2PZSA

Phi29 dna polymerase complexed with primer-template dna (post-translocation binary complex)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
571
Chain Sequence
b'PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-d(GACTGCTTAC)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
total genus 165
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pzsA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pzsA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pzsA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pzsA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pzsA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pzsA06
4B9SA 4HCBA 4KB1A 3U6FA 3SCXA 1FKOA 5EU7A 4C8LA 3NF6A 3OYMA 2RPIA 3PX6A 3EYZA 3K57A 1YVUA 1ZBLA 1T7PA 5C25A 4EZ9A 3B6PA 2A1SA 1L5UA 2AJQA 3ZSRA 1JL1A 3LWMA 2YNHA 3L2RA 4FZXC 3T3FA 3TAGA 4N76A 3WNGA 4FZZA 3OJSA 2PYLA 4AHCA 1RILA 1RNHA 4FJGA 3AA2A 1T8EA 1S1VA 2G8HA 5HP1A 3QEXA 4KREA 3VQDA 2HVIA 3DM2A 4CEBA 4I9LA 4B8CA 1HPZA 4RW6A 4E0DA 1S1TA 4M3XA 3AVKA 2OZMA 3DLEA 3KLHA 1HQEA 1LW0A 3SQ0A 1TKTA 2QKKA 3KK2A 1VRUA 2WOMA 1RTIA 4KHYA 4DWIA 3LP3A 2Q3SA 1U49A 1EXQA 2GV9A 3OVNA 2I5JA 4BE2A 3CYMA 3TWHA 3QNOA 4HUEA 2HHTA 1VK0A 3AVIA 2HNDA 3QO9A 4CFCA 4O55A 4CEFA 3EY1A 4KO0A 4F8RA 1LWFA 1QE1A 4DLGA 4DTNA 4AH9A 3ITHA 4BDYA 3IAYA 3VQ7A 3KD5E 4O0IA 3SUQA 1UOCA 4DSEA 3NGIA 1Q8IA 3PO4A 3HO1A 4FM2A 3NF8A 1BISA 3K5NA 4CJPA 3S9HA 4KPYA 5FROA 1TGOA 2DFFA 4E1NA 2DFEA 4DTXA 3AVHA 4CJKA 1WNSA 1ASUA 4LSNA 3VQEA 3LZJA 3RWUA 4DU4A 4Z4FA 4CJUA 3V9SA 4J2BA 3OYCA 4OVLA 3NFAA 1VSDA 2DY4A 2YV0X 3HL8A 1IO2A 4KAZA 1GOBA 1R0AA 1FK9A 1HNIA 3E01A 1DLOA 1BQMA 1RBRA 4HUFA 4B9MA 1C1BA 2D0AA 3A2FA 2QK9A 4OLAA 2VWJA 2HHSA 1D9FA 4DQSA 2R7FA 4LH4A 3OYDA 3V9WA 2Z1JA 2O4GA 4JLHA 4QOZB 1CZBA 4CCHA 3RR8A 4BWJA 3SJJA 1VSMA 1BCMA 4FM1A 3QLHA 3CG7A 3ASMA 3H08A 3TANA 4DQPA 4FJ9A 3QIPA 4Z0UA 3O4NA 4OGCA 2XHBA 2RKIA 3VQ4A 3SZ2A 4E7HA 4FJKA 1TAQA 3MAQA 3L2VA 5DK5A 1LWCA 3K5OA 1NK7A 2IAJA 4O5BA 3VQCA 3DMJA 4DTSA 2O4IA 1HNVA 2Z1IA 4M3RA 1BGXT 3U3GA 3OYNA 1JLBA 2OA8A 1NOYA 4DS5A 4IG3A 1RBUA 3SYZA 4DLEA 4DMNA 4BACA 4OKJA 1NK5A 4M3TA 4FLVA 3VA0A 1JKHA 1I39A 4CGFA 4DG1A 4CF8A 4KB0A 2VWKA 3K58A 3I8DA 1S1XA 3ZCMA 4CJSA 1EP4A 1JLEA 4BE1A 3SNNA 3AVCA 2OZSA 1YTUA 2IOCA 3S3OA 3RR7A 1NK9A 2B4JA 3KTQA 4FJ8A 3CFRA 3OYJA 1X9MA 1QS4A 1SL1A 1TK5A 4J2AA 2G8FA 3SQ2A 2Y1IA 3NH1A 1RDAA 4AILC 4AHSA 4DTRA 3TAPA 3AV9A 3ZSZA 4B9VA 3KD1E 1YT3A 1WSIA 4PUOA 1NK8A 5SZTA 4DU1A 1RT5A 4F4KA 4I7FA 3T1AA 4CJQA 3QERA 2RN2A 4ZTJA 2HMIA 3LALA 1X9WA 3C95A 1WAFA 1RT7A 2F96A 1KCFA 3K5LA 4AHVA 4CK2A 1FKPA 3VQAA 4DF4A 4KHQA 3OYIA 1LAWA 3I0SA 3ZT0A 1D5AA 3AVAA 4OKKA 2KZZA 3SQ4A 5HRRA 4EP5A 3OYLA 1LW2A 1RT4A 1O1WA 1U47A 3V9XA 1IKVA 1C0UA 2VG7A 4ZHRA 4PY5A 3KLGA 3DLRA 4FJXA 1JLQA 3MEEA 4DQRA 4F2SA 4EP4A 4PWDA 3VN5A 2OYQA 1TVRA 3L3UA 4CK3A 4DFMA 2IDOA 4ID5A 1XWLA 1KLMA 2X6NA 5SWMA 3WNFA 4C8OA 4FM0A 3TAEA 1S1UA 3DLBA 4FW2A 2A1RA 1QQCA 3WNEA 1RT3A 2ETJA 1JXBA 4CK1A 2OPQA 1NJWA 2HHVA 2YKNA 1HMVA 3CFOA 2HNYA 1EKEA 4XIUA 3DRSA 1NKBA 3RMBA 4NCAA 3ZSQA 4PA1A 2B6AA 3AO4A 3DI6A 4B9NA 3LZIA 4O44A 4ZTFA 1HYSA 1W9HA 1DTQA 2B5JA 4DF8A 5CYMA 1QSSA 3S3NA 2KTQA 1L3UA 4KHSA 2XY8A 3LPTA 1NJYA 4CEQA 1RDDA 4CGJA 3LP2A 1WN7A 2G8IA 3QNNA 4I2PA 1NKEA 4HVJA 4CJ4A 3JSMA 4CJ5A 4OPKA 3HSTB 5J2MA 1TK0A 2KFNA 2HHWA 4FLUA 2DTUA 3OS1A 3AO3A 3TARA 1BCOA 1CXUA 4Z4CA 1X9SA 2OPRA 4IFVA 1QTMA 5CZ2A 1VSJA 3SUNA 2HHQA 2YHBA 4ELTA 2HW3A 4E1MA 3F9KA 3HYFA 3KLFA 4CHZA 3QEVA 3HXMA 3NAEA 3L2UA 5HRSA 2LSNA 1UA1A 1L3VA 2FBTA 3EZ5A 3AO5A 3VQQA 4KV8A 1Q9YA 4N41A 3SQ1A 1KFSA 4BDPA 1XHXA 1A5XA 1C1CA 3MXJA 2HB5A 4BWMA 3BDPA 2P51A 3AVBA 1S5JA 4CGIA 2NUBA 3V81A 1WSHA 4IDKA 4DSKA 3L8BA 5C24A 3KKRA 2X78A 3HP9A 3AVGA 2ZQBA 4W5TA 1NK6A 4CFAA 3V4IA 3K2PA 4NYFA 1N5YA 1KVAA 3AVFA 4M3UA 1KVBA 1RTDA 4J2DA 4FYDA 4C8MA 4O0JA 3PO5A 3LWLA 2YKMA 2G8UA 4ICLA 3K5MA 1VSHA 3T19A 4AHTA 4Z4GA 5I42A 4OGEA 3MECA 4PQUA 3HK2A 3RMDA 4I9QA 5FRNA 4KRFA 5J2NA 1EX4A 4DSLA 4CGDA 3JYTA 3CM5A 3ZSOA 1UA0A 4CEOA 3OYFA 3HT3A 4FJMA 2BANA 3VQPA 2HNZA 2W42A 4RG8A 1BIUA 1J9AA 4FJ5A 3OYEA 5CY4A 4K8ZA 1Z25A 3PUFA 2PW9A 1A5WA 3HVRA 4YNQA 2FC0A 4CJEA 4FK4A 5JS1A 1HYZA 1X1PA 2IS3A 3QINA 1WAJA 4IG0A 3M8SA 3NE6A 1C0TA 4KI4A 4ELUA 2VG6A 2BDPA 3OJUA 4WE1A 1TKXA 4AHRA 3ISNC 3OYAA 3LAMA 4LH5A 2P5OA 4DU3A 5J2PA 1S1WA 4F2RA 4CJTA 4CJVA 2KZMA 1RBSA 2QXFA 3NGZA 3QEPA 1DTTA 3DRPA 3HPGA 4H4OA 1KLNA 5KRSA 4DS4A 1QSLA 4E19A 3LAKA 4CEDA 4DSFA 4RW9A 2D0CA 4M45A 3HVTA 3KJVA 1B9FA 1U48A 4FLZA 3CQ8A 2YNIA 1KTQA 3AO1A 4NYNA 4OPJA 3OY9A 4DTPA 3QESA 3SPYA 4B9LA 1SV5A 5HROA 4EZ6A 4Q0BA 1SL2A 1WSFA 1ZBFA 4KTWA 2ATQA 1VSIA 2IC3A 5JS2A 3SUOA 3HJFA 1ASVA 4CJRA 5KGXA 4GVMA 3TAMA 1S6PA 3LP1A 3LANA 5E41A 1J53A 3AVJA 4JS5A 3C6UA 2KFZA 5D3GA 3QIOA 4H8KA 4E7JA 4B9TA 1FXXA 1B92A 2YHAA 4Q5VA 4E7IA 4M3ZA 4CIFA 3DOKA 4FJNA 3TR8A 3ZSYA 2XY6A 2PZSA 4ELVA 3WNHA 3NBPA 4DFJA 2EHGA 1ZBHA 3ZT2A 3P1GA 2FBYA 3P5JA 3FI7A 5HLFA 3DRRA 3P83D 4FJJA 1U04A 4FLWA 4CEZA 1LWEA 1REVA 1BL3A 4OJRA 3TI0A 4O4GA 4AHUA 3SI6A 1J5OA 3TAFA 4B9UA 3NF9A 3O3HA 1A5VA 3AA5X 3C94A 4CHYA 5T7BA 4E7LA 4C8NA 4L8RB 3B6OA 2ZD1A 4Z4HA 1JLGA 1ITGA 3TABA 3LDSA 4Z4IA 4F3TA 4CJFA 1SKSA 3VQ5A 3OYGA 3HP6A 4FJ7A 2PY5A 1JLFA 4UQGA 3KLEA 2F8TA 1QHTA 4DQQA 1IKYA 1U45A 1QSYA 4CGHA 4HUGA 3PX0A 4KKOA 1CXQA 3NCIA 4Y1DA 1SKWA 3MXMA 2BE2A 2X6SA 5KI6A 1ZYQA 1K6YA 3FFIA 3K59A 3KK1A 3U3YA 3ZSVA 4F3OA 4W5QA 4M42A 4N5SA 3HPHA 3RRHA 4CE9A 1VSEA 3O4QA 1IKXA 1RCHA 3VQ6A 3M8PA 3ZT3A 4DTUA 4FJIA 4KHUA 3NH2A 3DOLA 5DMRA 3ZSXA 3MXIA 4W5RA 3S3MA 4CESA 3MEDA 3VQBA 1T05A 1BI4A 4HCCA 1TKDA 3ZT4A 3NH0A 3PV8A 1IG9A 3V1RA 4CF9A 4FXDA 4C8KA 3OS2A 1HJRA 2YNFA 1WSJA 1J54A 3L2WA 1XHZA 3D0PA 3V9UA 3OS0A 1SUQA 2Z1GA 2X74A 3OYBA 4MQ3A 4RW7A 3QEIA 1NK4A 5K14A 1B9DA 1F21A 2JLEA 5HRPA 2D5RA 1JLAA 2OPPA 4M3WA 5FRMA 4HHTA 4GMJB 4LY7A 1HRHA 3QEWA 3V6DA 1SL0A 4FLTA 3RMAA 1BHLA 3KLIA 4I2QA 3M8RA 1RBVA 1NJZA 2FBXA 3RRGA 2P5GA 4CGGA 5KRTA 2F8SA 4Z4EA 4DTMA 1RBTA 3DYAA 3KK3A 3OYHA 3G0ZA 1JL2A 1C1AA 1JXEA 1RDBA 3LP0A 4TSXA 1RTHA 4CJLA 4FK2A 3BGRA 3M8QA 1JLCA 4IBNA 3AA4A 4M3YA 1TV6A 4B08A 3LPUA 3NF7A 3RMCA 1HYVA 1D9DA 1IH7A 3G10A 4W5OA 1BIZA 3SUPA 4GW6A 2ZE2A 2Z1HA 3AO2A 2G8KA 1KVCA 1C6VA 3HPOA 5CYQA 1KRPA 1U4BA 4IKFA 1RT6A 1ZBIA 1GOCA 1WSGA 4HTUA 4N47A 3PY8A 3I0RA 3CM6A 4CIGA 1LAVA 4KFBA 1UWBA 4ID1A 1WSEA 1S9GA 3C6TA 1CZ9A 1Y97A 4OKEA 5J1EA 1RT1A 1UAXA 4FLXA 1S9EA 1S6QA 1I3AA 3ALYA 3AVLA 4CF2A 4RW4A 2IGIA 4Y1CA 3AVNA 2OPSA 4RW8A 2XRIA 1MU2A 4E7KA 4DSJA 4E3SA 3V9ZA 3IG1A 4KTQA 4CEAA 4JS4A 4H4MA 3VQ9A 2HHUA 2RF2A 4FJHA 4CJ3A 3DLKA 1TKZA 4G1QA 3NHGA 3O3FA 1ASWA 3PX4A 4CF0A 1NOZA 4CERA 4NCBA 1BQNA 3IS9A 1GOAA 3DLGA 3L3VA 1XC9A 4W5NA 5CZ1A 5HBMA 3UIQA 4CFDA 1ZBUA 3OYKA 3AVMA 5FDLA 4K8XA 3CFPA 2P1JA 2JGUA 4FVMA 3VQ8A 4BDZA 4CHPA 5I3UA 3AA3A 4R5PA 1VRTA 3SV3A 1YTAA 2WONA 2ITGA 3IRXA 3NGYA 4KTZA 3D45A 1RT2A 3V1QA 4DFPA 3QETA 4YFUA 1RTJA 1W0HA 3V1OA 1HQUA 2D0BA 4FZYA 4CEEA 4FJLA 2GBZA 4KI6A 1WLJA 4DQIA 2HHXA 1SKRA 1C0MA 4MFBA 3RTVA 1TL3A 1TK8A 1NK0A 1NJXA 4QCLA 2HVHA 1EETA 4CECA 4NCGA 3NDKA 3DLHA 1T03A 4QAGA 4CF1A 4JRQA 4FK0A 2QKBA 1Z26A 2E6MA 1RDCA 3L2QA 5J2QA 4N56A 2E6LA 1VSFA 4KHNA 3SPZA 2DFHA 1Q9XA 4IFYA 3SV4A 3ZT1A 4OLBA 3MEGA 4JRPA 4KHWA 1VSLA 1TL1A 3VA3A 4FW1A 4BE0A 4FCYA 2VG5A 2BGGA 2EX3A 4M41A 3ULDA 1NKCA 1D8YA 2YNGA 4DTJA 1IKWA 1N6QA 4B8AB 5HRNA 1CLQA 2XO7A 2GUIA 4CHNA 4DTOA 3TAQA 1KSPA 1KFDA 2G8VA 1L3TA 1VSKA 3O3GA 2PYJA 4E89A 4DSIA 3KIOA 5C42A 4CHQA 2XY5A 4J2EA 2FBVA 2KQ2A 2E4LA 4CIEA 4LSLA 2G8WA 2Y1JA 4CFBA 3KKSA 1XI1A 4LD0A 4FLYA 4CHOA 4CJWA 5KTQA 3F73A 1L3SA 4B3OA 1BI4B 3ZSWA 2R7YA 1TAUA 3THVA 5KGWA 2KW4A 3HM9A 2XY7A 1G15A 4DFKA 1LV5A
chains in the Genus database with same CATH superfamily
4MVZA 4A57A 4HCBA 3R9PA 3U6FA 3SCXA 2Q97A 3RVCA 4CD3A 5HOOA 3D2EB 5AQSA 2WA4A 3OYMA 3AEDA 3PX6A 1YVUA 3H6EA 2E88A 4J7JA 4XDKA 2A1SA 2AJQA 2QTOA 3QVNA 4YOUA 3J8AA 4FZXC 1PNLA 1QZ5A 4FZZA 4N76A 3WNGA 3OJSA 1RILA 4OO1J 1HPMA 4BRFA 3MN6A 2HVIA 3UO2A 3C6AA 2KG7B 3C0BA 3RBZA 4CEBA 2UUBK 1U2VA 4KP4A 2WP9A 4ISGA 4E0DA 1S1TA 3AVKA 3CC4V 4JI2B 2ZJPL 3AEGA 1Q6HA 1OVYA 5AQIA 5KX5A 4DV4O 1VRUA 5H6RA 3W7WA 1DGSA 2D1KA 2UU9B 3OUSA 3ABKB 4DWIA 3JAWB 4I55A 4P9OA 3U11A 3LP3A 2X5ID 2ZXWC 3D8CA 1GK9A 1BE3H 2AHZA 3CYMA 3VEZA 4FWMA 3W7TA 3QNOA 1LNQA 3AVIA 4DV6B 1NH2B 4JZGA 5KHKA 4LFCO 3WEEB 4F8RA 3LSQA 1LWFA 4AH9A 5GW7A 1RPRA 4O0IA 4OX9O 3SUQA 2Z5UA 3HO1A 2P9IB 1Q8IA 4EFEA 2JEXA 1UJWB 1VQOV 3HRGA 4LC9B 3K5NA 1GN6A 1KXPA 3OD4A 4CJPA 3S9HA 1BSMA 4BRLA 4JI4B 4E1NA 5GIOA 3AVHA 3W0LA 1YTFB 1MQTD 1GO3F 3CCJN 4Z4FA 4DU4A 2HG5C 1Q6IA 4BROA 1XMQO 4J41A 1IO2A 5AQQA 1IBKK 2EINC 1VAZA 3I55N 3BY5A 4IEIA 1BQMA 2HHSA 4RUEA 1Q43A 1S0VA 4QS8A 4HUFA 4B9MA 3JBG4 4JPRA 2QKAA 2R7FA 1VQ6V 3DWLA 1QBZA 2R074 4J8FA 4X64B 3R66A 4JI8K 4ZI7B 5KA5A 3MCAB 2P9NA 3RR8A 5L3DA 3CMEV 1M1KW 4FM1A 4MO4A 3AE3A 1GH6A 3CG7A 3H08A 3WXKA 3QTCA 4BRHA 2FTKA 4Z0UA 1GMGA 1VARA 4HAMA 4WFHA 3O9SA 4EFBA 4B3MK 1RDUA 5C3JA 3JD3A 4MVMA 4K41A 3L2VA 1NK7A 4JI2O 4NXMK 4H0VB 2Z1IA 2Y69C 1BGXT 2OA8A 1JLBA 1NOYA 4JI3B 4IG3A 1KKCA 1SQPH 1PPJH 3SYZA 3VMFB 1HR0K 2UU9O 4M3TA 4JYAB 3VA0A 1I39A 4PL7A 1YCIA 3R3LA 3JARB 2GBOA 4LFAB 3BEHA 3K0GA 1OCCB 1VQKN 3ZCMA 4DV6O 1EP4A 3DXMB 3AE6A 2B1IA 4B7KA 4WFBL 2IOCA 1YHQV 3RR7A 1AI6A 4QE9A 2HFEC 1EO1A 4UB6Z 3F2KA 2RS34 2A42A 1IBMB 2HSTA 4I0XA 2NR5A 2I7NA 4NO7A 1V54C 2GSMB 1TK5A 5KPRA 1KP2A 5LA6A 4JI4O 1RSOA 2V51B 4AHSA 4AILC 4DFKA 4PELA 3B09A 5JICA 3CX5F 4U3JB 3ZSZA 1OCOB 1WSIA 2ITMA 3AEIA 4XH5A 1NG9A 3N2GB 4DU1A 1RT5A 2Y4TA 3NMUA 2A3QA 3T1AA 4CJQA 2RR14 3LALA 1H38A 2HKOA 2F96A 1KCFA 1DK1A 4KHQA 5E79Z 1FKPA 4JGSA 3VQAA 2BTQB 3AG7A 3RT3C 1QZ6A 3DAWA 4B7EA 4BGAA 3B8NA 2WDRA 1THZA 1FFXB 4EP5A 4X64O 2F9WA 1AI7A 4NB4A 1L8DA 1U47A 3V9XA 3EHBB 1C0UA 3OBWA 4FJXA 2YI1A 4C1NI 2F43G 1JX9A 3VGLA 4PWDA 1K8KB 1Z5WA 1FXKA 3AG2C 1PNKA 1BHAA 3L3UA 3ZS8C 2A6AA 2ZGYA 4DV2B 5F2RA 4YY3K 1MNGA 3ID6A 1FFTB 1VMGA 3STZC 3WNFA 3VRAA 1S1UA 1QCEA 3DLBA 3ZN1A 4JI3O 5IY5B 4YJ2B 1S3XA 2YI8A 4PA3A 2OPQA 1VQ5N 4BR7A 3CCRN 2YKNA 1H2LA 2CH5A 4YIOA 2GHYA 4FSVA 3U9ZA 5FPRA 4B3TB 2A9HA 1EKEA 1XC3A 3DRSA 3ENOA 1SAZA 3UKRB 4XIUA 3PSFA 1FS0G 3EN9A 3DI6A 3S3WA 2KHOA 1XMOK 3SJHA 2ZR3A 1HYSA 1W9HA 2UUCK 5CYMA 4X1IA 4WF9L 2EILB 4WCEV 3M3ZA 1IBMO 1BZKA 3CIPA 2JGDB 5JJJB 5BN9A 1NJYA 3D2FB 3C3SA 1KQSU 5AZIB 4CBXA 3QNNA 1HW7A 2HVJC 3I8BA 2ZE6A 4CJ5A 2WLHA 1TK0A 3RYCB 5C2TA 2HHWA 3OS1A 3TARA 2Q73A 1SF9A 1I94B 2UXBB 4FPAA 4IFVA 2GTAA 1VBA4 4DK1A 3KLFA 1UA1A 1TUEB 1FD9A 1HKCA 2YIAA 3AO5A 3SQ1A 3LUTB 3P4SA 2QGNA 3MXJA 1E4FT 2HB5A 3BDPA 4K0KB 1S5JA 4G27B 5LOVB 2AZ2A 1WSHA 1SZ2A 2KSDA 3L8BA 4PDMA 5EC1C 2ZQBA 1KC8O 1OCZC 1NK6A 1BA1A 4O4LB 4DV2O 1OKJA 2VYPA 3AVFA 4DR7O 2WTUA 1W2BM 4JI6B 4DK0A 4O0JA 3HOSA 4UXNA 2G8UA 2CUGA 3K5MA 3EO3A 4FWKA 5ADXA 4AHTA 4Z4GA 2P9SB 4JKDA 3MECA 4B3SB 2GWJA 5DM7L 3HK2A 4NB5A 3RMDA 4KRFA 4H33A 4UUJC 3FR0A 4B3TO 1UA0A 1L0LH 2WLLA 3ZSOA 4CEOA 1LR1A 3IC9A 3SJAC 3HT3A 2W6IG 3OE7G 5AR0A 3ZYYX 2HNZA 2W42A 1K5QA 4BIOA 4HWIA 4K8ZA 3OYEA 4DW0A 1Z25A 4LF7B 3PUFA 2HF3A 3W7UA 3ETEA 3FZMA 1PO24 1AJPA 3FZLA 4P30A 1C0TA 4ELUA 3I56V 4LNUB 1RSOB 3DC5A 1K8AW 1TKXA 1VP7A 4LH5A 4YOTA 4AHRA 3OYAA 1ENVA 1OJHA 1WPXA 1I94O 2UXBO 4DU3A 1G6UA 4F2RA 3SYOA 4CJTA 2KZMA 2E2PA 4RHV4 1M9NA 1CXZB 3AK1A 2CGOA 3SAGA 3HPGA 1FW6A 4H4OA 5HFMA 1MDUB 3JATA 4UV8A 3ATUA 5KHIA 3CC2V 4FWSA 1AVMA 2WPDG 3KJVA 1XQSC 1U48A 1RFQA 3SPYA 1KTQA 3HSCA 4B9LA 2E76B 2ILMA 4DTPA 4FWPA 3ZEUA 2YC0A 3U4LA 3WG7C 1G4YB 3VTHA 3LNMB 4FFBA 5JS2A 4JKCA 3HJFA 4FIPC 2ZE7A 3UQ8A 4GLXA 3ABTA 1BO5O 2FMLA 1SA0A 1K73O 2V7ZA 3MK6A 4YDUC 4WFEA 5E41A 3HZ6A 4JI6O 3BCCH 3EE9A 1CP9A 1MWKA 1U6ZA 5D3GA 4B9TA 4I6MA 3O65A 1FXXA 2YHAA 2QM1A 5KA6A 4B3SO 3AEFA 2PZSA 1SQVH 4DFJA 3ZETB 3ZT2A 1YVNA 4O4IA 2DYRC 2WLIB 4HYOA 4FMTA 2YJFA 3P83D 4FJJA 4DV1B 1LWEA 1BL3A 3NVMA 4O4GA 3HTVA 1J5EB 4LF7O 4KH5A 3HPLC 5IJ9A 1J5OA 4PA9A 4PI0A 3QB0A 1AJNA 4Z1MG 3C94A 3TAFA 1HRI4 4JV5K 3CCMV 3CJBA 4L8RB 4Z4HA 1JLGA 2VWBA 3EKSA 4EIAA 3SPJA 1GM7A 3FZHA 1WBBA 3K08A 4H5VA 5AQUA 4Z4IA 3JAKA 4BVPA 1AROP 2W6LA 4TOIA 4BRIA 4CS2A 4C7UA 3BF1A 1KFYA 1RM1C 3KLEA 2CTWA 1KC8W 1J6ZA 1QSYA 4CGHA 3SK3A 4HUGA 5C2FA 3ABVA 2BE2A 1TVKB 1IVSA 5KI6A 1ZYQA 1K6YA 3ZSVA 5H1SQ 1ROPA 1X59A 3C65A 4OPAA 3T1YB 1IXBA 3J80N 1VSEA 4TV8A 3CCSN 2WAMA 3AGRA 3M8PA 2W0XA 4DTUA 3K9AA 4J9ZB 3OW2M 4YJ3A 3TETA 3EZWA 4KHUA 3DOLA 3EKUA 5DMRA 1Y64A 4QGPA 3ZSXA 4IXCA 3AG3C 4LF9K 4JI0B 3MEDA 4FWNA 1BI4A 1T05A 1IX9A 4CZHA 1OOPD 2NNWA 5CBGA 3SR2C 5B3SB 1JA8A 4FXDA 1GLLO 1WSJA 3D0PA 2X6CA 3V9UA 2HMPA 4H0PA 2X74A 1AB3A 3TSPA 4HZ3A 4CZJA 3FX7A 3E89A 2O57A 1F21A 5HRPA 2D5RA 2OTLV 5KUKA 4M3WA 3O1BA 3AE5A 4GUNA 5J2TA 5AQPA 4XH1A 5B1AB 1HRHA 2N74A 1W97L 4DV1O 4EB6A 3RMAA 4CZMA 1SQQH 4TQDA 3ULEB 3I33A 3G0ZA 5LP6A 1C1AA 1SESA 4CC6A 2CH7A 5ITZB 2CGJA 4PHZA 1PD3A 3BGRA 5AQZA 3CF5L 3U9DA 2OWOA 3M8QA 2V4DA 1JLCA 4IBNA 3AE1A 3CJHB 5JQGA 3LPUA 3OA9A 2YJEA 3NF7A 1VQ9N 1HYVA 1D9DA 4M3YA 3G10A 2YXLA 3BZKA 4W5OA 2UXCK 5KUMA 3SUPA 1NENA 4CBCA 1F4NA 5L3BA 4GW6A 5CMUA 5CYQA 4JASA 2ZF5O 1PL0A 1PNMA 4LFBB 4J42A 4WQ4A 4BRAA 5GAEP 1YIJN 3I0RA 1WB9A 1S9GA 1Q7YW 1CZ9A 3VQXA 4BR0A 3THWA 3H9VA 4WYBA 4FPBA 1L0NH 3G6EN 4FLXA 5GINA 5GONB 5LMUK 4U7NA 5CE3A 1MU2A 3OUFA 4E7KA 1QU7A 1TUBA 4MTOA 4JI0O 4E3SA 2WUSA 3WXMB 5BPLA 3QO8A 2CGNA 4H4MA 2E2QA 2RF2A 4FJHA 4CJ3A 5IYZA 3DLKA 2XAQA 3SPIA 1ASWA 3PX4A 3CHWA 3EE8A 4JKAA 4CERA 1M90W 3IS9A 4W5NA 5CZ1A 1NCQD 3KZBA 4CFDA 4PA7A 1R6TA 3OYKA 4YHHK 5FDLA 3L72H 4DUYB 2JGUA 2QWPB 3B2EE 2IVPA 4O4IB 3V1QA 4KTZA 3D45A 3K04A 4X8AA 5AQXA 3H45C 3OTOK 4FZYA 3TGUH 4KI6A 2GBZA 4L87A 2H89A 1VF6C 2QWNA 1KUQA 4GB34 1NGDA 1C0MA 3RTVA 1TL3A 4JKFA 2DYSB 5LL6Z 1NWKA 3BP8A 4JK9A 4CECA 2KKZA 2DQ3A 4JKGA 3SBTA 1NH2D 1YITN 3ZMUA 4JRQA 2P9LA 3L2QA 5B5EZ 5LY3A 3J81O 2WLMA 2DFHA 1RUC4 1JFFB 4N21A 1H2MA 4PKGA 3WXJA 5BR8B 4OLBA 4JRPA 1N32B 1NBMG 3WXLA 4KHWA 2IVOA 4IHJA 4LFBO 3OHRA 3EFFK 4BE0A 2VG5A 4M41A 1N34K 1D8YA 2YNGA 4DTJA 2D0PA 2D2CB 2PI4A 2Q0AA 1CLQA 1YJNV 1YJ9V 3OR6C 2O8DB 4TV8B 4GNIA 2RE2A 2L35A 4DSIA 5I9EB 2XY5A 4B9QA 5CN0A 1YEWA 1QVFU 4X1KA 4X65O 2FBVA 2KQ2A 4L8JA 2ZT9B 1K9MO 4LSLA 2G8WA 4CFBA 3KKSA 5L3EA 4B3OA 1BI4B 4BRCA 1XUQA 1IBLK 3O8MA 3S41A 1BEV4 3CSXA 4DV0B 3HM9A 4X88A 2XY7A 1G15A 1LV5A 4B9SA 4Q4V4 4UB8Z 2NRWA 2W41A 3P3NA 3A5OC 5EU7A 3GQHA 2RPIA 4J80A 2A06H 5LHGA 3K57A 4FO0A 1U96A 5EK0A 1L5UA 4DUYO 4IOXA 3L0QA 3L71H 1JL1A 3LWMA 4BG8A 4C23A 4PJ0Z 2DJVA 4LF8B 4AHCA 2QM8A 2Z3YA 5AQKA 3AA2A 1T8EA 4DR3K 4KREA 2IU3A 4IEEA 3QEXA 3VOVA 1Q5OA 5HP1A 3F5WC 1NJIO 4LBEC 2QWLA 4RW6A 3E66A 3D2EA 4M3XA 1E4GT 3A0BZ 1NQTA 3KLHA 5H2FZ 1LW0A 2QA4N 3SQ0A 5LP6B 2QKKA 3KK2A 3OEEG 5IWAB 1CZAN 4CZFA 2E74B 5F2VO 4BQLA 3ZX2A 1Q90D 1MOFA 3ZX0A 3QO5A 4TSFG 2Q3SA 1U49A 1YVWA 1YJWV 2I5JA 4BR4A 4C1NK 2XAFA 2WQYA 1Q86O 5AQRA 1VK0A 3AEBA 2JS3A 3G71N 5BR8O 3C6HA 4CEFA 2KG7A 1N32O 3EY1A 3ICXA 1JOYA 2HHHK 1QE1A 3WXIA 3J7AU 3ITHA 1RUH4 2D0OA 2LW7A 3KD5E 1NTMH 4DSEA 3WB1A 3ABMB 1BISA 1DLBA 1S3JA 2MK3A 5KQ8A 3P4PA 3K9KA 4DV4K 1WNSA 1ASUA 3SDLA 2JEUA 3RWUA 2XAHA 3V9SA 2F4VB 2Q69A 1AR1B 3ZHUA 1GOBA 1FK9A 1H2KA 1HNIA 3E01A 3AY9A 4YSXA 4BGBA 4BC4A 1GLAG 4OLAA 3A2FA 5LXTA 2JJ2G 4DQSA 1NVPD 2QWOB 4LH4A 2X6BA 3VF6A 5AQJA 3OYDA 2O4GA 4OX9K 5LHIA 2DWEC 4QOZB 2RS54 4R8CA 3SYAA 4BWJA 1VSMA 5BRFA 2B76A 4DV5K 5LL6Y 4LF8O 4OGCA 1XMQK 2EULA 1COV4 1NBWA 1TAQA 5DK5A 3OGIB 3K5OA 5JWPA 1FJGO 3DMJA 3TTCA 4DTSA 2RCVA 2JDIG 4P9PA 4WCEL 5LGNA 4YOVA 4ZI7A 2ASOA 4IT5A 3CC7N 4DMNA 3G80A 4CGFA 1VQ8V 4DG1A 4WFFA 4KB0A 3VEYA 3I8DA 1Z05A 1H2NA 3AECA 4CJSA 3CCEN 3ETQA 4IOCL 3AVCA 1NT2B 1X9JA 3S3OA 4M7XA 1NK9A 4FJ8A 4K43A 3AG1B 5C93A 4O5FA 3D3QA 2NN4A 2WA3A 3QG5A 5EBMC 5BRHA 2B5UA 3AG4B 1SL1A 4J2AA 1N34B 3MCPA 4FWRA 4JI2K 1JPXA 3SQ2A 3AE8A 1NEKA 2Y1IA 1H2GA 3JARA 2DOSA 1M1KO 3W3DA 2NRXA 5J9PC 4RUFA 2F4VO 1OV9A 2K9PA 2UU9K 3MDSA 4X1KB 1YT3A 4LP8A 3H1QA 3DXMA 1VQMN 4D6TH 1S72V 4F4KA 4DO2A 1I5XA 2ZNIA 4GX0A 3VEXA 4ZTJA 2HMIA 3M6GA 1WAFA 1RT7A 1P4RA 3K5LA 3IFRA 2LO1A 3N4QA 5KMGB 4JTDB 3UKMA 4A5AA 1ZL8B 3OYIA 1LAWA 2YHWA 3ZT0A 2RDCA 3GE1A 3AVAA 3QBWA 3JD1A 4OKKA 3PLAA 4Y0WA 1YSCA 5KHGA 5HRRA 4GKJK 5EX5A 1SQFA 5EYPB 2X0LA 4J9YB 4IGGA 5CA3A 1HNWB 2P4KA 4U3JA 3MN9A 4ZHRA 4JI4K 3T1HK 3DLRA 2NNUA 3CC4N 4MO5A 3MEEA 2IM9A 4F2SA 4ILGB 4KH4A 3E35A 4DV7B 2IDOA 3ZMZA 1KLMA 1QVGU 2BTQA 2X6NA 4C8OA 1OCCC 1IURA 4FM0A 4FL9A 2YIBD 4CW7B 3O9QA 1MZEA 1FFXA 2WLKA 4CK1A 3J8F4 5KHJA 1QLEB 2V7YA 5TKWA 2HHVA 3T1YK 1DEJA 1HMVA 3CFOA 1VQNN 1RP3B 2EIKB 2ZM6K 1QR8A 3LDEA 1K8KA 3AEAA 4PA1A 4H5WA 4B9NA 1XNRK 2OIGA 2F1MA 2IVNA 4O44A 4I5SA 1DTQA 3KZIZ 1ZX3A 2HBJA 3K3WA 1BT8A 3OT7A 3F7VC 1OCOC 1FPOA 1Z2GA 2XY8A 3SAHA 1JCFA 3EXAA 1T6DA 4YJ2A 3AE4A 2G8IA 4RAIA 1N34O 3T69A 3PSIA 1NMNA 4JAVA 3VENA 4HVJA 2IJHA 3E2EA 4JI3K 3UKRA 3AO3A 1CXUA 3HKDB 5AQNA 3CMAV 3CCUN 3CCQV 3N4PA 1XNQO 2YI9A 1HNXK 1EAH4 1N4CA 4UCVA 5CA1A 2YHBA 4CHZA 4A5BA 5JMVA 3QEVA 1L3VA 2EIMB 3TSUA 2JGDA 3D2FA 1HNZB 5AZIA 5LXTB 1V55B 3OEHG 4ZHQA 4BDPA 2B1GA 1RGIA 3ETDA 1A5XA 3A5MC 3VERA 3RYCA 4DFMA 3VQYA 4CGIA 1MA1A 2NUBA 1HNWO 1KAXA 2HBKA 4CZGA 1RHI4 1SS3A 4H0YB 3KKRA 5ADXH 1ZBSA 3O5BA 3AVGA 5KQDA 2VQEB 4AQYB 2GTDA 5E26A 3V4IA 4DV7O 3K2PA 3O9UA 1N33K 2NZTA 1KVAA 2E5LB 4M3UA 4J2DA 4CJ7A 4PKIA 4FYDA 2RJZA 4C8MA 1GLDG 3LWLA 2YKMA 1R6NA 3B4SA 2PFUA 4JAXA 4JI7B 4QNHB 5LOVA 2YXHA 5I42A 1IJJA 1N36K 4PQUA 5FRNA 5J2NA 5JVDB 4CGDA 3CM5A 3LM2A 1T44A 3HOTA 4JTAB 2M6YA 1G1XB 2BANA 4O4LA 3L4QA 3VQPA 4BRQA 3H1LH 4QE7A 1GKFA 1BIUA 1J9AA 5BREA 5CY4A 3R65A 1IXMA 2ZDIA 3UT5B 1A5WA 3HVRA 4YNQA 4DV2K 3SAFA 2RS14 5LMNK 1XL6A 1HYZA 3K0DA 1JCGA 3QINA 4DR7K 4JYYA 4NTWA 2P9SA 3MN7A 2HBMA 4KI4A 2BSKA 3P39A 4GV6A 2VG6A 4CC5A 4FWOA 4CJVA 3QNEA 1RBSA 2FXUA 1DTTA 3UM7A 4DXWA 3DRPA 1YDXA 5F1XA 2FL4A 2IH3C 1RDWX 3CCJV 4DS4A 1VQ4N 1JJ2M 2Y48A 3QF7A 1HNZO 4JI1K 3LAKA 1XUPO 4HTLA 4X1YB 4M45A 3HVTA 3CPWM 2N04A 5C12A 4LNUA 3AO1A 1RUF4 3I55V 4EZ6A 2YS8A 4LF5B 1SL2A 1WSFA 4H13B 3DJCA 2VQFK 1ZAUA 4YSZA 1VSIA 2IC3A 2DPNA 4WFAV 2VQEO 4AQYO 2H88A 1I94K 1PL4A 2PI5A 1LOTB 4ISFA 4CZEA 5KGXA 2F7TA 2E5LO 3LP1A 5KPZA 4JS5A 3C6UA 2KFZA 1ORQC 4E7JA 1Z7S4 3K03A 4JI7O 1B92A 1K97A 1NVPB 4E7IA 4M3ZA 2FF3B 1EBOA 3E9OA 1K8AO 1PV0A 2QM7A 4CIFA 3TR8A 1E79G 1H8EG 2XY6A 4BY9C 3B8MA 2EIJC 2NRTA 3NBPA 2EHGA 3SBGA 1IBKB 4UV9A 1KQSM 2FBYA 3L4IA 5FL7G 5J2UA 2HWC4 1NTKH 1AJQA 2OTJN 2EZOA 2AZ0A 1U04A 4FLWA 4MVOA 4OJRA 2V7QG 3SI6A 4J11A 3RGBA 1C0FA 4A59A 1A5VA 5IJ0B 3KG2A 1YXQA 1GLJO 1VQKV 3CCLN 4JI6K 3FB7C 2E1ZA 3LDSA 2JJ1G 4O2AB 1ZTEA 1L0VA 4JYAO 3HR0A 4CJFA 3ZETA 3T7ZA 3VQ5A 4MSWC 4LFAO 2PLV4 3SYPA 2GDSA 2WLIA 2QEXN 1ZC6A 2F8TA 1U45A 4XDJA 5CA1B 4CBWA 2F93B 4KKOA 5FNVB 1V4SA 3P4IA 1MG1A 3MX2A 3MXMA 4Q4W4 2X6SA 4CH3A 2CDYA 4A2BA 2Q7HA 2ZIOA 4PDWD 4F3OA 4CVNE 4FOEA 4LF7K 1YQ4A 1FXKC 2DMXA 3TCUA 4ZHQB 3RRHA 3BFRA 4ZBMA 2VRZA 3PIPL 3VQ6A 2UXNA 2BTFA 5BZBA 1YF2A 2EINB 4LF5O 1UPGA 5CBHA 3NH2A 1B3QA 3MXIA 1ZUQA 2Q0RA 3VQBA 3G25A 4K42A 1TKDA 1IG9A 1TVKA 1NGGA 4GV9A 4C8KA 3ASOC 1BGYH 2LFRA 3FAVB 3OR7C 1BWFO 1NGEA 1J54A 3K79A 3L2WA 3CD6N 4AF1A 1SUQA 5BMVB 4ABMA 2WS3A 3OYBA 2CE4A 2HVKC 3W7XA 4MQ3A 1B9DA 1ZSPA 5FRMA 4YOYA 5DM6V 2BTOA 2WSSG 4DV3B 4PL8A 1VQLN 2Y69B 1POV0 3ZCCA 4I2QA 1RBVA 2O8FB 4DR4K 4P2ZA 2FBXA 2QWMA 3CCRV 2F8SA 1VF5B 5KRTA 4Z4EA 1XBLA 1S76D 3KK3A 3SYQA 1RDBA 3GG4A 3BY6A 2BSKB 1RTHA 3MHHC 4IOAL 1R3IC 5ELZA 3QDKA 4LC1A 5B66Z 1BQZA 2P9KA 3UE5A 4OXSA 3RMCA 3VF2A 3CPEA 1BIZA 3NVKA 2ZE2A 2Z1HA 4IJAA 3AO2A 5HL7L 1KVCA 1KRPA 1V54B 1U4BA 2QXLA 1SKVA 1D2DA 3ULEA 4O8UA 1BCCH 4DV1K 3PY8A 4KFBA 5ITZA 2OCCB 1XILA 1Y97A 3J80O 3BHPA 5B3SC 5J1EA 2P4VA 2OANA 4JN4A 3CJHA 4A61A 1I3AA 5B8HA 1P49A 4DCHA 4WFGA 4LCUC 1YI2V 1K92A 1XMOB 1G99A 2XRIA 3SJQC 4RW8A 2UUCB 5BR9A 3A5NC 1OH8A 4DSJA 4KTQA 3AAQA 1XL4A 4J7KA 2ZCEA 2E75B 4B1ZA 4JS4A 3VQ9A 2HHUA 3SYCA 4JD2B 3JASB 4GV3A 4Z2WA 3BF3A 3WQTA 4G1QA 5B1AC 5AJ3K 1VQ7N 2Y0IA 3STLC 4QS7A 4EEQA 4NCBA 4K3AA 1NU1H 4K0KO 1GOAA 3M99B 3DLGA 5GAHP 5HBMA 5GONA 4IYHA 3AG2B 3E86A 5AQMA 1ZBUA 1GN4A 3CFPA 4YXDA 2W0FC 2P1JA 3N2KB 4BDZA 2YSUB 4CHPA 3H1JH 4WQ5A 1ZLZA 1VRTA 4DV3O 5J2UB 4PHTX 4R5PA 3OAAG 3NGYA 3QETA 5BRDA 4YSYA 2ITCC 3A0HZ 4JI0K 1RTJA 4MLEA 4MVRA 1BHBA 3THOA 3V1OA 4D7SA 1Q7YO 4IO8A 4CZIA 4DQIA 4YIPA 5FPOA 2LGWA 1TK8A 1NK0A 1NGFA 3WT0A 1KB9F 2HVHA 1AR64 1EETA 4A62A 1OCRC 2QWPA 2WWWA 4QAGA 4CF1A 3K06A 1Z26A 1RDCA 4R79A 4KHNA 3OTFA 3SPZA 3J7AP 1Q9XA 1FYJA 3KKYA 3SV4A 4I4TB 3ZT1A 3RW0A 4YXWG 3MEGA 4NXNB 2WDVA 2QSAA 2RN9A 1VSLA 3AAPA 4FPPA 4FCYA 2ZIMA 2BGGA 2EX3A 1O9HA 1HRV4 1OH6A 2Y0PA 4K35A 4EFHA 5H6QA 2ZKOA 1M90O 3AK3A 1IKWA 1N6QA 3HBTA 4JF3A 2NRVA 1EWRA 1L3TA 1RUE4 3RVYA 1Y6XA 4PDRA 4CHQA 1BL8A 5CR4A 2BOCC 3IFXA 1JFFA 2UUCO 3ZX3A 2FSNA 4LD0A 4FLYA 1L3SA 4LWSB 3JD74 1P7BA 1QNMA 3DXRB 4U7OA 1AR5A 1K4CC 2KW4A 1RUG4 5DECA 3ZHSA 2VGNA 4JI5K 4LFBK 1FKOA 2W6JG 3FB5C 2K1EA 3NF6A 1VQPN 2O8DA 1R73A 2ASPA 1ZBLA 2WDQA 4A5UB 3HM8A 4EZ9A 1OCZB 3ZIAG 3VBBA 3CJ1A 4DR6B 3D36A 4BRMA 2YNHA 5CB4B 1NU0A 3T3FA 3TAGA 3BEXA 2PYLA 4FJGA 4X65K 2P9PA 3LDOA 1S1VA 5M1PA 2QJ1A 4BR9A 5IYCO 3VQDA 3E8BA 3DM2A 2G8HA 1BUPA 2X6AA 4I9LA 1HPZA 4X20B 3DLEA 1ZOYA 1TKTA 1ATRA 2WOMA 4W4LA 5EIBC 1K34A 3CB2A 4ZOLA 2P9KB 3D6RA 4WFBV 3JALB 5C8YA 1IG8A 3TWHA 4DUYK 4HUEA 2HHTA 2P9UA 3R1XA 1NS1A 3SMPA 4NXNO 3C7NB 1J5EO 4KO0A 5EVZA 4DTNA 1SZTA 3ABUA 3CCVN 1TYQB 3A0IX 4K25A 4O4HA 4KXRA 3NGIA 4FM2A 3NF8A 1BU6O 1NGHA 3RYIB 5AG2A 1ASJ4 2OCEA 5GIPA 4IIJA 1TGOA 1XREA 2Q31A 4LSNA 3VQEA 2IBZH 2ZD9A 4L3QA 4CJUA 4CD1A 4J2BA 3OYCA 4RQFA 4OVLA 1VSDA 2CGKA 3HKCA 2YV0X 1F23A 3IDHA 3AE2A 3JXUA 4BVOA 3CCSV 1DLOA 1QQNA 5BR8K 2QK9A 1HDJA 2VWJA 1P8ZA 2YEVA 3NR7A 4CH4A 4B1UB 5FLXO 1D9FA 3SUCA 4BAYA 5IE9A 1N8RW 3WG7B 3T1YO 3WU2Z 1WOQA 4BR5A 4DUZK 5IT9N 2LFSA 3SFEA 1B06A 4MVUA 1CZBA 2UXDK 2XOKG 4DR6O 4X66B 1BCMA 3THYB 3QLHA 3H1HH 3JSLA 5LP6C 3H1VX 3TANA 4DQPA 3QIPA 3G4SV 1I7FA 5EZYA 5B1BC 4UCSA 3O4NA 4E4EA 3VQ4A 2BCCH 4ILHA 4IZ9A 3SZ2A 4FJKA 1RVF4 3MAQA 2QWOA 2IAJA 3FI7A 4F9OA 4M3RA 4UCOA 3OYNA 2AA4A 4UY8O 2ETNA 1DF5A 3CE2A 5JLHA 3FZKA 1RBUA 2HF4A 2DYRB 4DLEA 2L6LA 4KFMA 5JCOA 1NK5A 4FLVA 3TXQA 1JKHA 4WQ4C 2BUPA 4U3FH 3K58A 1Q82W 2YIDA 1S1XA 4WF9V 2FKXA 1JLEA 1K4DC 2OZSA 1YTUA 4DR1K 4LF8K 4BC3A 1VBE4 1VBD4 4YORA 2B4JA 1QVFM 3OYJA 3VETA 3L75H 2NRZA 1X9MA 1ZP0A 1QS4A 3O08A 4UVCA 3EL2A 1FJGK 4XDLA 2ZR2A 2KQXA 1NGAA 4JKHA 3CRMA 4LR3A 2RMKB 1YIJV 2CTQA 3AV9A 4B9VA 2PF4E 1AR4A 4PUOA 1KECA 1GLEG 4MDBA 3H46O 3ZEDA 1NK8A 4FVUA 4IL6Z 4B1WB 3QERA 4GCZA 1X9WA 5JCOC 3C95A 3G6EV 3VPZA 4AHVA 4CK2A 3Q7CA 3UCSC 3L9DA 2D4WA 4ICGA 2ODMA 5KAFZ 1BDGA 5EXWA 3E9LA 3SQ4A 2O8BB 1LW2A 2UXCB 1GLFO 4UCTA 1I0HA 5C15A 1AR84 4X66O 1NGJA 3UB5A 3VRBA 3VEWA 3KLGA 1K5MD 1H8HG 4B3RB 1X4TA 4PDVA 5M1QA 4DQRA 3IGAC 4EP4A 4LF4K 4ID5A 2IW5A 5KAIZ 2P9PB 1SZXA 3APQA 3E8FA 5KMGA 1ZL8A 5L3CA 1XWLA 2E1YA 4AM7A 5M1NA 5SWMA 4TV9A 5FLXN 4KHPB 3E22B 4D7TA 2A1RA 1QQCA 3WNEA 1RT3A 3CQYA 5EYPA 1JR9A 1JXBA 5TKYA 3H1IH 2J4RA 1SERA 4BREA 1NJWA 4KUMA 2FBWA 1XQ8A 2A79B 1M56C 4I7ZB 2IU0A 2HNYA 4EHTA 1K5SA 4O8KA 1ILYA 4NCAA 1M93A 3ZSQA 4ZOLB 2XAGA 2B6AA 4PI2A 5C8YB 3LZIA 4ZTFA 2B5JA 3HKBB 4HNAA 2P9UB 4DF8A 1QSSA 3VESA 1ATNA 3EEQA 3S3NA 4DB3A 1L3UA 1VIBA 4H0OA 3M1FA 4JEPA 1YITV 4KHSA 3LPTA 4O4HB 1U97A 2WLJA 3HB3B 5KLVH 3LP2A 1GTOA 4I2PA 3DTUB 4XBFA 4BW9A 1LUWA 4IIJB 5A9GA 4YHHB 3HSTB 4FWLA 4FOIA 4OPKA 3JSMA 2HR3A 5CHIA 2DTUA 1BCOA 2P90A 1X9SA 2OPRA 3CXCU 2HHQA 1VSJA 3HKCB 3Q4HA 2P67A 2RHKA 3SUNA 4ELTA 3F9KA 2AXTZ 4E7LA 3HXMA 3PN1A 5BXZA 2LSNA 3GBTA 3L2UA 4KX6A 3VQQA 3AE7A 2YEVB 1SQBH 4KV8A 2Q5ZA 1I08A 1XHXA 4DR2B 1C1CA 4BWMA 2P51A 1GLBG 5B1NA 2Q1NA 4BWAA 2UXCO 4IDKA 3HKDA 4DSKA 2QTSA 2IJJA 5C24A 4B3RO 3J7YP 3O9TA 1JJOA 4W5TA 3IUCA 4CFAA 4DHYA 4BRPA 4DR5B 2R9IA 1XNQK 5EZYB 4NYFA 4DV0O 1N5YA 4I9WA 1KVBA 2Q67A 1RTDA 4IWVA 4LFCK 1SQGA 4KHPO 3QFUA 2PUSA 2DW4A 3D3IA 4ICLA 1SS6A 2ZWHA 1AL24 4OGEA 4YTMA 1Z6RA 4I9QA 1GAXA 3MN5A 4BW5A 4O2BB 4DSLA 1PO14 1YZBA 4FJMA 2QTDA 2QA4V 3ABKC 1IBLB 4PA4A 2ACZA 5DN6G 1S5HC 4Q4Y4 1EN6A 3RVZA 4FK4A 2FC0A 4CJEA 1HLUA 4MDAA 3FGUA 4GYCB 2IS3A 4JZ2A 4IG0A 3M8SA 4H5NA 5IWAO 4NLBA 3NE6A 1S72N 1WA8B 4YHHO 3G71V 1Q81O 2EIMC 3FFQA 5E84A 1P84F 3HI0A 5JVDA 2E8AA 3ISNC 3JS6A 3LAMA 2DWDC 2QWRB 2P5OA 4BRNA 1V55C 4DRXA 5J2PA 2HLDG 5IDJA 1DF4A 4B1YB 4DR3B 1WAZA 1OZ0A 2X7RB 2QXFA 4BG9A 3NGZA 3UT5A 1NTZH 4NKGB 1KLNA 1Q6UA 4NYKA 3LDQA 5KRSA 3P32A 1QSLA 3U0ZA 4DSFA 4RW9A 1IV0A 1V9PA 4DR2O 1KBHA 1B9FA 3A5LC 3VF4A 3T4ZA 3BA8A 3T4DA 3QESA 1QVGM 4Q0BA 2R72A 1SV5A 3ENHA 5HROA 2PAVA 1NA1D 1ZBFA 4KTWA 3CP1A 2HOEA 1R6KA 1CPYA 1CEZA 1M57B 5LHHA 2F95B 1JVMA 2HHHB 4CJRA 3ABLB 4DR5O 4GVMA 1LCUA 1OH7A 1S6PA 1WUAA 4DV6K 5DM6L 1QLNA 1H8TD 4H37A 4TV9B 4X1YA 4H8KA 4BC2A 3MDQA 4Q5VA 1SETA 4GKKB 4CS4A 4GVEA 3ZSYA 2OIEA 4QS9A 5AQVA 4NLCA 1IZ3A 2Q7EA 3P1GA 1EZJA 1MABG 4GX5A 5HLFA 2YX6A 3DRRA 3PIOL 1PP9H 1TUUA 1Y74B 1G8MA 3CC7V 4HNAB 4YTNA 4ILJA 2PTMA 3GB7C 3P38A 2YICA 1YXBA 2EJ7A 3AA5X 2JS5A 4CHYA 3HKEB 5T7BA 1RPOA 3ZRWB 4OX9B 5LGTA 2FSKA 2ZD1A 3B6OA 1ITGA 4C8NA 3THXA 3T1CA 3TABA 3CCEV 1R3JC 2ZE8A 3R8EA 2V1DA 1SKSA 3OYGA 4X64K 2RQ6A 4FJ7A 4DV5B 2PY5A 1KMIZ 3ZHQA 3MWPA 4XEIA 4UQGA 1VQON 1ATSA 4Z94A 2AP1A 1BS3A 4DR3O 2BE3A 1QHTA 3TK1A 3Q4HB 1IKYA 1F4MA 1GN2A 1F7YA 4LH7A 1CXQA 3CJCA 4Y1DA 4F6RA 2HWB4 5IJ0A 3KK1A 3U3YA 4W5QA 4M42A 3I5DA 3M8AA 4O2AA 2Y4UA 1KYOF 1VQMV 3O4QA 1WP8A 1IKXA 1RCHA 3X2QB 3FLCO 3F7YC 4UVBA 5CA0B 4FJIA 1JCHA 3RYFB 4JYAK 1VBB4 4FZ1A 4AM6A 5F0XA 1VQ6N 4LFAK 4CESA 2HHHO 2N05A 5FNVA 3ZMSA 3BZCA 4HCCA 3ZT4A 3PV8A 2ZQMA 4TWKA 3V1RA 4CF9A 3K9JA 5GTHZ 3CMEN 1EZVH 2IH1C 3OS2A 3O9OA 5JH7B 1HJRA 3BUZB 2QKSA 1XHZA 3ASNB 2ADQB 2PGGA 4H0XB 1IBMK 3ZRVA 2E2NA 4GKKO 1URFA 3QEIA 1NK4A 1Q81W 1E1RG 3SGIA 1W0KG 2OPPA 1BMFG 1GN3A 4HHTA 4I50B 5IY5C 3KK7A 4LY7A 4LF5K 3V6DA 1SL0A 4FLTA 2PBDA 2XT9A 1IDSA 1BHLA 3M8RA 3FAVA 1NJZA 2H3GX 3RRGA 2P5GA 4CGGA 4LF6B 1VQNV 4DTMA 1RBTA 5BMVA 4RCHA 5EY4A 1K33A 1JXEA 2ZJRL 4GKJB 2GUZB 1W0JG 2UUAB 2EILC 3SMSA 1YHQN 3T1HB 4DV5O 1TV6A 4B08A 4DW1A 4DRXB 1SQKA 3FB6C 4X62B 3ZLJA 3CEIA 2O8FA 3HPOA 2JWLA 4IKFA 1COWG 1RT6A 1R3KC 1WSGA 4IO9L 1NZ6A 4HTUA 3ZHVA 1LAVA 2HBLA 3SJBC 1KP3A 4ASUG 1UWBA 3CCUV 2YIBA 3LDPA 4ID1A 3C6TA 3VGKA 5MLCQ 2RM24 4MT8A 1RUI4 5AQWA 4BRDA 4UCUA 2XUMA 3K9SA 2FSJA 1R1BA 3OBYA 1VRH4 1D5NA 1S9EA 4IFEA 2ZM6B 1S6QA 3ALYA 3JCZA 4RW4A 1W7AA 2IGIA 4Y1CA 3AVNA 1XNRB 2OPSA 1W59A 2CAZC 4ZKIA 2XNDG 4B3TK 3RYHB 4BR6A 1KD1W 4R50A 3IG1A 2UUBB 3V9ZA 4DYLA 5L3GA 2M7WA 1Y67A 3A8YA 2C2AA 1HKGA 3O80A 3B40A 4U67L 5FPDA 3NHGA 3SPGA 5AFUA 1D4XA 2ITDC 2XAJA 1NOZA 3E8HA 1BQNA 3UKUB 3L3VA 3RSEB 5FPNA 4Q4X4 2LW1A 2ZDIC 3UIQA 3P30A 5EC2C 1KU9A 1J95A 1HNXB 4JKBA 5I3UA 1ZXOA 3AA3A 3SV3A 2UXBK 3NXSA 3IRXA 2ITGA 4DFPA 1RT2A 1XDCA 3KHYA 2Q8VA 4JD2A 3JASA 4YFUA 5GTIZ 1W0HA 4LF6O 3JD0A 4FJLA 2H94A 4EKWA 1HQUA 3GDQA 4CEEA 3G67A 5JVGL 2FYUH 2GEMA 3MMVA 4GKJO 3Q7BA 2HHXA 3VTIA 1SKRA 3CRRA 4GZRB 2UUAO 3THXB 1OVQA 1EV14 1E1QG 1VBC4 4QCLA 5HFLA 3P31A 2O8CB 3T1HO 4H5RA 2A40A 3N2KA 3NDKA 3DLHA 3T2MA 1T03A 4K0KK 3O6WA 4FK0A 3LDCA 2OCCC 2E6MA 1NR1A 4N56A 4X62O 2E6LA 1VSFA 1N33B 3CI5A 1UFIA 3G6BA 1BQ0A 4IFYA 1N0JA 1F51A 2OCHA 4NR1A 4UFZA 4JAUA 4H5TA 1TL1A 4DV3K 3VA3A 4FW1A 4JNEA 4UVAA 4QPKA 4F6RB 5AZJB 3A8TA 3U8XA 3ULDA 3VR8A 2ZXWB 1YUWA 2R70A 3E83A 4JI8B 1WLEA 4B8AB 5HRNA 1N36B 2CTPA 1BG3A 2GUIA 4CHNA 1HJOA 2YCHA 2R064 1JQ0A 2ZM6O 3E8GA 3WUHA 2PYJA 4B3SK 3KIOA 2P6JA 1VQ4V 1XNRO 1EN5A 4WFNL 3OMIB 4JAAA 1NGCA 4XH4A 1JJ2U 4I4TA 2E4LA 4B3MB 3F73A 2Y1JA 3DGEA 2UUBO 4EAHD 2I7PA 2Q0UA 4CJWA 1TAUA 3ZSWA 2ZINA 3CPWU 3LM9A 3CIRA 4NXMB 4MW3A 4J7ZA 5LMNB 4H0LB 4DR7B 3APOA 5L3FA 2MW2B 1AILA 1U2VB 5FPMA 4IDHA 1HR0B 4C8LA 1US6A 3EYZA 2Q4PA 3FYEB 4FK5C 5KX5B 2RMU4 3FKSG 2HP8A 3H1KH 5C25A 1T7PA 1RUD4 3B6PA 3LDLA 1GRJA 4BRKA 4I55B 1M5IA 1HNXO 4IYIA 1KAZA 3ZSRA 3AE9A 4KH6A 3L2RA 4LWSA 1FKAO 3GVMA 3CQ8A 3DXRA 4JYBA 1RNHA 4ISEA 1YAGA 2XTAA 2YHXA 3OMNB 3BAAA 4JI1B 4B8CA 1O9GA 3CETA 4QJFB 2OZMA 1PM9A 1HQEA 3ZRSA 4CH5A 3OFNG 4MVQA 1Y66A 2OTJV 1MSWD 1K3EA 1X3MA 1RTIA 2VCPA 4KHYA 3VEOA 2VQFB 5LYJA 2BH1A 2Q36A 1PIV4 5K1XA 1HP8A 1EXQA 2GV9A 3B77A 1IBKO 1EM1A 1NM1A 3OVNA 5CB4A 5GADP 3QFPA 1AP5A 2CTRA 3M7MX 2FLOA 1FXVA 4BE2A 1N33O 3CCLV 3I56N 2HNDA 3QO9A 4CFCA 4O55A 1VQ5V 2DE0X 4DLGA 2E2OA 4Q6GA 4BDYA 3IAYA 3VQ7A 4X20A 2ARHA 1UOCA 2KLAA 2WBNA 4GX1A 1YI2N 2QEXV 5AQTA 4JI8O 3PO4A 2R9RB 1R3LC 1N36O 1NGBA 1SRYA 4KPYA 5FROA 4DTXA 2DFFA 1P90A 4Z1VA 1C0GA 1O13A 2DFEA 4CJKA 3LZJA 3JALA 2P9NB 1NI8A 5E1AC 3NFAA 3CC2N 4YY3B 2DY4A 3HL8A 4KAZA 1NKDA 4B3MO 1R094 3C7NA 2LP7A 1R0AA 2O8EA 4TQFA 4MW8A 3BA9A 5LMNO 4NXMO 1RBRA 1TYQA 3VQWA 1C1BA 2D0AA 4RTFD 1MSDA 4NXNK 4QIWF 1J5EK 3RYIA 1ZWIC 1HR0O 3V9WA 2Z1JA 3E1YA 2DN9A 3H3OB 4JLHA 4X89A 2QE7G 1GLCG 4CCHA 3SJJA 3CJ7A 3A0RA 4GY2B 3D7EO 3ZRXA 3ASMA 3CD6V 2GUPA 3FYIB 1MWMA 3JAMO 4FJ9A 4MS2A 3CHXA 2XHBA 3OM3B 5EIBD 1EQYA 2RKIA 4CS3A 3J7ZO 2RNBA 4JI1O 3SLCA 4E7HA 4KB1A 3W7SA 4CI6A 1OHHG 1LWCA 3VQCA 4O5BA 2EIJB 1HNVA 3U3GA 2O4IA 2E3CA 4I0XB 4DS5A 4MLHA 4M63C 3QBXA 1Z5VA 1WB8A 3KCYA 1VQLV 2VQFO 3CERA 4OKJA 4YDUA 2YXYA 3SPHA 5LA6B 4BACA 3THYA 3B8AX 4CF8A 2VWKA 1W2BU 3CCMN 1AR74 1Y4MA 4DR6K 5IYBO 1WJZA 2P06A 3SNNA 4BE1A 5JJNB 1MZFA 3KTQA 3L74H 4CZKA 3CFRA 4NTXA 1N8RO 4FZ0A 2AW9A 2G8FA 4TT3G 3SPCA 1YF5L 2ZNJA 3NH1A 1RDAA 2JIZG 4BIZA 3AGKA 4BR2A 1H2SB 4DTRA 3TAPA 3FB8C 4H44B 4YY3O 1BA0A 3KD1E 2CH6A 4TUYA 1HKBA 3MD0A 5SZTA 4DR4B 2ZE5A 4I7FA 3GL1A 2RN2A 1HWYA 1FXKB 4BRGA 1AI5A 4DF4A 1EFRG 3LNNA 3QO7A 3TU5A 3I0SA 1D5AA 4WQ5C 3OGCC 2R9AA 3U10A 2KZZA 3RWRD 2G38A 5D5PA 3KVGA 3OYLA 5IT9O 1RT4A 1O1WA 2KKWA 1IKVA 1LUVA 2VG7A 4PY5A 1XMOO 1Q82O 4MVSA 1Q18A 2A0LA 1JLQA 4CZLA 4CZZA 3ASOB 3AK2A 3JSNA 1VQ7V 1OH5A 3CS5A 3VN5A 2OYQA 1TVRA 4CK3A 5AQOA 4YOXA 4QPJA 5EBLC 4FFKA 2FF6A 2OTLN 2YUAA 1B6QA 3TAEA 4X1IB 4FW2A 3JCUZ 3CJAA 2VS0A 1X3NA 2ETJA 2O8BA 2QDOA 3ATVA 3ZN0A 2WLNA 1DT9A 5LYJB 2F23A 1L1FA 3LDNA 3WB0A 1NKBA 4H03B 3RMBA 2ASMA 5M1KA 3JAMN 5H5NA 2DYSC 3AO4A 3QICA 4X66K 2CK3G 5AQYA 1E3MA 3MX5A 3WQUA 1AI4A 2P22C 2WC9A 3E22A 2LGQA 2KTQA 2JWKA 4RQEA 3WFVA 4CEQA 1RDDA 4CGJA 1XEQA 1WN7A 5DEDA 3P4RA 4DQ8A 1NKEA 5LJWA 4CJ4A 5J2MA 2KFNA 1WPBA 4FLUA 4M7YA 4Z4CA 1QTMA 5CZ2A 3HKBA 3ZHTA 2Q7GA 3BRCA 4DR4O 4E1MA 3R6MA 3N27A 3HYFA 3IC7A 2HW3A 2R044 2O8EB 3NAEA 1QR9A 3D36C 5HRSA 2JRIA 2FBTA 5AQLA 2BOBC 2NLJC 2QR4A 3EZ5A 1Y76A 2ZGZA 1Q9YA 4JKEA 1R59O 1KFSA 3G4SN 3LSSA 1MMMA 5C2DA 3LSUA 5LJVA 4DKWA 1HX1A 4BQZA 1N0NA 3AVBA 4PKHA 1KAYA 3V81A 4PDLA 2NRRA 3O4WA 2X78A 3HP9A 3LL3A 3QMLA 4EHUA 1D4M4 1NGIA 2WLLB 5EBWC 1VQPV 2ATKC 1EWQA 3IKMA 4JHDA 4JV5B 2V52B 1N32K 4MTGA 5GAGP 5C10A 2QKCA 3OW2U 3PO5A 4GT1A 1DKGD 1JMKC 1I5YA 3DSQA 3ETGA 4OGQB 3F9MA 1VSHA 3T19A 4JTCB 1EX4A 3P4QA 3JYTA 2VGMA 3OYFA 2ADPA 3CRQA 5A2QO 3DLLL 4U7BA 5M1OA 3EVKA 3WB2A 4B3RK 1NR7A 4RG8A 4FJ5A 1K73W 3CXHF 1EN4A 5M1FA 3VGMA 2PW9A 4JI5B 5JS1A 4DV0K 2D3OW 1X1PA 1OCRB 4X9QA 1HUXA 2HJDA 1WAJA 2QWQA 1S5LZ 2B9ZA 3JATB 3DXKA 4KHPK 3O9RA 5CBFA 2BDPA 1A32A 3K0SA 1GM8A 3OJUA 4WE1A 4O2BA 3VEVA 4KL1A 4LF9B 3CCVV 3BABA 3ABMC 5AQFA 3ZEUB 5BN8A 1S1WA 4X65B 1VF6A 4FFBB 1YJNN 4TUYB 2F9TA 2QW9A 1YJ9N 3CRCA 3QEPA 3GQKA 2A41A 1SA0B 1ESVA 5D5QA 1VQ9V 2JK5C 5H9CA 4E19A 2A7WA 4CEDA 3C3TA 1WA8A 4FJCC 2D0CA 3TXSA 1RM1B 2FB5A 4R6ZA 4I6MB 4FLZA 4R7CA 2YNIA 4NYNA 3OY9A 1MA9B 2Q2RA 4OPJA 2QWRA 3MWTA 5IWAK 4N41A 4IJNA 2YDEA 2CGLA 3ZMVA 2AGAA 3SJCC 2ATQA 1XOUA 4AI8A 1S22A 1ASVA 3CJ9A 3SUOA 1NLVA 1WB7A 2LQTA 3TAMA 4RWTA 4NTYA 4JV5O 3LANA 1QQOA 1J53A 3AVJA 1TA8A 4WBNA 2UXXA 3BVOA 5IJ9B 3MHSC 2EWSA 3M5RA 3QIOA 4MTXA 3AG3B 4KBOA 3DOKA 4FJNA 5BPMA 4DR2K 4ELVA 3WNHA 1ZBHA 3JAKB 2NRHA 3P5JA 2IJIA 2F4VK 3ZMTA 3AARA 2QM4A 1VHXA 4CEZA 1REVA 3FFKB 2Q68A 3TI0A 3ZX6A 4AHUA 4JI5O 2W6KA 2W40A 4DR5K 4B9UA 3NF9A 3O3HA 4PD4F 1YJWN 4DUZB 3UO3A 3CXCM 3FD9A 5JJEB 1T5EA 3CWBH 1YTFD 2UXDB 3ZBHA 5LMUB 3AG1C 4F3TA 4UCRA 1NMDA 1TAEA 3HP6A 4BIUA 4LF9O 1VF7A 3AG4C 1JLFA 2Q6AA 5KHHA 4YJ3B 4YT0A 5A2QN 4O4JA 1Y74A 2GWKA 2E20A 4DQQA 1NNEA 4JYCA 3PX0A 5C0YA 3H01A 2WU2A 3NCIA 1SKWA 3HKEA 3ZRWA 3FFIA 3K59A 4JK8A 3AEEA 1M57C 2EJRA 3SFDA 2A5XA 1Y76B 3E9PA 4GX2A 3F5TA 3ABLC 5AQHA 3HPHA 3TSQA 4N5SA 4CE9A 3ZT3A 1M4UA 3RFRA 3S3XA 5FPEA 3O1WA 4W5RA 3S3MA 4B1VA 5J2TB 3CRAA 4DR1B 3KWIA 3NH0A 4HBNA 3OTOB 4WFAL 1AR94 4EB6B 5IYDO 5EOYA 4JHDB 2EBOA 2GELA 2YNFA 3OMAB 1FJGB 3OS0A 2H3OA 2Z1GA 5CA0A 2H8PC 4RW7A 3VR9A 3ZHRA 2CH7B 2A3ZA 1GM9A 2XASA 3RYFA 2JLEA 5K14A 5B1BB 1JLAA 4G9ZA 1KF6A 4ZIBA 5JQGB 4GMJB 1QLEC 3IMXA 3QEWA 4MTFA 2UYTA 3GOIA 5JVHL 4BC5A 3BPZA 2LJ2A 2EIKC 3KLIA 3TTFA 5JH7A 1VQ8N 5KPTA 1QHAA 2GTSA 4DUZO 5JLFA 3DYAA 1T6CA 3OYHA 1JL2A 2QWQB 2KB1A 3DXKB 2JVDA 2UXDO 3LP0A 5LMUO 4TSXA 4CJLA 4FK2A 3JAWA 3THWB 1FXHA 3AA4A 4GKKK 4I50A 2QI2A 4FWQA 4E1JA 4LF4B 1HNWK 1IH7A 1RFYA 1WP7A 2AHYA 3C90A 3J81N 1TUYA 3DC6A 3PJSK 3X2QC 1TUBB 3TJTA 3WEEA 1C6VA 2G8KA 1DTOA 1ZBIA 1V4TA 5LGUA 4RWUA 1GOCA 4DV7K 4N47A 3CM6A 4CIGA 2P9IA 1B04A 2GUZA 3ML0A 4W4KA 1WSEA 5IYZB 4V19S 1AP6A 2OT5A 4OKEA 3JYCA 5AQGA 1RT1A 1UAXA 3AVLA 3CQXA 2WU5A 4CF2A 3TTDA 3ASNC 5AFUH 4B1XB 1HXS4 4OPHA 3CYOA 3IJ4A 4JK7A 4DR1O 4N23A 4G28B 3OTOO 4CEAA 4YTPA 4F6EA 3KCXA 2YHYA 3JD2A 1TKZA 4WBNB 3O3FA 4CH6A 4CF0A 2QWNB 1XC9A 4A2AA 1SQXH 4LH6A 2IJKA 2P7TC 3AVMA 4RO2A 4K8XA 1KKDA 4FVMA 3RYHA 4JKGB 3L73H 3VQ8A 1WBDA 4G2KA 1RUJ4 2P9LB 1Q3EA 3L6QA 1YTAA 2WONA 3H3NO 1K9MW 4J10A 3VOUA 1YQ3A 1DGKN 1BOTO 3GWOA 4IHJB 3TPQA 2IIRA 2D0BA 5B1OA 3UKUA 1M56B 1WLJA 5BPNA 1RMU4 4NVPA 4DV4B 3RSEA 4MFBA 1HNZK 5BY1A 1P7GA 4YOWA 1NJXA 3RN4A 3LDDA 2DQ0A 4NCGA 4LF4O 2QKBA 1FAFA 1KD1O 5J2QA 4E2LA 2EZPA 4PV1B 4Q20A 1IBLO 1XNQB 1T3VA 5LBQA 3ENBA 3KWGA 4O4JB 2HEPA 3VQVA 2ZJQL 2VQEK 4LFCB 4AQYK 2Q0OC 5TISZ 1VEWA 1NKCA 2HJFC 3GWKC 1NJIW 3FE1A 3CMAN 3CCQN 2E5LK 1R084 1H1VA 4LF6K 4CBUA 3ID8A 2XO7A 2O8CA 2G8VA 3TAQA 4DTOA 1KSPA 1KFDA 4JI7K 1VSKA 3O3GA 3ZJZA 2UUAK 4F4LA 4E89A 2GX9A 5C42A 1PVC4 4J2EA 2Q9LA 1PKXA 3JD4A 3L70H 3P3PA 1K7DA 3N2GA 1SC5B 2F66C 1XMQB 3FZFA 4CIEA 2NLXA 1XI1A 1S77D 4CHOA 5KTQA 1Q86W 4X62K 4PA6A 1QQMA 4H0TB 5AZJA 5K1PA 1JCEA 5KGWA 2R7YA 3THVA 2WFBA 2Z0AA
chains in the Genus database with same CATH topology
4HCBA 3U6FA 3SCXA 3OYMA 3PX6A 1YVUA 2A1SA 2AJQA 4FZXC 4FZZA 4N76A 3WNGA 3OJSA 1RILA 2HVIA 4CEBA 4E0DA 1S1TA 3AVKA 4JI2B 5KX5A 1VRUA 1DGSA 2UU9B 4DWIA 3JAWB 4I55A 3U11A 3LP3A 3CYMA 3QNOA 3AVIA 4DV6B 5KHKA 4F8RA 1LWFA 4AH9A 4O0IA 3SUQA 3HO1A 1Q8IA 4EFEA 3K5NA 4CJPA 3S9HA 4JI4B 4E1NA 3AVHA 4Z4FA 4DU4A 1IO2A 1BQMA 2HHSA 4HUFA 1Q43A 4B9MA 2R7FA 4X64B 4ZI7B 3RR8A 4FM1A 3CG7A 3H08A 3QTCA 4Z0UA 4EFBA 3L2VA 1NK7A 2Z1IA 1BGXT 2OA8A 1JLBA 1NOYA 4JI3B 4IG3A 3SYZA 4M3TA 4JYAB 3VA0A 1I39A 3JARB 4LFAB 3ZCMA 1EP4A 2IOCA 3RR7A 1IBMB 1TK5A 5LA6A 1RSOA 4AHSA 4AILC 4U3JB 3ZSZA 1WSIA 3N2GB 4DU1A 1RT5A 3T1AA 4CJQA 3LALA 2F96A 1KCFA 4KHQA 1FKPA 3VQAA 2BTQB 1FFXB 4EP5A 1L8DA 1U47A 3V9XA 1C0UA 4FJXA 4PWDA 1Z5WA 4DFMA 3L3UA 3ZS8C 4DV2B 3WNFA 1S1UA 3DLBA 4YJ2B 2YI8A 2OPQA 2YKNA 5FPRA 4B3TB 1EKEA 4XIUA 3DRSA 3DI6A 1HYSA 1W9HA 5CYMA 4X1IA 5JJJB 1NJYA 3QNNA 1HW7A 4CJ5A 1TK0A 3RYCB 2HHWA 3OS1A 3TARA 1I94B 2UXBB 4IFVA 4DK1A 3KLFA 1UA1A 2YIAA 3AO5A 3SQ1A 3MXJA 2HB5A 3BDPA 4K0KB 1S5JA 5LOVB 1WSHA 3L8BA 2ZQBA 1NK6A 4O4LB 3AVFA 4JI6B 4DK0A 4O0JA 2G8UA 3K5MA 4AHTA 4Z4GA 3MECA 4B3SB 3HK2A 3RMDA 4KRFA 1UA0A 3ZSOA 4CEOA 3HT3A 3SJAC 2HNZA 2W42A 3OYEA 4K8ZA 1Z25A 3PUFA 4LF7B 1C0TA 4ELUA 4AHRA 4LNUB 1TKXA 3OYAA 4LH5A 4DU3A 1G6UA 4F2RA 4CJTA 2KZMA 3HPGA 4H4OA 3JATA 5KHIA 3KJVA 1U48A 3SPYA 1KTQA 4B9LA 4DTPA 4FFBA 5JS2A 3HJFA 3UQ8A 4GLXA 1SA0A 5E41A 5D3GA 4B9TA 1FXXA 2YHAA 2PZSA 4DFJA 3ZT2A 4O4IA 3P83D 4FJJA 4DV1B 1LWEA 1BL3A 4O4GA 1J5EB 5IJ9A 1J5OA 3TAFA 4PI0A 3C94A 4L8RB 4Z4HA 1JLGA 4Z4IA 3JAKA 4TOIA 4CS2A 3KLEA 1QSYA 4CGHA 4HUGA 2BE2A 1TVKB 5KI6A 1ZYQA 1K6YA 3ZSVA 3T1YB 1VSEA 4TV8A 3M8PA 4DTUA 4YJ3A 4KHUA 3DOLA 5DMRA 3ZSXA 4JI0B 3MEDA 1T05A 1BI4A 3SR2C 4FXDA 1WSJA 3D0PA 3V9UA 2X74A 1F21A 5HRPA 2D5RA 4M3WA 5J2TA 1HRHA 4EB6A 3RMAA 4TQDA 3G0ZA 5LP6A 1C1AA 4CC6A 5ITZB 4PHZA 3BGRA 2OWOA 3M8QA 2V4DA 1JLCA 4IBNA 4M3YA 5JQGA 3LPUA 3NF7A 1D9DA 1HYVA 3G10A 2YXLA 4W5OA 3SUPA 4GW6A 5CYQA 4LFBB 3I0RA 1S9GA 1CZ9A 3VQXA 4FLXA 5GONB 1MU2A 4E7KA 1TUBA 4E3SA 4H4MA 2RF2A 4FJHA 4CJ3A 5IYZA 3DLKA 1ASWA 3PX4A 4CERA 3IS9A 4W5NA 5CZ1A 4CFDA 3OYKA 5FDLA 4DUYB 2JGUA 3B2EE 4O4IB 3V1QA 4KTZA 3D45A 4FZYA 4KI6A 2GBZA 1C0MA 3RTVA 1TL3A 4CECA 4JRQA 3L2QA 2DFHA 1JFFB 4OLBA 5BR8B 4JRPA 1N32B 4KHWA 4IHJA 4BE0A 2VG5A 4M41A 1D8YA 2YNGA 4DTJA 2Q0AA 1CLQA 4TV8B 4DSIA 2XY5A 1YEWA 2FBVA 4X1KA 2KQ2A 4L8JA 4LSLA 2G8WA 4CFBA 3KKSA 4B3OA 1BI4B 3CSXA 3HM9A 4DV0B 2XY7A 1G15A 1LV5A 4B9SA 5EU7A 2RPIA 3K57A 1L5UA 1JL1A 3LWMA 4LF8B 4AHCA 3AA2A 1T8EA 4KREA 5HP1A 3QEXA 1Q5OA 4RW6A 4M3XA 3KLHA 3SQ0A 1LW0A 5LP6B 2QKKA 3KK2A 5IWAB 1U49A 2Q3SA 2I5JA 1VK0A 4CEFA 3EY1A 3ICXA 1QE1A 3ITHA 3KD5E 4DSEA 3WB1A 1BISA 1WNSA 1ASUA 3RWUA 3V9SA 2F4VB 1GOBA 1FK9A 1HNIA 3E01A 4OLAA 3A2FA 5LXTA 4DQSA 4LH4A 3OYDA 2O4GA 4QOZB 4BWJA 1VSMA 4OGCA 1TAQA 5DK5A 3K5OA 3DMJA 4DTSA 4ZI7A 4DMNA 4CGFA 4DG1A 4KB0A 3I8DA 4CJSA 3ETQA 3AVCA 1NT2B 3S3OA 1NK9A 4FJ8A 3QG5A 1SL1A 4J2AA 1N34B 3SQ2A 2Y1IA 3JARA 4X1KB 1YT3A 4F4KA 2ZNIA 4ZTJA 2HMIA 1WAFA 1RT7A 3K5LA 5KMGB 3OYIA 1LAWA 3ZT0A 3AVAA 4OKKA 5KHGA 5HRRA 1SQFA 5EYPB 1HNWB 4U3JA 4ZHRA 3DLRA 3MEEA 2IM9A 4F2SA 4DV7B 2IDOA 1KLMA 2BTQA 2X6NA 4C8OA 4FM0A 2YIBD 1FFXA 4CK1A 5KHJA 2HHVA 1HMVA 3CFOA 4PA1A 4B9NA 2F1MA 4O44A 1DTQA 2XY8A 4YJ2A 2G8IA 4HVJA 3AO3A 1CXUA 3HKDB 2YI9A 4UCVA 5CA1A 2YHBA 4CHZA 3QEVA 1L3VA 1HNZB 5LXTB 4ZHQA 4BDPA 1A5XA 3RYCA 3VQYA 4CGIA 2NUBA 3KKRA 3AVGA 2VQEB 4AQYB 3V4IA 3K2PA 1KVAA 2E5LB 4M3UA 4J2DA 4FYDA 2RJZA 4C8MA 3LWLA 2YKMA 4JI7B 5LOVA 5I42A 4PQUA 5FRNA 5J2NA 5JVDB 4CGDA 3CM5A 2BANA 4O4LA 3VQPA 1BIUA 1J9AA 5CY4A 3UT5B 1A5WA 3HVRA 4YNQA 1HYZA 3QINA 4KI4A 2VG6A 4CC5A 4CJVA 1RBSA 1DTTA 3DRPA 4DS4A 3QF7A 3LAKA 4X1YB 4M45A 3HVTA 4LNUA 3AO1A 4EZ6A 4LF5B 1SL2A 1WSFA 1ZAUA 1VSIA 2IC3A 5KGXA 3LP1A 4JS5A 3C6UA 2KFZA 4E7JA 1B92A 4E7IA 4M3ZA 4CIFA 3TR8A 2XY6A 3NBPA 2EHGA 1IBKB 2FBYA 5J2UA 1U04A 4FLWA 4OJRA 3SI6A 3RGBA 1A5VA 5IJ0B 3LDSA 4O2AB 4CJFA 3VQ5A 2F8TA 1U45A 5CA1B 2F93B 4KKOA 5FNVB 3MXMA 2X6SA 4CH3A 2Q7HA 2ZIOA 4F3OA 4ZHQB 3RRHA 3VQ6A 3NH2A 3MXIA 3VQBA 1TKDA 1IG9A 1TVKA 4C8KA 1J54A 3L2WA 1SUQA 5BMVB 3OYBA 4MQ3A 1B9DA 5FRMA 2BTOA 4DV3B 4I2QA 1RBVA 2FBXA 2F8SA 5KRTA 4Z4EA 3KK3A 1RDBA 1RTHA 3RMCA 1BIZA 2ZE2A 2Z1HA 3AO2A 1KVCA 1KRPA 1U4BA 1SKVA 3PY8A 4KFBA 5ITZA 1Y97A 3BHPA 5J1EA 1I3AA 1P49A 1XMOB 2XRIA 4RW8A 2UUCB 4DSJA 4KTQA 2ZCEA 4JS4A 3VQ9A 2HHUA 3JASB 4G1QA 4EEQA 4NCBA 1GOAA 3DLGA 5HBMA 5GONA 1ZBUA 3CFPA 2P1JA 3N2KB 4BDZA 4CHPA 4R5PA 1VRTA 5J2UB 3NGYA 3QETA 1RTJA 3THOA 3V1OA 4D7SA 4DQIA 5FPOA 1TK8A 1NK0A 2HVHA 1EETA 4QAGA 4CF1A 1Z26A 1RDCA 4KHNA 3OTFA 3SPZA 1Q9XA 3SV4A 4I4TB 3ZT1A 3MEGA 4NXNB 1VSLA 4FCYA 2ZIMA 2BGGA 2EX3A 1O9HA 1IKWA 1N6QA 1L3TA 4CHQA 1JFFA 4LD0A 4FLYA 1L3SA 2KW4A 1FKOA 3NF6A 1ZBLA 4EZ9A 4DR6B 2YNHA 5CB4B 3T3FA 3TAGA 2PYLA 4FJGA 1S1VA 2G8HA 2QJ1A 3VQDA 3DM2A 4I9LA 1HPZA 4X20B 3DLEA 1TKTA 2WOMA 5EIBC 3CB2A 4ZOLA 3JALB 5C8YA 3TWHA 2HHTA 4HUEA 4KO0A 4DTNA 4O4HA 3NGIA 4FM2A 3NF8A 3RYIB 4IIJA 1TGOA 4LSNA 3VQEA 4CJUA 4J2BA 3OYCA 4OVLA 1VSDA 3HKCA 2YV0X 1DLOA 2QK9A 2VWJA 4CH4A 1D9FA 1CZBA 4X66B 1BCMA 3QLHA 3JSLA 5LP6C 3TANA 4DQPA 3QIPA 1I7FA 5EZYA 3O4NA 4UCSA 3VQ4A 3SZ2A 4FJKA 3MAQA 2IAJA 3FI7A 4M3RA 4UCOA 3OYNA 1RBUA 4DLEA 5JCOA 1NK5A 4FLVA 1JKHA 3K58A 1S1XA 1JLEA 2OZSA 1YTUA 2B4JA 3OYJA 1X9MA 1QS4A 4LR3A 3AV9A 4B9VA 4PUOA 1NK8A 3ZEDA 3QERA 1X9WA 5JCOC 3C95A 4AHVA 4CK2A 3SQ4A 1LW2A 2UXCB 4UCTA 3KLGA 4B3RB 1X4TA 4DQRA 4EP4A 4ID5A 5KMGA 1XWLA 5SWMA 4TV9A 4KHPB 3E22B 4D7TA 2A1RA 1QQCA 3WNEA 1RT3A 5EYPA 1JXBA 1NJWA 1XQ8A 2HNYA 4NCAA 1M93A 3ZSQA 4ZOLB 2B6AA 4PI2A 5C8YB 3LZIA 4ZTFA 2B5JA 3HKBB 4HNAA 4DF8A 1QSSA 3S3NA 1L3UA 4KHSA 3LPTA 4O4HB 3LP2A 4I2PA 4BW9A 4YHHB 3JSMA 4IIJB 4OPKA 3HSTB 2DTUA 1BCOA 1X9SA 2OPRA 2HHQA 1VSJA 3HKCB 3SUNA 4ELTA 3F9KA 3HXMA 3PN1A 3L2UA 2LSNA 3VQQA 4KV8A 1XHXA 4DR2B 1C1CA 4BWMA 2P51A 4BWAA 4IDKA 3HKDA 4DSKA 5C24A 1JJOA 4W5TA 4CFAA 4DR5B 5EZYB 4NYFA 1N5YA 1KVBA 1RTDA 1SQGA 2PUSA 4ICLA 4OGEA 4I9QA 4DSLA 4O2BB 4FJMA 1IBLB 4FK4A 2FC0A 4CJEA 4GYCB 2IS3A 3M8SA 4IG0A 3NE6A 3FFQA 5JVDA 3ISNC 3LAMA 2P5OA 4DRXA 5J2PA 4DR3B 2QXFA 3NGZA 3UT5A 1KLNA 5KRSA 1QSLA 3U0ZA 4DSFA 4RW9A 1V9PA 1B9FA 3BA8A 3QESA 4Q0BA 2R72A 1SV5A 5HROA 1ZBFA 4KTWA 2F95B 2HHHB 4CJRA 4GVMA 1S6PA 4TV9B 4X1YA 4H8KA 4Q5VA 4GKKB 4CS4A 3ZSYA 2Q7EA 3P1GA 5HLFA 3DRRA 4HNAB 2PTMA 5T7BA 3AA5X 4CHYA 2JS5A 4E7LA 3HKEB 4OX9B 4C8NA 3B6OA 2ZD1A 1ITGA 3TABA 1SKSA 3OYGA 4FJ7A 2RQ6A 4DV5B 2PY5A 1KMIZ 4UQGA 1QHTA 1IKYA 4LH7A 1CXQA 4Y1DA 4F6RA 5IJ0A 3KK1A 3U3YA 4W5QA 4M42A 4O2AA 3O4QA 1IKXA 1RCHA 5CA0B 4FJIA 3RYFB 4CESA 5FNVA 4HCCA 3ZT4A 3PV8A 3V1RA 4CF9A 3OS2A 5JH7B 1HJRA 1XHZA 2PGGA 3QEIA 1NK4A 3SGIA 2OPPA 4HHTA 4I50B 4LY7A 3V6DA 1SL0A 4FLTA 1BHLA