2PZSA

Phi29 dna polymerase complexed with primer-template dna (post-translocation binary complex)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GACTGCTTAC)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 165
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pzsA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pzsA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pzsA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pzsA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pzsA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pzsA06
3T19A 3CFOA 4FJLA 3QERA 1KVBA 3ZSRA 4ELTA 4HUFA 1RT5A 2HHUA 4FM1A 4H4MA 3H08A 4C8MA 3C95A 2XO7A 1NOYA 1BHLA 4DQPA 3RRGA 1I39A 4Y1DA 4CIEA 5SZTA 4FZXC 2YNHA 1NKEA 1QHTA 1VK0A 3ZSOA 1YT3A 1IKVA 1VSLA 1BISA 5HP1A 3KTQA 4CGFA 3LWLA 1GOAA 1RT3A 4KI6A 1S1XA 2HHXA 3DYAA 1JLEA 5DK5A 2ZQBA 4B9NA 3NBPA 1T03A 4PWDA 4DTSA 4PA1A 4CEAA 4CJKA 1BL3A 1GOCA 1HRHA 3LPUA 3VN5A 3V4IA 3TAQA 4AHSA 4H8KA 1NJYA 2FBTA 5D3GA 1C0UA 1SL1A 3TAEA 4CE9A 4IKFA 4OPJA 4R5PA 4Q5VA 4I9QA 3DLGA 1W0HA 1A5WA 4FJJA 3VQEA 3K5MA 4CHQA 3VQDA 4E3SA 4EP5A 2P51A 4O4GA 2OZMA 3L2WA 3E01A 1SKSA 3KD1E 2DFFA 3CFPA 2HMIA 1UA1A 4CEEA 3NF6A 4NCGA 3L8BA 3L3UA 3L2RA 1KLNA 3HK2A 5T7BA 2OZSA 4FZYA 3RMBA 3SUNA 2GBZA 4OVLA 4AHTA 3ITHA 4O55A 4HHTA 2DFEA 4K8XA 4M3XA 3KD5E 3DOKA 4FJ9A 4CF9A 3V9ZA 4Z4FA 3OYGA 1LAVA 1HJRA 2R7YA 2XY8A 3OYNA 3TI0A 3NE6A 3AVCA 4O5BA 3AVHA 5C24A 4TSXA 4E89A 2GUIA 4GW6A 3FI7A 4W5NA 1WAJA 4CIGA 4BDPA 3S3NA 1U4BA 4Y1CA 1HYSA 4LH5A 1U48A 1C0MA 1KRPA 3LZIA 4ZTJA 1R0AA 3TR8A 2FBXA 3DLRA 2BGGA 3AVLA 4M3UA 4AH9A 1U47A 4ZTFA 2HNDA 4FJ8A 1SL2A 3OYCA 3V9SA 3JSMA 1D9DA 2Y1JA 3BGRA 4YNQA 4B9LA 3SNNA 2IGIA 4KHSA 4JS5A 5I42A 3C6TA 1DTTA 1Z26A 4BWMA 1NJXA 4FLWA 3F9KA 4ELVA 3V9XA 4FJ7A 1NK5A 5FRMA 2KTQA 2G8VA 2KZMA 1A5VA 4O44A 4Z0UA 2P5GA 1TK5A 3VA0A 1S6PA 4IBNA 1QQCA 2QXFA 4M42A 1KCFA 1RT7A 3OYKA 4KB0A 3M8PA 4FK4A 1JLAA 3TAPA 1ZBIA 4GMJB 4CHNA 4XIUA 3KK1A 2YKNA 2PYLA 4BACA 4B9MA 3KLHA 4F8RA 3PY8A 2BDPA 4G1QA 1Z25A 1BQMA 1LW2A 3KKRA 3OJUA 3TANA 1X9WA 1TAQA 2E4LA 2Q3SA 3HPHA 4CESA 4N56A 1XC9A 1T8EA 4IFVA 3LWMA 1K6YA 3ALYA 1XWLA 4ICLA 5HRRA 3QEVA 3ULDA 3SUPA 4M3YA 4BDYA 3S3OA 3TAMA 1ZYQA 1SKRA 1IH7A 5J2QA 2PZSA 4HCBA 2KZZA 4DSFA 1A5XA 4FLVA 1XHZA 1KFDA 1L3TA 3G10A 4JRQA 3C6UA 4ZHRA 1RILA 2VG7A 3THVA 2PYJA 3RTVA 3V1QA 1CLQA 4KREA 1DLOA 3DRPA 4NYNA 3OYDA 5J2NA 4DTOA 4O0IA 1UA0A 1RDCA 5J1EA 3HT3A 4CJQA 5HBMA 4C8OA 5J2PA 3LALA 2XY5A 3HM9A 4CFCA 4FM2A 1CZ9A 2YKMA 4KAZA 4B8AB 3D0PA 3NGYA 3T3FA 1C0TA 4CFAA 3VQ9A 4CGGA 1RDAA 1NK6A 3DLHA 1G15A 4LSNA 2XY6A 4Z4HA 2HNYA 4E7KA 4C8KA 2HVHA 4JS4A 1RDBA 3VQCA 1JKHA 1F21A 1KVAA 1TAUA 2EHGA 4CGJA 1FKOA 1QTMA 4FLTA 4M3TA 5HRNA 4ID1A 4CHPA 4DLGA 4DU1A 4M45A 3DRRA 3KLFA 4DQQA 3AO3A 2RPIA 3QIOA 4WE1A 3SPZA 4CGIA 3WNFA 1HNIA 1IKXA 1C1BA 1ASVA 3VQBA 3OYLA 3SUQA 1B92A 4QCLA 5SWMA 1S9GA 4CEFA 4DWIA 2OA8A 4I7FA 3U3GA 4I2PA 3KLIA 3O3GA 3OYIA 2NUBA 4E7JA 4FK2A 3O3FA 1RT6A 4BDZA 3RRHA 2A1SA 1HNVA 5KGWA 4F4KA 1YTUA 4FW2A 3LAMA 1X1PA 2FC0A 3LP0A 4FJHA 2X74A 4KTQA 2R7FA 4LH4A 4EZ9A 1HMVA 2RF2A 5KTQA 4CHZA 2G8HA 2O4GA 1TKXA 4C8NA 2RN2A 2OPRA 3AO4A 3U3YA 4PQUA 2QK9A 4E7IA 1TVRA 5JS2A 4KB1A 4EP4A 4RW9A 4DS5A 2X6SA 4OJRA 2FBYA 4RW7A 1VSDA 3AA4A 4DFKA 1S6QA 1C1CA 3V1RA 4FJ5A 2HW3A 2KFZA 3AVMA 3LANA 3TABA 3ZT2A 4FJGA 1VSIA 4PUOA 2HB5A 3EZ5A 3IAYA 4M3WA 3L2UA 3I0SA 2B5JA 1RBRA 3LP2A 5JS1A 3HYFA 3CG7A 3FFIA 4M41A 5KI6A 3VQ7A 4RW8A 3TWHA 1J5OA 2HHTA 4N41A 3KKSA 4FYDA 2YNFA 2Z1IA 1BQNA 4BE0A 1J54A 3K58A 4HUEA 3V9UA 3AVBA 3DLBA 3KIOA 1NKBA 4DSLA 4ELUA 4F3OA 4CEQA 2E6LA 5KRTA 1W9HA 3SI6A 3AVJA 4DTXA 3KJVA 3K5NA 1WSGA 1S1UA 1YTAA 4DU3A 2G8IA 3QETA 4Z4CA 3MXMA 2D0CA 1TL3A 1TKZA 4DG1A 3RWUA 2IS3A 4O0JA 4CFBA 3OY9A 4HUGA 3VQAA 3SPYA 3K5OA 4KRFA 1BCOA 4BE2A 2BANA 2O4IA 3B6OA 2OPPA 3HP6A 3HVRA 1B9FA 1RT1A 2BE2A 3CM5A 1JL1A 4RW4A 4DF4A 4IDKA 4W5OA 1TK8A 3C94A 2VG5A 1NK7A 1DTQA 3P5JA 5CZ2A 1NKCA 3SQ2A 4MFBA 2G8UA 1T05A 4KTWA 1U04A 4CJFA 2VG6A 1RT4A 4FJNA 2KQ2A 4FLXA 3AA2A 1JXEA 1TL1A 1WSJA 3PX0A 5K14A 4HCCA 4B9UA 3QEPA 2YNIA 2EX3A 1BCMA 4DFJA 2G8WA 4NCBA 4DFPA 5CZ1A 2OYQA 3DOLA 3ZT3A 4CK1A 4B8CA 1VRUA 3KK2A 3KLEA 1FXXA 5HLFA 3MECA 4N76A 4J2AA 2XHBA 2XY7A 3SQ1A 1LV5A 3JYTA 1CXUA 3DMJA 5CY4A 1TV6A 3V6DA 3K59A 3SYZA 3K5LA 4CECA 4OGCA 4CGHA 1WSFA 4K8ZA 1J9AA 3DI6A 3TAFA 4N47A 4W5RA 3AVGA 3IRXA 4LSLA 2F8SA 3AVNA 3SUOA 1IKYA 3SV4A 1ZBHA 3LAKA 1HYVA 4CF8A 1RT2A 3ZT4A 4DU4A 3AVKA 2ATQA 2YNGA 4KFBA 3OYHA 3CYMA 4LD0A 4Z4EA 3QNNA 2G8FA 1JLCA 5DMRA 4L8RB 1JXBA 4E19A 3OYMA 4CJSA 1CXQA 3HO1A 1QE1A 3IG1A 3MAQA 1ZBFA 4DS4A 4CHOA 3SQ0A 1VSMA 1FK9A 4FLYA 1YVUA 1NJWA 4DQRA 1QSYA 2HHWA 2P1JA 3DM2A 3LZJA 3EY1A 4DTUA 4N5SA 2Y1IA 3ZSVA 3NDKA 2P5OA 1RNHA 4CJRA 4DSIA 4BWJA 4AHUA 4KO0A 4AILC 4ID5A 2IAJA 4KKOA 1O1WA 4CJWA 4KHQA 4Q0BA 1HPZA 3KLGA 3V9WA 4OGEA 5HROA 1D8YA 3M8QA 4E0DA 1BGXT 4CJUA 2JGUA 2D5RA 3DLEA 1XI1A 1VSKA 2X6NA 2B4JA 2B6AA 4CJPA 3OYEA 3AV9A 5C42A 4B08A 1KVCA 3LDSA 3IS9A 1C6VA 1WN7A 2Z1HA 1X9SA 2HHQA 3MEEA 2AJQA 4J2EA 2KW4A 1J53A 3SJJA 4CJ5A 1WAFA 3DRSA 1D9FA 3DLKA 4CK2A 4OKKA 4J2BA 5FDLA 2DY4A 3MEGA 3VQPA 3P83D 3PUFA 2IC3A 4FZZA 3NF9A 1BIZA 1JLGA 1UWBA 1WSIA 4QAGA 4NYFA 4CJ4A 4CHYA 4CK3A 4FJMA 4FJKA 3O4QA 3QESA 1KLMA 1SUQA 1ZBUA 1TK0A 4F2RA 3MXJA 3HL8A 3VQ8A 2WOMA 4E1NA 5E41A 4OKEA 5HRSA 4E7LA 3UIQA 4B9TA 4BE1A 2WONA 1VSJA 1QSLA 4DFMA 1LWFA 3VQ5A 1BI4A 4CJTA 1U45A 2G8KA 4I9LA 3AO1A 1RTJA 2DTUA 3S3MA 4CEZA 4CIFA 4M3ZA 3ZCMA 4KI4A 2OPSA 3RR8A 1B9DA 1FKPA 1EETA 4AHRA 1D5AA 3ZT1A 5CYMA 2A1RA 1TKTA 4CJLA 1QS4A 1L3SA 4HTUA 1WSEA 3HP9A 1XHXA 3O4NA 1REVA 3HXMA 5J2MA 1IG9A 3PV8A 3K2PA 2OPQA 4FJIA 4YFUA 3I8DA 1C1AA 2D0AA 1NK8A 4JLHA 2PY5A 2PW9A 3OYJA 1UOCA 3LP3A 4KV8A 1TKDA 5FROA 1JL2A 3CQ8A 2HHSA 3KK3A 2KFNA 2GV9A 3ZSYA 4CGDA 3WNEA 3HPOA 3NCIA 4FXDA 2HHVA 3OJSA 1SKWA 4DSJA 3PO4A 3O3HA 4HVJA 4RG8A 3L2QA 5CYQA 1VRTA 3L2VA 3EYZA 2DFHA 3U6FA 1N5YA 3NF8A 1NK4A 4IFYA 4OKJA 4GVMA 4UQGA 5I3UA 1RBUA 1RCHA 4IG3A 4E1MA 4CEDA 4QOZB 4OLAA 4EZ6A 3OS2A 2LSNA 3ASMA 5FRNA 3SCXA 1UAXA 3ZSWA 5KGXA 1RTIA 3AA3A 1CZBA 4FLZA 2IOCA 1L5UA 1S1WA 5HRPA 3OYBA 2W42A 4DQIA 2QKKA 4DTRA 3ZT0A 4CF1A 1RTHA 3CM6A 3WNHA 4FM0A 1ASWA 1NOZA 2Z1GA 4CERA 4DMNA 3SZ2A 1NK0A 1N6QA 4FLUA 1IO2A 3I0RA 1L3UA 4B3OA 1RBVA 2F96A 2YHBA 3NH0A 3MXIA 3T1AA 3HJFA 4DTNA 3M8RA 2ITGA 4CJVA 2I5JA 2RKIA 1LAWA 1I3AA 3TAGA 1Q9XA 3BDPA 1LWCA 3ISNC 4DLEA 5EU7A 4Z4GA 1NK9A 1HQUA 1VSFA 3OVNA 1KSPA 2ZD1A 3HSTB 2Z1JA 4FVMA 3QLHA 4DTMA 1T7PA 1WSHA 3S9HA 1U49A 4NCAA 4DTJA 1SL0A 3AVAA 1S1TA 4DTPA 2JLEA 4OLBA 1L3VA 1SV5A 3NF7A 3SV3A 4CEBA 1RDDA 1RBTA 4CEOA 3A2FA 1JLBA 1S1VA 2D0BA 1KTQA 1ZBLA 1S9EA 4CJEA 3OS0A 1EP4A 3PO5A 2E6MA 3QINA 3NFAA 2FBVA 3MEDA 4B9SA 4AHVA 2XRIA 1LW0A 2HNZA 3NHGA 4CFDA 2YV0X 1EXQA 3SQ4A 3PX4A 1WLJA 4OPKA 3QIPA 1Q9YA 1HYZA 1QSSA 4KHNA 1RBSA 3OS1A 4DSKA 1HQEA 2IDOA 3P1GA 5KRSA 1JLQA 3QEXA 2QKBA 3HVTA 3OYFA 3VQ6A 4E7HA 3L3VA 3VQQA 3ZSZA 4W5QA 4DQSA 3WNGA 3PX6A 2YHAA 1X9MA 1Y97A 3NH1A 1S5JA 1JLFA 4Z4IA 4KHUA 4CF0A 1EX4A 1VSHA 3QO9A 4M3RA 4F3TA 1GOBA 1KFSA 1ITGA 3F73A 4PY5A 2X78A 3AVFA 3AVIA 1NJZA 4DSEA 2VWKA 2ZE2A 3LPTA 1EKEA 5C25A 4KHYA 3NH2A 4FW1A 3TARA 4FJXA 3AO5A 3B6PA 1Q8IA 4DF8A 3QEWA 3LP1A 3K57A 3QNOA 3RR7A 3ZSQA 4I2QA 4KTZA 4F2SA 1VSEA 1BI4B 3NAEA 4FK0A 4KHWA 1LWEA 3VQ4A 4LY7A 3QEIA 4B9VA 3AO2A 2VWJA 3AA5X 1MU2A 1ASUA 3HPGA 4H4OA 4CJ3A 3CFRA 3VA3A 4MQ3A 3D45A 4RW6A 3RMDA 4KPYA 4FCYA 2HVIA 4CF2A 3V1OA 4W5TA 4C8LA 1TGOA 3RMAA 3M8SA 4AHCA 1IKWA 4J2DA 3NGIA 1RTDA 3V81A 3OYAA 3NGZA 2ETJA 3ZSXA 1BIUA 4IG0A 3RMCA 3G0ZA 4CCHA 2F8TA 1WNSA 4JRPA
chains in the Genus database with same CATH superfamily
2YXYA 1EV14 2UU9B 1IV0A 3UKUA 4GV9A 1F4MA 3QERA 1YQ3A 2IW5A 4X20B 1KVBA 3PSIA 4I6MA 3B09A 3FZHA 1ATRA 3OUSA 3H08A 1PO24 3C95A 2ZE5A 1M9NA 4K43A 1BHLA 3CJAA 3WG7C 2YI8A 4DQPA 3RRGA 2F4VO 1M56B 3AEDA 4CIEA 5SZTA 4FZXC 1WB9A 1WA8B 1YT3A 4PDWD 2YCHA 1FXVA 1BISA 3B8MA 5HP1A 1NU0A 5I9EB 3MCPA 1HX1A 4CVNE 3LWLA 4GUNA 4DYLA 1RGIA 1GOAA 5IWAK 1VQ5N 1AI5A 3OEHG 1OCCB 2WLIB 2QWPA 5ADXH 4YOTA 4DK0A 4FWMA 1KAXA 3AAPA 1T03A 2W41A 3U4LA 3CRAA 4FWRA 3HKCB 4CEAA 4DTSA 4PWDA 2O8DA 1BA1A 3LPUA 3JASA 3UO3A 4H8KA 2YUAA 3AEGA 1SL1A 1QZ6A 5KMGA 1YUWA 4LF7O 1AVMA 5IJ0B 4IKFA 5CB4B 4DR2B 2RQ6A 4I9QA 4JI5B 1W0HA 4WQ5C 2E75B 3RWRD 3K5MA 3F9MA 3VQDA 4A57A 4E3SA 1E79G 3CD6V 2P51A 2FF6A 1BO5O 2VGNA 2WLHA 3SDLA 3CFPA 3KCYA 1SAZA 3SYCA 1UA1A 4NCGA 3L2RA 2VQEK 3O1WA 3AY9A 1G6UA 3RMBA 4O8UA 4K42A 1K5SA 3IC7A 4HHTA 2DFEA 3SAGA 3DOKA 4C1NK 3RYFA 1MOFA 3S41A 4FJ9A 2R9AA 3I56N 1HR0O 4WYBA 2XY8A 4MVZA 1Q82W 3E2EA 3AVHA 5IJ9B 4YHHB 4MDAA 5C24A 3AG2B 3LDEA 4ZOLB 1J5EB 3MN9A 5KPTA 2QKSA 1H8HG 4I55A 1H38A 1VQ9N 5KX5A 2ITDC 2JJ1G 1DGSA 4OX9B 2OCEA 4CIGA 2JK5C 4X62O 1HNWO 1JCHA 4LF9O 5C10A 1HYSA 3VRBA 1R0AA 2JGDA 2R70A 2IJJA 2E5LO 3ENBA 1HNZB 5LXTB 3O9OA 4L3QA 2BGGA 3QMLA 1U47A 1Q3EA 3K0GA 2P9LB 4G28B 4YNQA 1L0NH 1HRV4 2WLLA 3E8HA 4JS5A 5I42A 1ZOYA 4JF3A 1F7YA 4YOWA 1Z26A 4UCSA 3P30A 2CTPA 2CK3G 4FK5C 1NJXA 1AR5A 4FLWA 4JTCB 2HHHO 1BUPA 3F9KA 2IIRA 4DQ8A 4FJ7A 5FRMA 2OTLN 2G8VA 4W4LA 4OXSA 1NTZH 1S6PA 4M42A 4FFBA 1RT7A 4MO4A 2CTRA 3OYKA 3VGLA 2WA3A 3C90A 4B3RK 1NU1H 4FK4A 2HVIA 2E2NA 3T1YO 1GN2A 2BDPA 1I7FA 1Z25A 4JPRA 1BQMA 3J7YP 3OJUA 4K0KK 1AR74 5IYDO 1GTOA 2YHYA 3HPHA 3CCRN 2BTQA 2WBNA 4NVPA 2FXUA 5KAFZ 2RCVA 4ICLA 4RTFD 4Z94A 4BDYA 4RQEA 2NNUA 1ZYQA 1VQ4N 3VQYA 2ZM6O 3AG7A 1T6CA 3RW0A 3L75H 4CBCA 4F9OA 4UVCA 1NH2B 2QWQA 2P9UB 3K79A 4HCBA 3ASOC 1EFRG 3TPQA 1OCZB 3EE9A 3ZETA 4FLVA 4BR5A 5BY1A 5KHKA 1YI2V 2BOCC 3TU5A 2K9PA 3FB5C 4JRQA 5DECA 3SFDA 1XEQA 4KREA 3CCMN 3BEHA 1GH6A 4LF8O 1NGIA 1RDCA 1Q86W 5J1EA 4BW5A 2LFSA 3HT3A 2QEXN 1OHHG 5EZYB 3E9OA 5J2PA 4P2ZA 2AHZA 2XY5A 3HM9A 4DR7B 2R064 1HLUA 1CZ9A 1RUF4 1NQTA 4TWKA 4B8AB 4O2BA 2QTDA 2DYSC 4KH4A 2YI9A 4TV8B 4UVBA 3VQ9A 4J9ZB 3AGKA 4EIAA 1P8ZA 3DLHA 2E3CA 4YOVA 1IBMK 1AROP 2CGJA 1BGYH 5KHIA 4MVMA 1IBKO 3E35A 1RDBA 4JS4A 3DXRB 3ZBHA 1KBHA 4TV9B 3O9TA 1F21A 3AE2A 3BEXA 2YIDA 4MT8A 4F6RA 2EHGA 1QTMA 1L0LH 4U7OA 4YJ2A 3QICA 4K25A 4CHPA 1SC5B 1WB7A 4QPJA 4H5TA 4CZFA 4DLGA 4IOXA 1VQNN 3DRRA 4PL7A 4BQZA 3SPZA 2FBWA 2FLOA 1VARA 2H3OA 2CH7B 3OYLA 4QCLA 1G1XB 1YTFD 5SWMA 3ID8A 3U10A 4E7JA 4I2PA 3O3GA 2NUBA 4FK2A 3EFFK 4YTPA 3ETGA 4H13B 1VQON 3WXJA 1HNVA 1WP7A 3RBZA 3LAMA 1WLEA 2ZCEA 3LUTB 5J2TB 1RPOA 5C93A 5BRHA 2O4GA 3TSQA 4CC6A 1S0VA 2RN2A 2FTKA 2QK9A 5AQRA 5BPNA 1SRYA 4E7IA 4JAXA 1P7BA 4DS5A 1KKDA 3EKUA 3O9RA 4RW7A 2FKXA 1S6QA 5H6RA 2PI5A 4UCRA 4IGGA 3LANA 3ZT2A 1XUQA 5AZJA 1RPRA 4M3WA 3I0SA 3MWTA 1ZXOA 5JS1A 3OTOK 1N32K 3HYFA 3FFIA 5KI6A 3TWHA 2DQ3A 3WU2Z 4RW8A 2UXDK 4GKJO 2YNFA 4X20A 1UJWB 1BQNA 1J54A 1A32A 2VRZA 3DLBA 4GYCB 4DSLA 1NKBA 3SJAC 3GBTA 4GY2B 3T69A 1BEV4 1HJOA 4ISGA 4WFBL 3T4ZA 3CC7V 3C6HA 3KJVA 1P7GA 3D36A 4CBWA 5B1BC 4Z4CA 1N34O 1KP2A 4DG1A 3CB2A 4O0JA 2E2PA 3GQKA 3FD9A 2UU9K 4BE2A 2O4IA 1NENA 4JHDB 2OPPA 4DR6B 2EIKC 3SJBC 3O9QA 4B1UB 1M56C 2BE2A 1EO1A 1JL1A 4LNUB 4IDKA 1K8AW 1TK8A 1QNMA 1RP3B 4H0TB 4I4TB 2LFRA 3LNMB 3P5JA 5CZ2A 3SQ2A 4JV5K 1ASJ4 1ZWIC 2RN9A 2WLIA 2HKOA 3G4SV 4FLXA 4H5WA 3HKCA 3AEAA 2BTFA 3J81O 1GRJA 1KMIZ 3QEPA 2YNIA 3CCEN 1SS3A 4UXNA 4JI0B 5IJ0A 4DB3A 5CB4A 3OA9A 4DFPA 1WJZA 5CZ1A 2XT9A 3ABUA 5HLFA 5AJ3K 4DW1A 4NLBA 3DXKB 1CXUA 5ELZA 3UE5A 3V6DA 5BMVB 4BRKA 2BSKB 4YY3O 2NZTA 1QLEB 1J5OA 1WSFA 3TAFA 1KC8O 2QWLA 4KXRA 3WT0A 3DC6A 4IOCL 5E1AC 3SV4A 4CF8A 4LF6O 1FS0G 4G27B 1T3VA 2AP1A 3AVKA 2ATQA 3OFNG 2YNGA 4DR4K 1DEJA 5BPMA 3H1JH 3O8MA 4YTMA 4Z4EA 3TETA 2G8FA 2GWJA 4EKWA 3WEEB 4E19A 4XH5A 1G4YB 3KWGA 5IJ9A 5LGUA 1CXQA 3GDQA 5CBGA 4ZOLA 1BCCH 4K3AA 3MAQA 1ZBFA 4BIUA 1LOTB 4ISEA 1YJ9N 1NJWA 5F1XA 3VEOA 2HHWA 3VF2A 3GG4A 1MZEA 4DTUA 1IDSA 3ZSVA 5LXTA 1XOUA 2IBZH 5H5NA 3SR2C 3J8F4 1ZL8B 4BWJA 1J5EK 2UXCK 2P9LA 4BGBA 4AI8A 3CMEN 1S76D 1Y6XA 1HPZA 5LMNO 1Y74B 1I5XA 5FLXN 4H0YB 3VF4A 3V9WA 2JGUA 3M3ZA 4YOYA 1Y66A 2W6LA 3DLEA 1HNZK 2Q97A 3AE8A 1VHXA 1AP6A 5H9CA 1RFQA 3EO3A 1AI6A 2Q5ZA 4R6ZA 3OGCC 5H2FZ 4RWTA 5CA0B 4CZEA 4LF5O 1MSDA 1K4CC 3S3XA 3LSSA 3CQXA 2WU2A 1AI4A 1X9SA 2AJQA 2KLAA 5GAGP 4J2EA 2PI4A 4JI7B 1EWRA 3SJJA 1MZFA 3FZLA 4CK2A 2LGWA 3SAHA 1M4UA 2XAFA 1VIBA 3SPCA 2D0OA 3PUFA 4YORA 4B1YB 4J7JA 1OJHA 3NMUA 1BIZA 1ILYA 3K9KA 4CK3A 1L0VA 2P9UA 3WXMB 1NT2B 4JI6B 3VQVA 1KLMA 1SUQA 3IMXA 1TK0A 3HL8A 4DV0O 1MABG 2NRVA 4LCUC 2WOMA 4OKEA 2ITCC 5M1KA 3UO2A 2DMXA 3HOTA 1QSLA 4OPHA 1U45A 3L72H 3ZYYX 5KA6A 3EHBB 4PA7A 4M3ZA 3ETEA 1IVSA 1NZ6A 1R3LC 1YCIA 3APOA 2QXLA 1FKPA 2YS8A 3ZT1A 4DV7B 3JSNA 2I7NA 2A1RA 4CJLA 4EFBA 2D0PA 4TV8A 1WSEA 4FJCC 3OHRA 5GADP 1H2MA 3JS6A 5KHGA 1IG9A 4DUZB 3PV8A 3VOUA 2OPQA 5JH7B 3I8DA 3QO8A 4DV3B 2D0AA 1NK8A 2QA4N 3DXRA 4TV9A 4KV8A 1TKDA 4JI4O 5KPZA 5FROA 3ML0A 3A5OC 2HHSA 3CERA 2H88A 2W0FC 5LMUK 4D6TH 1X59A 1ZP0A 1QBZA 1ZAUA 3Q4HB 2BH1A 3OJSA 3W7UA 4RG8A 4NO7A 3U6FA 1N33K 4DV2O 2UUAB 1NK4A 1KP3A 2A42A 4OKJA 2CH7A 4GVMA 5I3UA 4IG3A 1BL8A 1PP9H 2FL4A 2QWRB 4X64O 1RCHA 4CEDA 1V9PA 4OLAA 2YJFA 3G71N 2HBJA 4EZ6A 3OS2A 4JTAB 4I5SA 1EZVH 4NR1A 3TXQA 3RSEB 3J7AU 3CWBH 4FLZA 3QB0A 3BVOA 3LDLA 4DV1K 1S1WA 3LM9A 4DQIA 3ETDA 1H2KA 2HJFC 3FKSG 3SPHA 5J2TA 3VRAA 1Z5WA 2CE4A 1NOZA 1NK0A 1DF4A 4FLUA 4BQLA 1WAZA 2F96A 2VQFK 2IJHA 2ASOA 4DTNA 2A0LA 2ITGA 1R6KA 1RVF4 3B8NA 1LAWA 2OTJN 1LWCA 3ISNC 4BIZA 3N2KB 1KECA 3ZMTA 4F4LA 1HQUA 1VSFA 1OH7A 2GHYA 2ZD1A 1KSPA 2P9PB 2JIZG 4FVMA 5AQPA 4DTMA 4PDMA 1WSHA 3S9HA 2ETNA 2P22C 3FYEB 3VEZA 4DTPA 4JAUA 5AQZA 1L3VA 5CBHA 1ATSA 3DAWA 1PV0A 4U7NA 4A2BA 4FZ1A 3CJHB 3SBGA 4BREA 1KTQA 3CPEA 1DKGD 1M1KW 3ABKC 2N04A 4BC4A 3FZFA 4AHVA 4DR2O 2Q73A 3CCJN 3J80N 4JI5O 2QKAA 4LC1A 4X88A 1LW0A 2HNZA 4CFDA 1COV4 2YDEA 5AQWA 1JMKC 2WSSG 3RFRA 3WG7B 1WLJA 2NRXA 5M1QA 4BVOA 1KQSU 4OPKA 1GK9A 3VGMA 4LFCK 5AQXA 5IWAB 4DSKA 4YOXA 4J10A 4LNUA 3UM7A 4N21A 4I4TA 2GELA 3E89A 4DQSA 3ZSZA 1Q6UA 1YDXA 1X9MA 1VQMV 1T05A 3QNEA 2GTSA 2D4WA 1QR9A 4M3RA 3NR7A 4ABMA 1XBLA 2I7PA 2WTUA 5LHHA 4DR6K 4PY5A 3AEEA 1NGFA 4DR1B 2X78A 3AVFA 1YJWN 4KUMA 4YHHO 4XDLA 5EOYA 4YXWG 4JI1O 3A5NC 3NH2A 1F23A 4PV1B 4Z1MG 3N27A 2UUCB 4OX9O 4MTFA 3B6PA 3DXKA 3QNOA 4DF8A 3ZSQA 4WFHA 4I2QA 4F2SA 1BI4B 2VQEB 3VGKA 4MTGA 3QEIA 2VWJA 3HPGA 4UV8A 1MSWD 4BC2A 5LL6Y 3RMDA 4JI0K 4JKDA 3OGIB 3ZEUB 1IXBA 2YICA 4C8LA 1RUC4 1QQOA 3M8SA 3SMSA 1I0HA 1VQ5V 5LY3A 3OYAA 3W3DA 1KQSM 4DCHA 5E79Z 2PGGA 2ZF5O 3ATVA 3G0ZA 4CCHA 1WNSA 3K9JA 4YDUC 3T19A 1RUH4 1IBLB 1S3XA 4FFKA 4U3JB 3M6GA 2IJIA 3ZSRA 4CH6A 1RT5A 2IVPA 4HUFA 3K0DA 4B3TO 2HHUA 4FM1A 2B9ZA 3H1VX 3HI0A 2KB1A 3SMPA 3ATUA 4FMTA 4A59A 4JZGA 1I39A 2X6AA 1R6NA 3D6RA 1QHTA 4J41A 1Q82O 1XC3A 1ZL8A 1IKVA 1BDGA 1BS3A 4NXMK 3AECA 3ASNC 4CGFA 1Y74A 1RT3A 2F43G 1XNRB 2YHWA 3STLC 3J8AA 4IZ9A 1H2LA 1NR1A 1R094 3BFRA 4X1IB 4CZHA 2DPNA 1GOCA 2WFBA 5D3GA 3TAQA 5CA0A 5EVZA 2ZWHA 4FO0A 2OIEA 1R3IC 4K0KB 1VQ8N 3O65A 1KXPA 2QI2A 2JDIG 3JAWB 1OCRC 2ZDIC 3VEYA 2B1GA 3WXLA 4FWPA 1NGAA 2VS0A 4IJNA 4EP5A 3ZIAG 4DR7O 3M5RA 3HR0A 4P30A 5B3SB 3E01A 1W2BM 1ZUQA 3PJSK 2DFFA 4BRLA 4CEEA 2Q8VA 3L3UA 4RCHA 1CXZB 3E8BA 2EBOA 3HK2A 3OMAB 3W7XA 4AQYB 1OV9A 3ID6A 2OZSA 4FZYA 2GBZA 2M7WA 1Z5VA 4AHTA 1M90W 3E8GA 1VQPN 1D5NA 2MK3A 4JI7K 2X0LA 1NBWA 3ASOB 4CF9A 3V9ZA 3MN7A 2XOKG 5L3GA 3CC2N 1SQQH 3CCSV 3VR8A 3CQYA 3TI0A 4K41A 2CAZC 4E89A 2GUIA 4NXNK 1HNXK 3H1HH 4W5NA 2ASPA 4JI3K 2P6JA 1K5MD 4BDPA 1R73A 5TISZ 4QJFB 3JD74 1YEWA 4LH5A 1U48A 1XMOO 4WFGA 1C0MA 3SLCA 1KRPA 5LOVB 1IBMB 2ITMA 4FVUA 2FBXA 1B3QA 3DLRA 3U9DA 2DYSB 4FWLA 1AR94 4NYKA 5JH7A 3E22B 1NVPD 2BTOA 2HWB4 4YSZA 1VEWA 2V1DA 3W7WA 3A0RA 4WFBV 3V9SA 2Y4UA 2Q7EA 3BGRA 1D9DA 2IGIA 1BT8A 2KHOA 4KHSA 4PA9A 1QQNA 3OMIB 4DV7K 4LFAO 4BWMA 3VBBA 4GKKO 5K1PA 2ZKOA 4JKHA 4MS2A 3D2FB 3Q4HA 1NK5A 4DW0A 3L73H 5DM6V 4DR5B 5LHIA 3CXHF 1A5VA 3N4QA 4WQ4C 1WP8A 3CRMA 3VA0A 1NMNA 3F7VC 4KB0A 3B77A 2EIMC 1FXHA 4BC3A 1N8RW 3I55N 3TAPA 4CHNA 2Y48A 3KK1A 4BACA 1MWMA 1WBBA 1EM1A 1QCEA 1LW2A 1HKGA 2HG5C 2HOEA 1U97A 3KKRA 4DUYK 1T8EA 2HBKA 3RSEA 4CESA 4N56A 4Q4Y4 3LWMA 1K6YA 1Z2GA 3KKYA 2A40A 3AK1A 3QEVA 2Q7GA 1ATNA 1YVWA 3ULDA 5GAHP 3T1HK 3S3OA 1YIJN 2UUAK 5FPOA 3ZHUA 1SKRA 4JYAO 3ZMSA 4O4LB 4GLXA 3E8FA 3BZCA 3M1FA 1E1RG 5KAIZ 3C0BA 1A5XA 1KFDA 3O6WA 1B6QA 4P9PA 4LFBO 3D7EO 1RILA 2VG7A 2PYJA 2E2QA 3K0SA 2Z3YA 1MNGA 1VBA4 3N2KA 4NYNA 3OYDA 5J2NA 1VF5B 2P9PA 4O0IA 2UXDB 3IDHA 1HDJA 1MMMA 3MHHC 3SYOA 3G6EV 2XAJA 3M7MX 1V54C 5KHHA 5F2VO 2V51B 3AG3C 2QTOA 1POV0 1GN6A 2ZNJA 3NGYA 4BVPA 1C0TA 4CGGA 3RN4A 2XY6A 4LSNA 4Z4HA 2F7TA 1AJNA 5D5PA 1S72V 5EXWA 3CP1A 1DGKN 1T44A 4Q6GA 5JJEB 2QW9A 3CF5L 2ZE6A 1TAUA 2YEVA 1NGGA 1V4SA 3LDCA 4CGJA 4HZ3A 5B1BB 4NB5A 2RS54 2WDQA 3JSLA 4I9WA 4C7UA 4ID1A 5L3BA 3W7SA 4TQDA 4H5RA 4M45A 1K33A 1XL4A 4J7KA 1DT9A 4JV5B 4E1JA 3KLFA 3VR9A 2EIKB 2X6BA 5CA3A 2ATKC 4WE1A 2OIGA 1VRH4 3NVKA 2GX9A 3WNFA 4Y0WA 5AQLA 5A2QO 1P84F 2JWLA 4MSWC 4ZI7B 4DWIA 3GOIA 4EFHA 4MW3A 3OYIA 4CZZA 2BOBC 2DYRB 3FZMA 4BDZA 4GV6A 1VBB4 4F4KA 1FW6A 3M99B 4FW2A 3JCUZ 2ZXWC 1DF5A 1SZ2A 3LP0A 1K8AO 2DWDC 1NJIW 2X74A 4FSVA 5KTQA 2OANA 4HTLA 4B3MO 4WQ5A 4CHZA 1Z7S4 2ADPA 2B5UA 4C8NA 3JALB 4PQUA 4DHYA 3FB7C 1K8KB 1YXQA 1RUJ4 3CMAN 2FSJA 1ENVA 4RW9A 4DR1K 2FBYA 2GTDA 2WC9A 3ZMUA 4WCEL 4DR4B 4CD1A 3ZEUA 3AE4A 4TUYB 5C2DA 4I50A 2Q7HA 2VWBA 4IOAL 1VQLV 2ZQMA 2E74B 4DV6K 2UUCK 3J7AP 3IAYA 1P4RA 3P32A 2P90A 1D4XA 3SBTA 2HHTA 3FZKA 3AEIA 4WFAL 4FYDA 4JI8B 4QS7A 2UXBK 3QO5A 4U3JA 5M1NA 4FPAA 3WUHA 1OCOC 2F23A 3RYHB 1JOYA 5F2RA 4F3OA 3RVYA 1W9HA 3SI6A 5IYBO 3VOVA 3AVJA 2UXNA 1PKXA 1G99A 1H2NA 4JKGB 4DTXA 1I94B 1S1UA 1WSGA 2QM8A 2G8IA 5LYJB 4B9QA 3MXMA 5AQYA 4G2KA 2UUBK 2UXCB 3OY9A 4KRFA 4KHPO 1IBLK 2HBMA 4O4IB 3HP6A 5LJWA 3CC4N 5L3DA 4W5OA 5A9GA 2LO1A 3C94A 1H1VA 4JI6O 4Q0BA 2VG6A 4FJNA 3AA2A 1VQKN 1JXEA 4X1IA 3J7ZO 1BQZA 3TTFA 3WB2A 2EX3A 3CYOA 3ZEDA 3MDQA 3THYB 3ZCCA 3ZT3A 4CK1A 4B8CA 2QM7A 1OH6A 3H1KH 1XNRK 3KLEA 3MECA 4N76A 1S3JA 1YJ9V 2W0XA 5AQIA 5BPLA 2ILMA 2WWWA 3JAMN 1W97L 2CGLA 3K59A 5CY4A 3SYZA 3K5LA 3L70H 4OGCA 1JCEA 3BY5A 1GLLO 2ZJPL 1TYQB 2F8SA 4DUZO 1NLVA 2GDSA 5B3SC 1ZSPA 4DV3O 2BCCH 1ZBHA 3LAKA 2B76A 2CUGA 4PD4F 3SPGA 1LNQA 3P4SA 4RAIA 1K4DC 3A0IX 4KFBA 4L8JA 3QO7A 1XQ8A 3GB7C 3TJTA 2J4RA 5EX5A 4L8RB 4MVRA 3OYMA 2P9NA 2A5XA 3A5LC 3O5BA 3AARA 3HO1A 4AQYK 1QE1A 3C3SA 3H9VA 1YHQV 1IURA 4CHOA 3SQ0A 1K97A 3OTOB 3QF7A 1FK9A 1IG8A 4FLYA 4DQRA 1QSYA 4FWOA 1RHI4 2LW7A 3IJ4A 5LOVA 3HBTA 2PLV4 4YXDA 4N5SA 1KAZA 1Q18A 4ZBMA 3NDKA 3ZHQA 2P5OA 3E22A 1J6ZA 1K92A 4ICGA 3BUZB 2WS3A 4AHUA 4KO0A 4MVQA 4AILC 3BF1A 3BA8A 2IAJA 3CI5A 1SETA 5LMUB 1E3MA 3KLGA 1BGXT 3E83A 4B1WB 3ABTA 3CJ7A 5AQKA 4CJUA 2NLXA 1S77D 3D2FA 4CH4A 3SUCA 1N33B 2X6NA 2B4JA 1GLDG 1OOPD 1IZ3A 4PDRA 5FPNA 3R65A 3IS9A 2N74A 2ZD9A 3G25A 2HHQA 4DV1B 1RM1C 2RHKA 2UYTA 1WAFA 1NTMH 3DRSA 3DLKA 4XH1A 1D9FA 4DR5K 2ZE7A 4PDLA 3AG4B 4JKAA 4WF9L 1FFXB 3GWOA 2VQFB 1UWBA 4JYBA 1WSIA 2QWMA 3THWB 1VBC4 2RM24 3MCAB 4O4LA 5J9PC 3O4QA 3QESA 3JD4A 4ILHA 3TTDA 4R79A 5BXZA 3VQWA 3KWIA 3CCQV 1FYJA 4JN4A 5E41A 5HRSA 4DR3K 3UIQA 4B9TA 2WONA 4X65K 5IWAO 2HVJC 4ZHQB 2V7QG 4I9LA 3AO1A 5KGXA 4QS8A 3ABMC 1Y64A 4CEZA 1VMGA 5M1PA 2OPSA 1ZC6A 3RR8A 4AHRA 1EETA 1D5AA 1SZTA 4AM6A 2V4DA 1CEZA 1QS4A 2RDCA 4HTUA 1L3SA 3HP9A 3K9AA 1XHXA 3O4NA 2M6YA 3WFVA 2CH6A 4FWSA 4FJIA 4ZKIA 2O8EB 5L3EA 3ABKB 4X8AA 3OYJA 1UOCA 4LH6A 4LFCB 2UUCO 1K7DA 1XMQB 3HOSA 4CGDA 2VQEO 3WNEA 4BR0A 4I0XB 1FJGK 3O3HA 4HVJA 3L2VA 1M1KO 1N5YA 3LDPA 4IFYA 3L9DA 2ZGYA 1WA8A 2X6CA 4UQGA 5B1AB 5IDJA 5DM6L 3BPZA 4HWIA 3L4QA 4Q4X4 2LSNA 2E2OA 4B3SB 1UAXA 2NRZA 3ZX2A 3QG5A 3AA3A 2IOCA 1PO14 3CS5A 3AG1C 4BC5A 4XH4A 2W42A 4YJ3B 2DYRC 3WNHA 1NI8A 1HKCA 3MN6A 3ZRVA 4B1ZA 4CERA 1N6QA 3ZX3A 2DQ0A 1K8KA 1K34A 2YHBA 2OCCC 4A5AA 1QQMA 5D5QA 3CD6N 4TUYA 2ZT9B 1NCQD 1E4FT 1NK9A 1G8MA 1DLBA 2AW9A 2WLJA 3CJ1A 2O8BB 2RMU4 3RYIB 2Z1JA 4NCAA 4DTJA 3LDOA 3VTHA 4JI2K 3VETA 4V19S 2JLEA 1YSCA 3T2MA 4I7ZB 1QVFM 1SV5A 2EWSA 3JATB 1TAEA 3L74H 1RBTA 1R084 2D0BA 2QKCA 3RYHA 4B3RO 5C3JA 3HKDB 3C3TA 4ASUG 1QZ5A 3F2KA 1U96A 3NFAA 2FBVA 1AILA 4K0KO 4JKGA 4X9QA 1K5QA 5LYJA 3R3LA 4NKGB 1TUBB 1X4TA 1PM9A 2YV0X 1EXQA 2NRTA 2ARHA 4NXMB 3QIPA 4JI8K 2LGQA 3E9PA 2Q68A 4O4IA 2CGKA 3ZHSA 2QWOB 4J11A 1HQEA 4IFEA 3ZS8C 1JLQA 3HVTA 5BN8A 3VQ6A 3ASNB 3K03A 4AQYO 3L3VA 1I94K 3VEXA 4O5FA 3WNGA 2GBOA 3W0LA 4HNAB 1JLFA 3QO9A 1C0FA 1QU7A 3B40A 1YITV 1KFSA 1JA8A 1GLAG 3THYA 1NJZA 4DSEA 3ZHVA 1EKEA 3ETQA 4FW1A 4FJXA 2PUSA 4GCZA 2Q31A 3WB1A 2ZR3A 3RR7A 1OCRB 4XBFA 1AL24 2PTMA 4LF7B 4M63C 1IBMO 1LWEA 1CZAN 4LY7A 1TYQA 4WFNL 1KF6A 2Y0PA 1BMFG 3CFRA 1RSOB 1U4BA 1F4NA 3CCUV 1QVGU 5J2UB 2UXXA 3D8CA 1TGOA 1VF6C 5JJNB 4H0VB 3SJHA 2WLKA 3NGIA 1RTDA 2W40A 2YIBA 4RQFA 3QBWA 3NGZA 3ZSXA 1BIUA 3TGUH 3S3WA 4IG0A 1QHAA 4NXNB 1HNXB 4BRNA 2Y4TA 4HYOA 4JI3B 4FJLA 1OH8A 1YI2N 1AP5A 1EAH4 3CXCM 4CH3A 3O80A 4QS9A 1M90O 1FAFA 3U8XA 1NOYA 2RNBA 3ZHRA 5CMUA 2F1MA 4JAVA 5EZYA 2WDRA 1JVMA 4X1KB 3WXIA 1DK1A 1VK0A 2QWNB 4X62B 1RDWX 3ZSOA 2QE7G 4XDKA 3B4SA 1R3JC 5AQHA 4LWSB 2A79B 2E5LB 1X9JA 2A06H 2MW2B 1PNMA 1JLEA 2ZQBA 2HFEC 2P4VA 3OD4A 3ENOA 4B9NA 2WUSA 5EC1C 2YIAA 2FSNA 4CJKA 1QVGM 1BL3A 1VP7A 3V4IA 4AHSA 1N0JA 1NJYA 2FBTA 1C0UA 2HHHB 1N32O 4DUYB 2UXDO 4OPJA 2NNWA 4MTOA 4DV4B 2EIMB 3DLGA 4FJJA 3VQEA 2CH5A 5BR8K 3T1HB 2HP8A 4O4GA 4FL9A 3WXKA 3DWLA 4TQFA 3OMNB 2QGNA 1SKSA 3KD1E 2ACZA 2XAQA 2HMIA 4PKGA 5FL7G 3NF6A 5JVGL 4IJAA 1YTFB 5LP6C 4CZIA 3L8BA 1FFXA 3THWA 5DN6G 3CCLV 4D7TA 1O9GA 1Y67A 1N8RO 4EB6B 2UU9O 3AG4C 4M3XA 4IDHA 4Z4FA 4JYCA 3OYGA 1R6TA 3D2EB 4O2AB 2V52B 1PVC4 3CCVN 3GE1A 4WCEV 1V55B 4EFEA 1YJNV 4ZHQA 3NE6A 4DV5K 3MX2A 2C2AA 1GM9A 4JV5O 4TSXA 4YIPA 2WPDG 4BRFA 4B3MK 3S3NA 1V54B 2NR5A 3D3IA 5JCOC 4H0XB 4LF8B 4QE7A 4WFAV 1VQ6V 3LZIA 2EJRA 3TR8A 3AG3B 2F95B 4ZTFA 4FJ8A 2O8EA 3PN1A 3OYCA 4B9LA 3I5DA 2EULA 3JYCA 4A62A 3SNNA 2H89A 4IYHA 3C6TA 4QNHB 1GM7A 4CI6A 3AEFA 4I0XA 4ELVA 3CC7N 3V9XA 2EIJC 1HRI4 5EIBD 3UCSC 2KTQA 1CP9A 2E76B 2JEUA 4DRXB 4O44A 2P5GA 4DR4O 3STZC 3CSXA 1QQCA 2QXFA 4DK1A 4CBXA 4KFMA 1VQ7V 3M8PA 4JHDA 3FYIB 4UFZA 1ZBIA 2Z5UA 1JLAA 1XMQK 4GMJB 4XIUA 2YKNA 2PYLA 5IT9N 3Q7BA 4F8RA 4N41A 5LGNA 3AK2A 3PY8A 2IH1C 4IL6Z 4KX6A 2HEPA 2F9WA 5AZIB 4CZLA 5B1AC 4IFVA 1KLNA 1IX9A 3ALYA 3G4SN 2R7FA 5AR0A 1Q7YW 4YJ3A 2HBLA 3GQHA 3KHYA 2ZXWB 1SF9A 4FWKA 4JK8A 4QIWF 2L35A 3LSQA 1BA0A 3U11A 1IH7A 1HP8A 5DEDA 2PZSA 3DLLL 2KZZA 2Y69C 3BY6A 5GW7A 1KD1W 4GVEA 1L3TA 4B3SK 1ZX3A 4AF1A 1J5EO 2UXCO 3C6UA 3THVA 1CLQA 4DV6B 1MA1A 3DRPA 5BMVA 3OE7G 2BSKA 1EN5A 2VCPA 1PPJH 2O8BA 3RYIA 3P4IA 2NRRA 1UA0A 1W59A 2O8CB 4CJQA 1NJIO 4C8OA 1Y4MA 2UXBB 1HNZO 4PDVA 5FLXO 3LALA 2R72A 4CFCA 1MWKA 2YKMA 4KAZA 3JATA 2HSTA 3BA9A 5H6QA 3D0PA 3T3FA 1GO3F 4YDUA 4CFAA 1XQSC 2JRIA 3ZJZA 1RDAA 1G15A 3QBXA 4JKBA 2EZPA 3IGAC 3VQXA 1KAYA 1OCOB 3O9UA 4GKJB 3WEEA 2UUBB 3VQCA 1TUBA 5KHJA 3HM8A 1W2BU 3VESA 2ZE8A 3BRCA 4TSFG 1QLNA 2QWOA 4JK7A 3OW2M 3VF6A 3RT3C 1N34B 2RPIA 3QIOA 2EZOA 3H1QA 4N23A 2LW1A 1IKXA 1AR84 1X3MA 3IFXA 2A9HA 4HNAA 3SUQA 1B92A 4BRQA 1BHBA 4BWAA 4GX2A 5JQGB 3ZRWB 1S9GA 3U3GA 3KLIA 3KG2A 4B1XB 4CEFA 2HF4A 4JAAA 2A1SA 1ORQC 3KVGA 3MN5A 2F4VK 1X1PA 4RUFA 2IH3C 3BHPA 1OVQA 1RDUA 4Q4V4 5EC2C 2FC0A 2DOSA 2Q4PA 2QM1A 3I56V 2XAGA 4FJHA 4EZ9A 4KTQA 1HMVA 3QTCA 3OTOO 4MVOA 2ZDIA 2JS5A 2ASMA 5F0XA 1NM1A 1I5YA 2OPRA 5EBMC 2HF3A 1RMU4 1VF7A 2PFUA 1TVRA 2AA4A 1RSOA 5JS2A 4EP4A 4R8CA 4KB1A 4OJRA 1VQ9V 5IE9A 1VSDA 1R59O 1B06A 3AA4A 5J2UA 4DFKA 2LJ2A 4UUJC 4WF9V 2HW3A 4C1NI 2KFZA 2V7YA 2DW4A 4P9OA 3AVMA 3TABA 4FJGA 3EZ5A 5LMUO 1Y76B 1BZKA 3L2UA 4LF7K 5B5EZ 3CG7A 4M41A 3VQ7A 1VQKV 4LF6B 2CGOA 1N33O 3A0BZ 3OEEG 3TTCA 3JXUA 3KIOA 4ELUA 2WAMA 2Z0AA 1WPBA 1PNLA 3BAAA 1VBE4 2OTLV 1YF5L 1TL3A 1TKZA 4DV1O 4HUGA 4X1KA 5AQNA 3SPYA 1AR4A 1FXKC 2AGAA 2QWNA 2BANA 4GX5A 3TSPA 4JZ2A 1SQGA 4L87A 1BU6O 3HVRA 1B9FA 1HR0K 1RT1A 2EJ7A 4LWSA 2GSMB 3CE2A 2VQFO 2VG5A 1DTQA 3CCRV 5FPMA 1EBOA 1S5HC 3LDQA 4UCVA 3SJCC 1UFIA 1RT4A 1LUVA 1TL1A 5AQQA 1VQ4V 1WSJA 3P3PA 4FWNA 3NXSA 5K14A 4X62K 3PX0A 4LF9K 2E20A 1HNWK 4HCCA 4B9UA 3ZRXA 2QWQB 4WQ4A 2K1EA 1BCMA 2G8WA 2HWC4 2WP9A 2E5LK 1U2VB 2EILB 3HKEB 1V4TA 1Q5OA 1R1BA 2ZR2A 3C7NB 3ZETB 4UB8Z 3KK2A 1FXXA 3O9SA 3SQ1A 3JYTA 3CCMV 1GMGA 3DMJA 3BABA 4LF5B 1OVYA 1RM1B 4KP4A 4BRGA 2QWRA 3DI6A 5BN9A 2QEXV 5AFUH 3QDKA 3AVGA 4W5RA 4QGPA 3AVNA 2HHHK 4FWQA 3SUOA 4BIOA 1LUWA 5L3CA 4OO1J 4DV4K 4DR3B 3ZT4A 4EB6A 4DU4A 4X65B 4LFCO 3CYMA 3J80O 3D2EA 4LD0A 4O2AA 1TA8A 1H8TD 3T4DA 4KH6A 4WFFA 3QNNA 5CHIA 1HW7A 1TUUA 1O9HA 3DTUB 4IT5A 5M1OA 1K9MW 4NB4A 4FZ0A 3DSQA 5EK0A 4F6RB 3IG1A 1UPGA 5TKYA 4DS4A 1V55C 3ABMB 3K9SA 1VQNV 3JCZA 1BQ0A 2HJDA 2XTAA 4DR6O 3DM2A 3VERA 2ZM6K 3EVKA 3EY1A 1SZXA 3LZJA 1LCUA 5FPEA 2W6JG 3OUFA 5LA6B 2D1KA 3G6BA 2A3ZA 2P9SB 1GLFO 5ITZB 3ULEB 4CJRA 2RS14 5E26A 1SQBH 1N0NA 2YI1A 5KQDA 1EZJA 1Q81W 4KHQA 4CJWA 3CJHA 1VQOV 4OGEA 5HROA 4LF8K 2EINC 1FJGB 2OCHA 4JI0O 1MA9B 3VEVA 1THZA 1XI1A 2Q0OC 4DRXA 1BHAA 1VSKA 4TT3G 2E1ZA 2B6AA 4CJPA 3AV9A 1ZBSA 5C42A 4JNEA 1KVCA 3LDSA 5K1XA 1NS1A 3WQTA 3HSCA 2Z1HA 3MEEA 1N36B 3E86A 5AQVA 4BRDA 5BREA 4DV2B 5AZIA 3LM2A 1IBKK 4CJ5A 4OKKA 4X64B 1VQMN 5FDLA 2DY4A 3MEGA 2A3QA 2W6KA 3ZN0A 3P83D 1BWFO 2IC3A 1EN6A 3VQPA 3JD1A 3NF9A 3UKRB 1AI7A 3AG1B 4D7SA 3SYAA 2YJEA 4FJKA 2O57A 4CW7B 4JYYA 1ZBUA 3D3QA 2R9RB 4F2RA 3AE3A 4JTDB 3EZWA 4CD3A 3VQ8A 4NXMO 4E1NA 3N2GB 3H6EA 2OCCB 1FFTB 4JD2B 1KKCA 4B1VA 4DFMA 5AQFA 1BI4A 1KFYA 2ZINA 5KLVH 3W7TA 4JI2B 2O8CA 2WLMA 2DTUA 1EN4A 3S3MA 4K35A 2Q0RA 5CYMA 2P4KA 4JASA 1TKTA 4NLCA 2DJVA 2R9IA 5JLHA 4E2LA 3HXMA 2GTAA 2ADQB 3K2PA 3DXMB 4YFUA 4YSXA 1M57C 1C1AA 3K04A 4JLHA 3THXB 4U67L 1J95A 2JJ2G 3ZMVA 3LP3A 3SPIA 4A5BA 1JL2A 1K73O 4ISFA 3CCEV 2QDOA 1MG1A 4GZRB 3OBYA 5BRFA 2KFNA 2GV9A 4FXDA 5C8YB 3AE5A 2HHVA 4J42A 3T1CA 3I33A 1SKWA 3X2QC 1GLJO 5CYQA 4GKJK 4W4KA 4Z1VA 4JI7O 3TCUA 2DFHA 5DM7L 3P38A 1KYOF 3R9PA 5GIPA 2Q67A 1NG9A 3RVCA 1RBUA 4BRHA 2XASA 3RVZA 3EXAA 4E1MA 5GTIZ 5JQGA 3ZRWA 5IYZB 1XNQB 4CJ7A 3WQUA 2GUPA 3ASMA 3IC9A 3MMVA 4BRIA 3ZSWA 4NXNO 1HNXO 1BE3H 4O4JB 3CRQA 3ICXA 2ODMA 4JI3O 4ILJA 1N34K 1L5UA 1JJ2U 2F93B 2QKKA 4DTRA 3ZT0A 4GX0A 3QVNA 4BR9A 4UCOA 4CF1A 4GV3A 3SPJA 4CS4A 3U9ZA 1SQPH 1RBVA 3MXIA 3NH0A 2ZIOA 4JI1B 3J81N 3JAWA 3EEQA 1JFFB 4X66B 2I5JA 2RKIA 5B8HA 1I3AA 3PLAA 2XNDG 4Z4GA 5TKWA 5L3FA 3OVNA 1MQTD 4DV7O 3HSTB 2YC0A 1HPMA 1Y76A 1YAGA 1T7PA 1U49A 5CA1B 4BRCA 3KZIZ 1SQKA 3AVAA 3L6QA 4OGQB 3CMEV 1K3EA 5CN0A 5LHGA 1S1VA 1ZBLA 1VBD4 3PO5A 4YY3K 4U7BA 1Z6RA 2A6AA 2E6MA 3OT7A 3CCSN 3MEDA 1C0GA 4DUYO 1NGBA 5JJJB 1NTKH 4E4EA 4DV4O 3A8YA 3SQ4A 2QR4A 4IHJB 3QFPA 3PX4A 4LF6K 3T1HO 1H2SB 4B3TB 2UUAO 1HYZA 3FLCO 2FSKA 1QSSA 3JD3A 3UKMA 1RBSA 4BR2A 1JJ2M 1RUG4 2RS34 5KRSA 4EHTA 1JX9A 3OYFA 1CPYA 2Q2RA 2ZJRL 4E7HA 4W5QA 4CZKA 4J7ZA 1SKVA 1NVPB 1Y97A 1S5JA 5C0YA 4KHUA 4CF0A 1EX4A 1VSHA 1SQXH 5LBQA 1GOBA 4PL8A 3VPZA 2Y0IA 1T5EA 3THOA 1ITGA 5M1FA 3F73A 3AVIA 3IFRA 3MX5A 1U2VA 3HKEA 1I08A 5BR8B 2HVKC 2IVNA 3C7NA 5C25A 1US6A 5JVDB 3TARA 3QEWA 4HAMA 3LP1A 1AJQA 1GM8A 2EILC 1VSEA 3NAEA 5LMNK 4IXCA 1XILA 4PELA 4B9VA 3AO2A 1MU2A 1ASUA 1YXBA 3ABLC 3TK1A 4CJ3A 3VA3A 3JBG4 3D45A 4IO9L 4FCYA 5LP6B 5CBFA 4W5TA 3AE9A 5FPRA 3RMAA 1NGEA 1Q6HA 4AHCA 1IKWA 3FE1A 4DV5B 2KKZA 3V81A 4LF5K 2ETJA 3RMCA 5IY5C 2HMPA 1XREA 2QA4V 3KZBA 4LF4B 1VAZA 3CFOA 3H1LH 4A2AA 4ELTA 1NMDA 3MDSA 4H4MA 4C8MA 3EL2A 2XO7A 3ZX0A 1XDCA 1E4GT 2WU5A 2QTSA 3KCXA 3BZKA 1IJJA 1YVNA 4XEIA 4PHZA 3BCCH 5LA6A 4H37A 4Y1DA 4MDBA 2FB5A 2YNHA 3G6EN 1NKEA 1NEKA 2P9SA 5ITZA 3ULEA 3P4PA 1VSLA 4DV0K 1XMOB 4Q4W4 1LR1A 3G71V 3KTQA 4FPBA 1YQ4A 5AFUA 4KI6A 5AQGA 4AM7A 2KSDA 3GL1A 1S1XA 1S72N 2HHXA 4DR1O 3DYAA 3FGUA 5DK5A 3NBPA 4PA1A 1U6ZA 1W0JG 2EIJB 3CCVV 4JEPA 4DV6O 1HRHA 3VN5A 4MW8A 3FB6C 4LFAB 3SK3A 4BW9A 4GKKB 3TAEA 4CE9A 4R5PA 3CRRA 5EIBC 4Q5VA 1QVFU 1YF2A 3DC5A 1A5WA 2UXBO 3APQA 4CS3A 4CHQA 1TVKB 2OTJV 1XUPO 2OZMA 3L2WA 4IYIA 4JI4K 1QR8A 1BG3A 4ZI7A 3UKRA 2VGMA 3BF3A 2XAHA 1WPXA 2AZ0A 5T7BA 4EHUA 3SUNA 2UUBO 4OVLA 3ITHA 3MK6A 1NBMG 3AGRA 4ILGB 4O55A 4K8XA 1N36K 1IBLO 3KD5E 4R7CA 3B8AX 2Y69B 2YSUB 2D3OW 4DV2K 4YIOA 3O4WA 3N2GA 4CZMA 4JYAB 4NTWA 1LAVA 1HJRA 3FAVB 3L4IA 4X64K 4JKFA 4JD2A 2R7YA 3OYNA 3AAQA 2ZJQL 3AVCA 2GUZB 3JALA 4O5BA 1Q7YO 3CCJV 5LJVA 2XUMA 1NKDA 3HKBB 3NVMA 4GW6A 3SYQA 4LFBB 1WAJA 4KBOA 3FI7A 3VMFB 2DN9A 4CZGA 4LP8A 2N05A 3D36C 4B7EA 4Y1CA 3E1YA 2WA4A 2ZIMA 1KD1O 1VQLN 4ZTJA 1SQFA 2FF3B 4UB6Z 3AVLA 1K73W 3DXMA 2Q9LA 5EYPB 1XNRO 4AH9A 2HNDA 4M3UA 1SL2A 3THXA 4XDJA 2KQXA 3JSMA 3HRGA 3LDDA 2Y1JA 1L1FA 5LGTA 4X1YB 2P06A 1S22A 1OCCC 3AE7A 4M7XA 1DTTA 4CC5A 2CDYA 1YJWV 1EQYA 5C8YA 4M7YA 4CZJA 3JAMO 2KZMA 4BG9A 4Z0UA 1TK5A 2H8PC 4IBNA 2R074 1KCFA 4H0OA 5FPDA 5IYZA 2B1IA 4QPKA 4B9MA 2W6IG 3KLHA 2QJ1A 5GONB 2F4VB 4G1QA 4H5NA 2P9IB 3TANA 1X9WA 1YZBA 3WB0A 1TAQA 2E4LA 4O4JA 1HWYA 2Q3SA 4DR2K 1XC9A 4JI5K 2RJZA 3CXCU 4TOIA 1XWLA 2E88A 5HRRA 3PIOL 3SUPA 4M3YA 1FD9A 4B7KA 3TAMA 5KPRA 3H3NO 3F7YC 5J2QA 2D2CB 1SESA 5JWPA 1PNKA 4GX1A 1XNQK 4DSFA 5ADXA 1XHZA 3SGIA 1JFFA 3G10A 1JCGA 3CIPA 3R8EA 4ZHRA 3OR6C 4B3MB 3H3OB 3V1QA 3RTVA 5JLFA 1DLOA 3AG2C 1H8EG 5KQ8A 5HOOA 4DTOA 5EY4A 4G9ZA 1VF6A 4JK9A 3DGEA 5CA1A 5HBMA 4YHHK 3L0QA 4FM2A 4JI1K 3ZN1A 3RYCB 4X66K 4IIJB 4UCUA 4OX9K 3OAAG 2BE3A 2KG7B 2A41A 5AQOA 4FOEA 3CJBA 1NK6A 4F6EA 5C12A 5HFLA 2OT5A 2HNYA 2WLNA 3CETA 3O08A 3RGBA 4E7KA 4C8KA 2HVHA 2JVDA 3FB8C 1JKHA 1KVAA 4DR5O 5KUKA 4IHJA 4WBNB 1FKOA 4FLTA 1HR0B 1YHQN 4M3TA 1BSMA 2NLJC 5HRNA 1VQ8V 2H3GX 4DU1A 4U3FH 1FXKB 3IKMA 4O4HB 2YHXA 4DQQA 1RUD4 3AO3A 4UVAA 4CGIA 2FYUH 4KHPB 1HNIA 4DR3O 1HNWB 1ASVA 4LF9B 1C1BA 3VQBA 4NTYA 4X65O 4R50A 2OA8A 4I7FA 4B3TK 2O8FB 4IWVA 3E9LA 3O3FA 4ZIBA 1RT6A 3PSFA 3RRHA 1SQVH 5KGWA 4CS2A 2AXTZ 1VQPV 1YTUA 3JARB 1GLCG 2ZGZA 3B2EE 5JVDA 2NRWA 1GKFA 3VTIA 2JEXA 4BRMA 3CC2V 4LH7A 5EBWC 1Z05A 2RF2A 4LH4A 4CBUA 5HL7L 2G8HA 2CTWA 1OCZC 1TKXA 3C65A 3U3YA 1AR1B 3AO4A 3P4QA 3R6MA 4PI2A 1JPXA 4PKHA 4MTXA 5E84A 4BY9C 3BP8A 2X6SA 5C2TA 4FPPA 2YXLA 3P3NA 4PA4A 1ZLZA 1C1CA 5LP6A 3V1RA 4BGAA 4FJ5A 2X7RB 3SYPA 1URFA 3A8TA 4EAHD 1NNEA 1VSIA 4PUOA 2HB5A 4RO2A 3CX5F 3UT5B 3SAFA 3T1YB 2B5JA 1RBRA 3LP2A 4LBEC 1NWKA 5MLCQ 3AEBA 1FJGO 4BG8A 3KKSA 2P7TC 1WBDA 2LP7A 3MD0A 5LL6Z 3V9UA 1D2DA 2RMKB 2Z1IA 3HZ6A 3K58A 4HUEA 4HBNA 3AVBA 4A61A 4BE0A 4DR7K 2ZM6B 3CCQN 4CEQA 2E6LA 1RUI4 5GAEP 5KRTA 3K5NA 1YTAA 4DU3A 3QETA 5JCOA 1RUE4 2D0CA 1N36O 3RWUA 2IS3A 3ZHTA 4CFBA 4UV9A 3VQAA 3L71H 3K5OA 3MWPA 1BCOA 2IVOA 5AQTA 4LF4K 4RHV4 3B6OA 1K9MO 3I55V 3ZLJA 1PL4A 1SA0B 5CE3A 3CM5A 4RW4A 4DF4A 1XL6A 2IU3A 2NN4A 3FR0A 2WQYA 1NK7A 1NKCA 3R1XA 2A7WA 4MFBA 2G8UA 4O8KA 5CR4A 4KTWA 1U04A 3CEIA 2P9KB 2PF4E 4YOUA 2KQ2A 2EINB 3ZRSA 4CJFA 3ZMZA 1W7AA 1YIJV 5FNVB 2JWKA 3VEWA 3G67A 4NTXA 1XMOK 1ESVA 2L6LA 4DFJA 4H44B 2DWEC 4NCBA 3AK3A 1IBKB 1ROPA 2OYQA 4JI2O 1BOTO 3DOLA 4C23A 4JGSA 1M5IA 2H94A 1VRUA 1Q81O 1T6DA 2Q0UA 1TVKA 2JS3A 3K08A 4OPAA 5AG2A 2XHBA 2Q1NA 2XY7A 1SERA 1WUAA 1LV5A 4J2AA 4PKIA 1TV6A 3JAKB 4CECA 4CGHA 3MHSC 4K8ZA 1J9AA 4Q20A 1PD3A 4N47A 4LFAK 2YX6A 3IRXA 4LSLA 4GKKK 5BR9A 3N4PA 1IKYA 3SFEA 1HYVA 4H03B 5AQMA 1NGCA 1RT2A 4JI8O 2HR3A 2AHYA 1S5LZ 3OM3B 1WOQA 1COWG 4J80A 3OYHA 3OW2U 3FAVA 1JLCA 5DMRA 1JXBA 2GUZA 5JVHL 1I94O 4CJSA 3HKBA 3UKUB 2YEVB 5BZBA 2RR14 1FPOA 3LL3A 4I6MB 5GINA 1VSMA 3LNNA 3H46O 1YVUA 1SS6A 1DTOA 2P1JA 4JYAK 1NGJA 2Y1IA 3CHXA 4MVSA 1XNQO 4MVUA 1NGDA 3EN9A 1AJPA 1L8DA 3A0HZ 5EYPA 1RNHA 3ZX6A 5AQJA 5JICA 4DSIA 4LFBK 1M57B 4ID5A 2LQTA 4X1YA 4PA3A 1O1WA 4KKOA 1OH5A 1D8YA 4E0DA 2PBDA 3HKDA 3M8QA 1JR9A 3PIPL 1PIV4 3CIRA 1GN3A 2QWPB 2D5RA 4BAYA 3FFKB 1KC8W 4PA6A 4X66O 2O8DB 3OYEA 3JASB 3X2QB 5C2FA 1GN4A 3UB5A 3FX7A 4B08A 5KMGB 4LR3A 1AB3A 4DKWA 4FOIA 2YXHA 3CMAV 2Q0AA 3H1IH 4UCTA 1C6VA 1WN7A 2Q36A 5GONA 2P9IA 2KW4A 5KUMA 1J53A 1QLEC 5KA5A 4GNIA 3GWKC 4WFEA 1M93A 4I50B 4J8FA 4J2BA 4KL1A 4IEIA 4LC9B 3T7ZA 2DE0X 4FZZA 3CRCA 3CPWU 1JLGA 4CHYA 4QAGA 4CJ4A 3OTFA 3UQ8A 1O13A 4NYFA 1YITN 4FJMA 5A2QN 4BR6A 2AZ2A 3EE8A 4J9YB 3F5WC 3MXJA 3TSUA 3RYFB 2FMLA 1HUXA 1MDUB 2IU0A 4IO8A 4E7LA 4BE1A 1VSJA 1LWFA 2OWOA 3VQ5A 4CJTA 2G8KA 1GLBG 1RTJA 2F66C 2GWKA 5GIOA 4CIFA 1KUQA 3H45C 3ZCMA 4I55B 4KI4A 5KX5B 3CCUN 1B9DA 4DXWA 3RYCA 4YY3B 1W0KG 4IIJA 3CC4V 1PL0A 3HB3B 5EBLC 2KG7A 1GLEG 5JMVA 3ENHA 2JGDB 4PJ0Z 5J2MA 1REVA 1X3NA 2IJKA 5BRDA 1HKBA 1OZ0A 2Q69A 4FIPC 2QSAA 2PY5A 5BR8O 2PW9A 4YT0A 5AQUA 2ZNIA 3CQ8A 4WBNA 4B3RB 1ZTEA 2KKWA 2WLLB 2F9TA 3KK3A 1P90A 3I8BA 3ZSYA 3HPOA 1FXKA 3NCIA 4O4HA 3O1BA 3CPWM 4GB34 4DSJA 3PO4A 4CH5A 2RE2A 2R044 3L2QA 1VRTA 3EYZA 3NF8A 4FFBB 2BUPA 3VENA 4PI0A 4MLEA 4QOZB 2O8FA 4DV5O 3K3WA 3OR7C 1N4CA 5FRNA 4RUEA 3SCXA 1RTIA 2V7ZA 2BTQB 1CZBA 4LF4O 3JARA 3P4RA 5HRPA 3OYBA 1EWQA 2YIBD 4KHPK 1RTHA 1RFYA 2Q6AA 3CM6A 5LMNB 1NH2D 4UY8O 4FM0A 1ASWA 2Z1GA 4YSYA 4DMNA 4H5VA 3SZ2A 2P9NB 3DJCA 1IO2A 3I0RA 1L3UA 4B3OA 1F51A 3JD0A 1Q43A 3SJQC 3LSUA 3P31A 4JKCA 3T1AA 3C6AA 4BR7A 3M8RA 3HJFA 4X89A 1R3KC 4DO2A 4JI6K 4CJVA 3TAGA 4KH5A 1Q9XA 3BDPA 1D4M4 1NA1D 4DLEA 3ABLB 5EU7A 3GVMA 1H2GA 1AR64 4A5UB 1KB9F 1P49A 1TUEB 2NRHA 1B04A 2E8AA 3UT5A 3QLHA 1GAXA 4PHTX 1SL0A 2P67A 1S1TA 3A5MC 4BROA 3CCLN 1JJOA 4OLBA 3KK7A 3NF7A 3IUCA 3SV3A 1Q86O 4CEBA 4O2BB 5IY5B 3ABVA 1RDDA 3A2FA 1JLBA 3HTVA 1S9EA 1XMQO 4CJEA 1EP4A 3OS0A 1KU9A 3QINA 2GEMA 1NR7A 1YJNN 5H1SQ 4B9SA 3JD2A 2XRIA 4DUZK 1JQ0A 1WB8A 2CTQA 3T1YK 3NHGA 4DV3K 4DV0B 5IT9O 3AE6A 2X5ID 1Q9YA 4KHNA 5B66Z 4YJ2B 4H33A 3E66A 1IXMA 3OS1A 2E1YA 4JKEA 1SA0A 4H0LB 2IDOA 4QE9A 3P1GA 3QEXA 1VQ6N 2QKBA 3R66A 1Q90D 4GT1A 5AQSA 4B3SO 3VQQA 3PX6A 3CHWA 2YHAA 5GTHZ 2P9KA 4Z4IA 3NH1A 5FNVA 3F5TA 4F3TA 1Q6IA 3Q7CA 3TXSA 1NGHA 1OKJA 5B1OA 3CJ9A 4BRPA 3CJCA 3M8AA 4EEQA 4BRAA 4H0PA 1TUYA 2HLDG 2CGNA 3H01A 3P39A 4IEEA 1E1QG 2VWKA 2ZE2A 3LPTA 4KHYA 4JI4B 4Z2WA 3AO5A 1Q8IA 4RWUA 3K57A 4KTZA 3JAKA 1N32B 2PAVA 2QM4A 3FFQA 1VQ7N 4FK0A 3VQ4A 4KHWA 3OBWA 3AA5X 2WDVA 4H4OA 4KPYA 4MQ3A 2G38A 3LDNA 3EKSA 4RW6A 1FKAO 1HXS4 4CF2A 3V1OA 3G80A 3QFUA 3HPLC 5IYCO 2VYPA 2IM9A 4YTNA 4BR4A 5AZJB 4J2DA 3AE1A 3U0ZA 1JCFA 4MO5A 3K06A 5HFMA 5C15A 4MLHA 5B1NA 2F8TA 4CEOA 4JRPA
chains in the Genus database with same CATH topology
2UU9B 3QERA 4X20B 1KVBA 3H08A 3C95A 1BHLA 4DQPA 2YI8A 3RRGA 4CIEA 5SZTA 4FZXC 1YT3A 1BISA 5HP1A 3LWLA 1GOAA 4DK0A 1T03A 4PWDA 4DTSA 3HKCB 4CEAA 3LPUA 3JASA 4H8KA 1SL1A 5KMGA 5IJ0B 4IKFA 5CB4B 4DR2B 2RQ6A 4I9QA 4JI5B 1W0HA 3RWRD 3K5MA 3VQDA 4E3SA 2P51A 3CFPA 1UA1A 4NCGA 3L2RA 1G6UA 3RMBA 4HHTA 2DFEA 3DOKA 4FJ9A 3RYFA 2R9AA 2XY8A 3AVHA 5IJ9B 4YHHB 5C24A 4ZOLB 1J5EB 4I55A 5KX5A 4CIGA 4OX9B 1DGSA 1HYSA 1R0AA 2R70A 1HNZB 5LXTB 2BGGA 1U47A 1Q3EA 4YNQA 4JS5A 5I42A 1Z26A 4UCSA 1NJXA 4FLWA 3F9KA 4FJ7A 5FRMA 2G8VA 1S6PA 4M42A 4FFBA 1RT7A 3OYKA 4FK4A 2HVIA 2BDPA 1I7FA 1Z25A 1BQMA 3OJUA 3HPHA 2BTQA 4ICLA 4NVPA 4BDYA 1ZYQA 3VQYA 4HCBA 4FLVA 5KHKA 4JRQA 4KREA 1RDCA 5J1EA 3HT3A 5EZYB 5J2PA 2XY5A 3HM9A 4DR7B 1CZ9A 4B8AB 4O2BA 2YI9A 4TV8B 3VQ9A 3DLHA 2E3CA 5KHIA 4JS4A 1RDBA 4TV9B 1F21A 4F6RA 2EHGA 1QTMA 4YJ2A 4CHPA 4DLGA 3DRRA 3SPZA 3OYLA 4QCLA 5SWMA 3U10A 4E7JA 4I2PA 3O3GA 2NUBA 4FK2A 1HNVA 3LAMA 2ZCEA 5J2TB 2O4GA 4CC6A 2RN2A 2QK9A 4E7IA 4DS5A 4RW7A 1S6QA 4UCRA 3LANA 3ZT2A 4M3WA 3I0SA 5JS1A 3HYFA 3FFIA 5KI6A 3TWHA 4RW8A 2YNFA 4X20A 1BQNA 1J54A 4DSLA 3DLBA 4GYCB 1NKBA 3SJAC 3KJVA 4Z4CA 4DG1A 3CB2A 4O0JA 4BE2A 2O4IA 2OPPA 4DR6B 3SJBC 2BE2A 1JL1A 4LNUB 4IDKA 1TK8A 4I4TB 3P5JA 5CZ2A 3SQ2A 4FLXA 3HKCA 1KMIZ 3QEPA 2YNIA 4JI0B 5IJ0A 5CB4A 4DFPA 5CZ1A 5HLFA 1CXUA 3V6DA 5BMVB 1J5OA 1WSFA 3TAFA 3SV4A 4CF8A 3AVKA 2ATQA 2YNGA 4Z4EA 2G8FA 4E19A 5IJ9A 1CXQA 4ZOLA 3MAQA 1ZBFA 1NJWA 2HHWA 4DTUA 3ZSVA 5LXTA 3SR2C 4BWJA 1HPZA 3V9WA 2JGUA 3DLEA 5CA0B 1X9SA 2AJQA 4J2EA 4JI7B 3SJJA 4CK2A 1M4UA 3PUFA 1BIZA 4CK3A 1NT2B 4JI6B 3VQVA 1KLMA 1SUQA 1TK0A 3HL8A 2WOMA 4OKEA 1QSLA 1U45A 4M3ZA 1FKPA 3ZT1A 4DV7B 3JSNA 2A1RA 4CJLA 4EFBA 4TV8A 1WSEA 5KHGA 1IG9A 4DUZB 3PV8A 2OPQA 5JH7B 3I8DA 4DV3B 2D0AA 1NK8A 4TV9A 4KV8A 1TKDA 5FROA 2HHSA 1ZAUA 3OJSA 4RG8A 3U6FA 2UUAB 1NK4A 4OKJA 4GVMA 5I3UA 4IG3A 1RCHA 4CEDA 4OLAA 1V9PA 4EZ6A 3OS2A 4FLZA 1S1WA 4DQIA 5J2TA 1Z5WA 1NOZA 1NK0A 4FLUA 2F96A 4DTNA 2ITGA 1LAWA 1LWCA 3ISNC 3N2KB 1HQUA 1VSFA 1KSPA 2ZD1A 4FVMA 4DTMA 1WSHA 3S9HA 2P22C 4DTPA 1L3VA 1KTQA 4AHVA 1LW0A 2HNZA 4CFDA 1JMKC 3RFRA 1WLJA 4OPKA 5IWAB 4DSKA 4LNUA 4I4TA 4DQSA 3ZSZA 1X9MA 4M3RA 4PY5A 4DR1B 2X78A 3AVFA 3NH2A 2UUCB 3B6PA 4DF8A 3QNOA 3ZSQA 4I2QA 4F2SA 1BI4B 2VQEB 3QEIA 2VWJA 3HPGA 3RMDA 4C8LA 3M8SA 3OYAA 2PGGA 3G0ZA 4CCHA 1WNSA 3T19A 1IBLB 4U3JB 3ZSRA 4CH6A 1RT5A 4HUFA 2HHUA 4FM1A 1I39A 1QHTA 1IKVA 4CGFA 1RT3A 1XNRB 4X1IB 1GOCA 5D3GA 3TAQA 5CA0A 4K0KB 3JAWB 4EP5A 3E01A 2DFFA 4CEEA 3L3UA 3HK2A 4AQYB 2OZSA 4FZYA 2GBZA 1Z5VA 4AHTA 4CF9A 3V9ZA 3TI0A 2CAZC 4E89A 2GUIA 4W5NA 4BDPA 1YEWA 4LH5A 1U48A 1C0MA 1KRPA 5LOVB 1IBMB 2FBXA 3DLRA 5JH7A 3E22B 2BTOA 3V9SA 1D9DA 2Q7EA 3BGRA 2IGIA 4KHSA 4BWMA 5K1PA 1NK5A 4DR5B 1A5VA 3VA0A 4KB0A 3TAPA 4CHNA 4BACA 3KK1A 4PUOA 1LW2A 3KKRA 1T8EA 4CESA 4N56A 3LWMA 1K6YA 3QEVA 2Q7GA 3ULDA 3S3OA 5FPOA 1SKRA 4O4LB 4GLXA 1A5XA 1KFDA 1RILA 2VG7A 2PYJA 3N2KA 4NYNA 3OYDA 5J2NA 4O0IA 2UXDB 3M7MX 5KHHA 2ZNJA 3NGYA 1C0TA 4CGGA 2XY6A 4LSNA 4Z4HA 5D5PA 4Q6GA 5JJEB 1TAUA 4CGJA 3JSLA 4ID1A 4TQDA 4M45A 3KLFA 4JV5B 4WE1A 3WNFA 4ZI7B 4DWIA 3OYIA 4BDZA 4F4KA 4FW2A 3LP0A 2X74A 5KTQA 4CHZA 4C8NA 3JALB 4PQUA 4RW9A 2FBYA 4DR4B 4TUYB 4I50A 2Q7HA 3IAYA 2HHTA 4FYDA 4JI8B 4U3JA 4F3OA 3RYHB 1W9HA 3SI6A 3AVJA 4DTXA 1I94B 1S1UA 1WSGA 2G8IA 5LYJB 3MXMA 2UXCB 3OY9A 4KRFA 4O4IB 3HP6A 4W5OA 3C94A 4Q0BA 2VG6A 4FJNA 3AA2A 1JXEA 4X1IA 3WB2A 2EX3A 3ZEDA 3ZT3A 4CK1A 4B8CA 3KLEA 3MECA 4N76A 5CY4A 3K59A 3SYZA 3K5LA 4OGCA 2F8SA 1ZBHA 3LAKA 4KFBA 4L8JA 1XQ8A 4L8RB 3OYMA 3HO1A 1QE1A 3SQ0A 4CHOA 3OTOB 3QF7A 1FK9A 4FLYA 4DQRA 1QSYA 5LOVA 4N5SA 3NDKA 2P5OA 3E22A 4AHUA 4KO0A 4AILC 3BA8A 2IAJA 5LMUB 3KLGA 1BGXT 4CJUA 4CH4A 1N33B 2X6NA 2B4JA 3IS9A 2HHQA 4DV1B 1WAFA 3DRSA 1D9FA 3DLKA 1FFXB 1UWBA 2VQFB 1WSIA 4O4LA 3O4QA 3QESA 3VQWA 5E41A 3UIQA 5HRSA 4B9TA 2WONA 4ZHQB 4I9LA 3AO1A 4CEZA 2OPSA 3RR8A 4AHRA 1EETA 1D5AA 2V4DA 1QS4A 1L3SA 4HTUA 3HP9A 1XHXA 3O4NA 4FJIA 3OYJA 1UOCA 4LH6A 4LFCB 1XMQB 4CGDA 3WNEA 3O3HA 4HVJA 3L2VA 1N5YA 4IFYA 4UQGA 3BPZA 2LSNA 4B3SB 1UAXA 3QG5A 3AA3A 2IOCA 2W42A 4YJ3B 3WNHA 4CERA 1N6QA 2YHBA 5D5QA 4TUYA 1NK9A 3RYIB 2Z1JA 4NCAA 4DTJA 2JLEA 1SV5A 3JATB 1TAEA 1RBTA 2D0BA 3RYHA 3HKDB 3NFAA 2FBVA 5LYJA 1TUBB 1X4TA 2YV0X 1EXQA 4NXMB 3QIPA 4O4IA 1HQEA 3ZS8C 1JLQA 3HVTA 3VQ6A 3L3VA 3WNGA 4HNAB 1JLFA 3QO9A 1KFSA 1NJZA 4DSEA 1EKEA 3ETQA 4FW1A 4FJXA 2PUSA 3WB1A 3RR7A 2PTMA 4LF7B 1LWEA 4LY7A 3CFRA 1U4BA 5J2UB 1TGOA 5JJNB 3NGIA 1RTDA 2YIBA 3NGZA 3ZSXA 1BIUA 4IG0A 4NXNB 1HNXB 4JI3B 4FJLA 4CH3A 1NOYA 2F1MA 5EZYA 4X1KB 1VK0A 3ZSOA 4X62B 2E5LB 1JLEA 2ZQBA 4B9NA 2YIAA 4CJKA 1BL3A 3V4IA 4AHSA 1NJYA 2FBTA 1C0UA 2HHHB 4DUYB 4OPJA 4DV4B 3DLGA 4FJJA 3VQEA 3T1HB 4O4GA 4TQFA 1SKSA 3KD1E 2HMIA 3NF6A 3L8BA 5LP6C 1FFXA 4D7TA 1O9GA 4EB6B 4M3XA 4Z4FA 3OYGA 4O2AB 4EFEA 4ZHQA 3NE6A 4TSXA 3S3NA 5JCOC 4LF8B 3LZIA 3TR8A 2F95B 4ZTFA 4FJ8A 3PN1A 3OYCA 4B9LA 3SNNA 3C6TA 4ELVA 3V9XA 5EIBD 2KTQA 4DRXB 4O44A 2P5GA 3CSXA 1QQCA 2QXFA 4DK1A 3M8PA 4UFZA 1ZBIA 1JLAA 4GMJB 4XIUA 2YKNA 2PYLA 4F8RA 4N41A 3PY8A 2HEPA 1KLNA 4IFVA 3ALYA 4YJ3A 3U11A 1IH7A 2PZSA 2KZZA 1L3TA 3THVA 3C6UA 1CLQA 4DV6B 3DRPA 5BMVA 3RYIA 1UA0A 4CJQA 4C8OA 2UXBB 3LALA 2R72A 4CFCA 2YKMA 4KAZA 3JATA 3BA9A 3D0PA 3T3FA 4CFAA 1RDAA 1G15A 3VQXA 4GKJB 2UUBB 3VQCA 1TUBA 5KHJA 3BRCA 1N34B 2RPIA 3QIOA 1IKXA 4HNAA 3SUQA 1B92A 1S9GA 4BWAA 5JQGB 4CEFA 3U3GA 3KLIA 2A1SA 1X1PA 3BHPA 2FC0A 4FJHA 2R7FA 4KTQA 4EZ9A 1HMVA 3QTCA 2JS5A 2OPRA 1VF7A 1TVRA 5JS2A 1RSOA 4KB1A 4EP4A 4OJRA 1VSDA 3AA4A 4DFKA 5J2UA 2HW3A 2KFZA 3AVMA 3TABA 4FJGA 3EZ5A 3L2UA 3CG7A 4M41A 3VQ7A 4LF6B 3KIOA 4ELUA 1WPBA 3BAAA 1TL3A 1TKZA 4HUGA 4X1KA 3SPYA 2BANA 1SQGA 3HVRA 1B9FA 1RT1A 2VG5A 1DTQA 4UCVA 3SJCC 1RT4A 1TL1A 1WSJA 3PX0A 5K14A 4HCCA 4B9UA 1BCMA 2G8WA 3HKEB 1Q5OA 3KK2A 1FXXA 3SQ1A 3JYTA 3DMJA 3BABA 4LF5B 3DI6A 4W5RA 3AVGA 3AVNA 3SUOA 4DR3B 3ZT4A 4EB6A 4DU4A 4X65B 3CYMA 4LD0A 4O2AA 1TA8A 3QNNA 1HW7A 1O9HA 3DSQA 4F6RB 3IG1A 4DS4A 3DM2A 3LZJA 3EY1A 5LA6B 4CJRA 5ITZB 4KHQA 4CJWA 4OGEA 5HROA 1FJGB 1XI1A 4DRXA 1VSKA 2B6AA 4CJPA 3AV9A 5C42A 1KVCA 3LDSA 5K1XA 2Z1HA 3MEEA 1N36B 4DV2B 4CJ5A 4OKKA 4X64B 5FDLA 2DY4A 3MEGA 3VQPA 3P83D 2IC3A 3NF9A 4D7SA 4FJKA 1ZBUA 4F2RA 3VQ8A 4E1NA 3N2GB 4DFMA 1BI4A 2ZINA 4JI2B 2DTUA 3S3MA 5CYMA 1TKTA 3HXMA 3K2PA 4YFUA 1C1AA 4JLHA 3LP3A 1JL2A 2KFNA 2GV9A 4FXDA 5C8YB 2HHVA 1SKWA 5CYQA 2DFHA 1RBUA 4E1MA 5JQGA 5IYZB 1XNQB 3ASMA 3ZSWA 5KGXA 4O4JB 3ICXA 1L5UA 2F93B 2QKKA 4DTRA 3ZT0A 4CF1A 4UCOA 4CS4A 1RBVA 3MXIA 3NH0A 2ZIOA 4JI1B 3JAWA 1JFFB 4X66B 2I5JA 2RKIA 1I3AA 4Z4GA 3OVNA 3HSTB 1T7PA 1U49A 5CA1B 3AVAA 1S1VA 1ZBLA 3PO5A 2E6MA 3MEDA 5JJJB 3SQ4A 4IHJB 3PX4A 1H2SB 4B3TB 1HYZA 1QSSA 1RBSA 5KRSA 3OYFA 4E7HA 4W5QA