralizing Antibodies against HIV-1
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2001-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1k5mD00
1RUG4 3JBG4 4PDWD 1PIV4 2RS34 1VRH4 2RMU4 1RUI4 1VBA4 1VBD4 1HRI4 1HXS4 1AR94 1HRV4 4RHV4 1PO24 1COV4 3JD74 1AL24 1BEV4 1H8TD 1R084 3J8F4 4GB34 2R064 2RM24 1RUH4 1RMU4 1ASJ4 2X5ID 4Q4X4 1PVC4 1D4M4 2R044 2RR14 2PLV4 4Q4W4 1RUE4 1PO14 1RUC4 1RHI4 1EAH4 1OOPD 1VBC4 1Z7S4 4Q4Y4 1R094 1NCQD 1EV14 2RS54 1RUD4 1RUJ4 1NA1D 1RVF4 2HWB4 4Q4V4 1RUF4 1AR84 1K5MD 1VBE4 2R074 2HWC4 1POV0 1AR74 1MQTD 1VBB4 2RS14 1AR64
chains in the Genus database with same CATH superfamily
1RUG4 1PIV4 1XHZA 2WU2A 3SUCA 3J8F4 3FI7A 5C3JA 3AE7A 2B76A 3AE6A 2WS3A 3AEDA 3P4RA 5C2TA 3GQKA 4YXDA 1XHXA 2WDQA 2R044 1RUE4 1PO14 2PYLA 3AE9A 3AEFA 1YQ4A 3GQHA 1RUF4 1K5MD 2HWC4 2RS34 3AECA 1RUI4 1VBA4 1VBD4 1HRI4 3AE4A 4YSXA 1AL24 2WQYA 1NEKA 1RUH4 2WU5A 1ASJ4 4KX6A 3AEEA 4YTMA 4Q4X4 1D4M4 4Q4W4 1RUC4 1EAH4 1OOPD 1VBC4 2PZSA 4Q4Y4 1R094 1NCQD 2ACZA 2PW9A 1RUJ4 1NA1D 1ZP0A 2FBWA 4Q4V4 2H88A 1AR84 1VBE4 1POV0 3CIRA 4YSYA 2PY5A 1VBB4 4PDWD 3P4SA 3VR9A 4YTPA 1KFYA 1VRH4 3AE5A 1HRV4 4YSZA 4RHV4 1PO24 1R084 3AEBA 3SFDA 2R064 2H89A 2RM24 1RMU4 4YT0A 2X5ID 3P4QA 1PVC4 2RR14 2EX3A 3AE8A 1Z7S4 3VRAA 2WP9A 1EV14 1ZOYA 2RS54 3AE2A 3VR8A 2HWB4 3ABVA 1KF6A 1YQ3A 2R074 1RUD4 1MQTD 1L0VA 3AE3A 3JBG4 1NENA 2RMU4 1XI1A 1HXS4 1AR94 3JD74 1COV4 2WDRA 1BEV4 1H8TD 4GB34 3SFEA 3AEAA 3AEGA 2PLV4 1RHI4 3VRBA 3AE1A 2R7FA 3P4PA 1RVF4 4YTNA 2WDVA 1AR74 2PYJA 2RS14 1AR64
chains in the Genus database with same CATH topology
1RUG4 3JBG4 4PDWD 1PIV4 2RS34 1VRH4 2RMU4 1RUI4 1VBA4 1VBD4 1HRI4 1HXS4 1AR94 1HRV4 4RHV4 1PO24 1COV4 3JD74 1AL24 1BEV4 1H8TD 1R084 3J8F4 4GB34 2R064 2RM24 1RUH4 1RMU4 1ASJ4 2X5ID 4Q4X4 1PVC4 1D4M4 2R044 2RR14 2PLV4 4Q4W4 1RUE4 1PO14 1RUC4 1RHI4 1EAH4 1OOPD 1VBC4 1Z7S4 4Q4Y4 1R094 1NCQD 1EV14 2RS54 1RUD4 1RUJ4 1NA1D 1RVF4 2HWB4 4Q4V4 1RUF4 1AR84 1K5MD 1VBE4 2R074 2HWC4 1POV0 1AR74 1MQTD 1VBB4 2RS14 1AR64
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RUG 4;  3JBG 4;  4PDW D;  1PIV 4;  2RS3 4;  1VRH 4;  2RMU 4;  1RUI 4;  1VBA 4;  1VBD 4;  1HRI 4;  1HXS 4;  1AR9 4;  1HRV 4;  4RHV 4;  1PO2 4;  1COV 4;  3JD7 4;  1AL2 4;  1BEV 4;  1H8T D;  1R08 4;  3J8F 4;  4GB3 4;  2R06 4;  2RM2 4;  1RUH 4;  1RMU 4;  1ASJ 4;  2X5I D;  4Q4X 4;  1PVC 4;  1D4M 4;  2R04 4;  2RR1 4;  2PLV 4;  4Q4W 4;  1RUE 4;  1PO1 4;  1RUC 4;  1RHI 4;  1EAH 4;  1OOP D;  1VBC 4;  1Z7S 4;  4Q4Y 4;  1R09 4;  1NCQ D;  1EV1 4;  2RS5 4;  1RUD 4;  1RUJ 4;  1NA1 D;  1RVF 4;  2HWB 4;  4Q4V 4;  1RUF 4;  1AR8 4;  1K5M D;  1VBE 4;  2R07 4;  2HWC 4;  1POV 0;  1AR7 4;  1MQT D;  1VBB 4;  2RS1 4;  1AR6 4; 
#chains in the Genus database with same CATH topology
 1RUG 4;  1PIV 4;  1XHZ A;  2WU2 A;  3SUC A;  3J8F 4;  3FI7 A;  5C3J A;  3AE7 A;  2B76 A;  3AE6 A;  2WS3 A;  3AED A;  3P4R A;  5C2T A;  3GQK A;  4YXD A;  1XHX A;  2WDQ A;  2R04 4;  1RUE 4;  1PO1 4;  2PYL A;  3AE9 A;  3AEF A;  1YQ4 A;  3GQH A;  1RUF 4;  1K5M D;  2HWC 4;  2RS3 4;  3AEC A;  1RUI 4;  1VBA 4;  1VBD 4;  1HRI 4;  3AE4 A;  4YSX A;  1AL2 4;  2WQY A;  1NEK A;  1RUH 4;  2WU5 A;  1ASJ 4;  4KX6 A;  3AEE A;  4YTM A;  4Q4X 4;  1D4M 4;  4Q4W 4;  1RUC 4;  1EAH 4;  1OOP D;  1VBC 4;  2PZS A;  4Q4Y 4;  1R09 4;  1NCQ D;  2ACZ A;  2PW9 A;  1RUJ 4;  1NA1 D;  1ZP0 A;  2FBW A;  4Q4V 4;  2H88 A;  1AR8 4;  1VBE 4;  1POV 0;  3CIR A;  4YSY A;  2PY5 A;  1VBB 4;  4PDW D;  3P4S A;  3VR9 A;  4YTP A;  1KFY A;  1VRH 4;  3AE5 A;  1HRV 4;  4YSZ A;  4RHV 4;  1PO2 4;  1R08 4;  3AEB A;  3SFD A;  2R06 4;  2H89 A;  2RM2 4;  1RMU 4;  4YT0 A;  2X5I D;  3P4Q A;  1PVC 4;  2RR1 4;  2EX3 A;  3AE8 A;  1Z7S 4;  3VRA A;  2WP9 A;  1EV1 4;  1ZOY A;  2RS5 4;  3AE2 A;  3VR8 A;  2HWB 4;  3ABV A;  1KF6 A;  1YQ3 A;  2R07 4;  1RUD 4;  1MQT D;  1L0V A;  3AE3 A;  3JBG 4;  1NEN A;  2RMU 4;  1XI1 A;  1HXS 4;  1AR9 4;  3JD7 4;  1COV 4;  2WDR A;  1BEV 4;  1H8T D;  4GB3 4;  3SFE A;  3AEA A;  3AEG A;  2PLV 4;  1RHI 4;  3VRB A;  3AE1 A;  2R7F A;  3P4P A;  1RVF 4;  4YTN A;  2WDV A;  1AR7 4;  2PYJ A;  2RS1 4;  1AR6 4; 
#chains in the Genus database with same CATH homology
 1RUG 4;  3JBG 4;  4PDW D;  1PIV 4;  2RS3 4;  1VRH 4;  2RMU 4;  1RUI 4;  1VBA 4;  1VBD 4;  1HRI 4;  1HXS 4;  1AR9 4;  1HRV 4;  4RHV 4;  1PO2 4;  1COV 4;  3JD7 4;  1AL2 4;  1BEV 4;  1H8T D;  1R08 4;  3J8F 4;  4GB3 4;  2R06 4;  2RM2 4;  1RUH 4;  1RMU 4;  1ASJ 4;  2X5I D;  4Q4X 4;  1PVC 4;  1D4M 4;  2R04 4;  2RR1 4;  2PLV 4;  4Q4W 4;  1RUE 4;  1PO1 4;  1RUC 4;  1RHI 4;  1EAH 4;  1OOP D;  1VBC 4;  1Z7S 4;  4Q4Y 4;  1R09 4;  1NCQ D;  1EV1 4;  2RS5 4;  1RUD 4;  1RUJ 4;  1NA1 D;  1RVF 4;  2HWB 4;  4Q4V 4;  1RUF 4;  1AR8 4;  1K5M D;  1VBE 4;  2R07 4;  2HWC 4;  1POV 0;  1AR7 4;  1MQT D;  1VBB 4;  2RS1 4;  1AR6 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...