2PZSA

Phi29 dna polymerase complexed with primer-template dna (post-translocation binary complex)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTAC)-3'
total genus 165
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pzsA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pzsA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pzsA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pzsA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pzsA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pzsA06
4CJRA 3O3FA 5J1EA 4ICLA 1BISA 2HB5A 2RN2A 4J2BA 4FK0A 3LZJA 4Z4FA 1C1BA 1RDAA 1WSHA 3WNHA 3SUNA 3WNEA 3SQ2A 3OY9A 2X6SA 2HHVA 2OZMA 5CY4A 5T7BA 3OJSA 3AVJA 1BI4B 2IS3A 4CHZA 1RT1A 5HLFA 1KRPA 3AVHA 3TAMA 3ZCMA 4DMNA 2RPIA 3L2VA 1ASWA 4W5RA 4CEFA 1KCFA 2D5RA 1NK0A 1J5OA 1D9FA 4FXDA 5FROA 3M8SA 2XHBA 2EX3A 5J2MA 1BIZA 3PX4A 1IKWA 4RW4A 3U3YA 4N41A 3PX0A 3T3FA 4O4GA 1NOYA 2VWKA 2ZD1A 4JRPA 4JS4A 4DS5A 4FLYA 3OS0A 2Y1JA 1VSLA 1S1UA 1KFDA 4LD0A 3NHGA 1Y97A 4KB0A 3TANA 3QEPA 3NGIA 3V6DA 4DFPA 3SPZA 3K59A 1B9DA 2VG6A 3TABA 3M8RA 4OVLA 4E0DA 3MAQA 2GUIA 4KHSA 4PA1A 3OYGA 4E3SA 1JKHA 2GBZA 3HXMA 3K5NA 4K8ZA 4N56A 3AVGA 4M45A 1Q9XA 4B9UA 2IDOA 1QSSA 2YKNA 2X6NA 4DFKA 1S5JA 2ATQA 3L2RA 1IKVA 1Q9YA 4N76A 4E89A 2D0CA 1YTUA 2HNZA 4NYNA 3ZT2A 3THVA 3JYTA 4B8CA 3ITHA 3VQ8A 3AVCA 5HRRA 3OYCA 2X74A 5C42A 4FCYA 3MXIA 2P51A 3OYNA 4F2SA 3VA3A 4M3ZA 1VRUA 3LWMA 1Z25A 4CEBA 3CFPA 4Q0BA 4KFBA 3ZSYA 4CF1A 1L3TA 4OJRA 4DFMA 3ZSRA 4KTQA 4RW6A 1BQMA 3NF6A 1VSMA 4CGFA 3TI0A 4DSLA 4CEZA 1DTQA 1FK9A 3DLEA 4FM1A 4H4OA 4RW8A 4CHPA 2XY5A 5E41A 4FW2A 3TAEA 3I0SA 4OPKA 3B6OA 1W9HA 4ID5A 1TV6A 3O4NA 3L8BA 4DFJA 4AH9A 2DFEA 4BDZA 3SJJA 4B8AB 1VSIA 2IAJA 3WNGA 1U45A 3KD5E 4ELVA 4M42A 3HPGA 4UQGA 2RKIA 2Z1GA 4BACA 4DU3A 2OPRA 1O1WA 2Z1IA 4DTJA 3V9XA 4CJPA 3NH1A 3S3MA 3ZSVA 4CIGA 3OYAA 2Y1IA 3OYMA 2ZE2A 1RILA 5KGXA 3P5JA 1NK9A 3ALYA 1KLMA 1U47A 1J9AA 3ISNC 4CGIA 1W0HA 2KTQA 1BCMA 3VA0A 4BE0A 3L3UA 1TL3A 3HVTA 4EZ9A 4NCAA 3DRPA 3V1QA 3G10A 4FW1A 3ZSWA 1RTJA 3OS1A 1RT7A 1TGOA 3L2QA 3OYKA 4FK2A 1YVUA 4OKJA 1RDBA 1TVRA 4M3WA 1C1CA 1BCOA 5DMRA 1VSJA 4LY7A 1UAXA 3TAFA 4HCBA 3QLHA 1X9SA 3HPHA 1QS4A 1CZBA 4AHCA 5KRTA 4HTUA 4M3XA 1RNHA 3MEEA 2KW4A 1U4BA 1HNVA 3KK1A 4IDKA 2O4GA 5CYMA 4B9TA 2WOMA 3AVIA 4DLGA 1SKSA 3HVRA 3ULDA 4GW6A 4CJSA 3NF9A 4DF8A 4FJIA 2B5JA 3EZ5A 2I5JA 2G8FA 4OGEA 4AHTA 3CG7A 3DLGA 1NK8A 4J2DA 3WNFA 1ZYQA 3V1OA 4J2EA 3K2PA 2DY4A 1CLQA 2A1SA 4FM0A 3RR7A 3LPUA 1D5AA 3PY8A 4Z4EA 3U3GA 1C0UA 3K5MA 4GMJB 3AVLA 4Z4HA 1IG9A 1SKWA 4Z0UA 3VQEA 5J2QA 4KHYA 1JLCA 3L2WA 2BDPA 4CFAA 3SQ1A 4NYFA 2XO7A 1UA1A 2IOCA 3TWHA 3RMCA 2ITGA 3BDPA 3QEIA 1S9EA 4CF0A 3M8QA 4F3OA 1RDDA 4G1QA 4KHWA 4FM2A 3VQ7A 3F73A 1C6VA 2HHSA 3LDSA 3SV3A 2B4JA 4CIEA 1RDCA 4Q5VA 3LWLA 2Q3SA 1WNSA 1I3AA 1VSKA 1UOCA 5J2NA 4FJ9A 1T05A 4DQIA 1U48A 2YKMA 3IS9A 2E4LA 3AA2A 4LH4A 3ASMA 3OYEA 2P5OA 1DTTA 3SNNA 1S6PA 4E1MA 3KLIA 2G8WA 4F2RA 1C0MA 1ZBUA 3AVAA 1BI4A 3LP1A 1VSEA 3ZT1A 5KRSA 3S9HA 4CJEA 3UIQA 1N5YA 4JS5A 1WAFA 4DQPA 4DTRA 4QCLA 5HRSA 4PY5A 1UA0A 2PW9A 1HQUA 3HL8A 1D9DA 4FLWA 1K6YA 2VG5A 4GVMA 3ZSZA 4CFCA 4BDYA 1NJYA 3I0RA 2KFNA 4AHRA 4B08A 1ITGA 1KVAA 1YTAA 3C94A 1RT4A 4KV8A 3P83D 5I3UA 3LP0A 3MEDA 1EX4A 3ZT4A 4KREA 1BIUA 3U6FA 3V81A 3VQQA 4CEDA 1IH7A 4O44A 3VQ9A 3QETA 4DF4A 3KIOA 1QQCA 2PYJA 4CEQA 4I7FA 1RBTA 1QE1A 4IG0A 2IGIA 5CZ1A 1TK0A 1SL0A 3KTQA 4KTWA 4EZ6A 2PZSA 4IFVA 3EYZA 3DLHA 1GOAA 4E7KA 2KZMA 3LAMA 2ZQBA 4O55A 1I39A 1EKEA 4CESA 3DLRA 2HNYA 2YNFA 1JXEA 4TSXA 4LH5A 5FDLA 3D0PA 3QEVA 2FC0A 3DMJA 3TAPA 2EHGA 4PQUA 2PY5A 1HYSA 4CJKA 3NGZA 3A2FA 3K5OA 2QK9A 4IBNA 5KI6A 4CJ5A 4L8RB 1TL1A 4BE1A 1KVCA 5HP1A 3TR8A 1S1WA 4HVJA 4YNQA 2W42A 4DU4A 1DLOA 1R0AA 2G8HA 2VWJA 1GOBA 4MFBA 1LWEA 2NUBA 3K5LA 3IG1A 4OKEA 3V1RA 3VQ6A 4BE2A 2HHUA 2D0AA 1A5VA 3OYLA 1G15A 4C8NA 3OYDA 3OYFA 3TARA 3AO4A 1NK7A 1LW0A 3LAKA 1WLJA 4CK3A 4DTMA 4AILC 4LSLA 4E7HA 1JL1A 3ZT3A 4E7LA 1UWBA 1JLQA 1YT3A 1WSEA 4CJVA 1C1AA 1HNIA 3KK2A 4FJNA 3SZ2A 2A1RA 2HHTA 4HUFA 3QERA 1HYVA 1JLAA 1NJWA 1RT6A 4EP5A 3SQ0A 4ID1A 4E1NA 3HT3A 3SUOA 4ZTJA 4M3YA 4Z4CA 3DOLA 2FBYA 5CZ2A 1NK4A 4DS4A 4CIFA 3PX6A 3HSTB 5EU7A 1U04A 1XI1A 2YNHA 4CECA 1NKBA 3DI6A 1KVBA 1RBRA 1TK8A 3CQ8A 3L2UA 4FJJA 5K14A 3D45A 1LWCA 4CHOA 1Z26A 2B6AA 3LALA 1TKDA 4DSJA 4O0IA 3DOKA 2OPPA 3CM6A 4O0JA 2KFZA 4FLXA 1ZBHA 3NAEA 1VSFA 1EETA 4NCBA 4FLTA 4CJLA 1F21A 4E7JA 3VQBA 4B9SA 1NKCA 3T19A 3AA3A 1S9GA 3AA5X 3VQ5A 3G0ZA 4O5BA 3QESA 1IKYA 4F3TA 2LSNA 4W5OA 4OLBA 1ZBIA 3OS2A 1LV5A 3V4IA 3CFOA 3LP2A 5HRNA 1REVA 2YHAA 3KLGA 1TKTA 2XY6A 2YNGA 3AVBA 4CJUA 4CFDA 3NFAA 3AVNA 4EP4A 4KRFA 2G8UA 2HNDA 5SZTA 1A5WA 4FLVA 2YV0X 1X9WA 4R5PA 3NE6A 1WSIA 2F8SA 4CERA 4IFYA 1LW2A 3KLFA 4HCCA 3HJFA 5HROA 4XIUA 3QNOA 1QTMA 2R7YA 4CEOA 1JLBA 4CJ4A 1ZBLA 1Q8IA 1TK5A 3ZSXA 4PWDA 2XRIA 4OPJA 4WE1A 1KTQA 1SL2A 1S1VA 1BL3A 1JLFA 4M3UA 4CGHA 4FJ7A 1KSPA 4RG8A 2OZSA 3MECA 1WSGA 4KI6A 4CGJA 3FI7A 4BWJA 4Z4IA 1ASVA 4I9QA 3DRSA 3SCXA 1T03A 2YHBA 3DLBA 1HRHA 4CJFA 4QAGA 3QEXA 1TAQA 3LPTA 4IG3A 4PUOA 1IO2A 1EP4A 2XY8A 3DRRA 2JGUA 4CEEA 3KK3A 1NK6A 3HK2A 4E19A 3H08A 4CJWA 3EY1A 2JLEA 4OGCA 3LZIA 4DTSA 4W5TA 2BANA 5I42A 4FJGA 4FK4A 3AVMA 3O3GA 5CYQA 3RRGA 3V9ZA 1N6QA 4C8LA 3HPOA 4ELTA 4FZYA 3IRXA 1HQEA 1D8YA 3OYIA 3RR8A 1A5XA 3AO1A 3TAGA 3K57A 3SI6A 2HHWA 5FRMA 2R7FA 3QEWA 1X9MA 1RBUA 3RRHA 4JRQA 2BE2A 2E6LA 4N5SA 4B3OA 4DTPA 4KHNA 5JS2A 2Z1JA 3LP3A 3MXJA 4KTZA 4CJTA 1U49A 2KZZA 4AHUA 4CCHA 1T8EA 1S1TA 3KJVA 5C25A 2FBVA 1L3VA 1JXBA 3VQPA 3QNNA 1GOCA 5SWMA 1J53A 4FJHA 5HRPA 3VN5A 2X78A 1NOZA 4CFBA 1SUQA 4CF2A 5KGWA 1C0TA 3VQAA 1QSLA 4CE9A 3AVFA 4FVMA 4B9LA 3SQ4A 1BGXT 3C6TA 1VSDA 3CFRA 1RT3A 1RT5A 5C24A 3RMBA 4FZZA 5HBMA 4ZHRA 3S3NA 3V9SA 3CYMA 1L3UA 2G8VA 2O4IA 1VK0A 3T1AA 1WAJA 1VSHA 4LSNA 4FJKA 1NK5A 2BGGA 3RWUA 4CHYA 4HUEA 2OPQA 2VG7A 2FBXA 3DM2A 5J2PA 1RBSA 4BWMA 3KLHA 4DQQA 2DFFA 3O4QA 4Y1DA 4CHQA 3FFIA 2QKKA 4B9VA 3KD1E 4KB1A 2G8IA 2F8TA 2HVHA 4IKFA 2AJQA 3RTVA 3IAYA 3I8DA 5DK5A 4CGDA 4I2PA 2HHQA 2ETJA 3OYJA 3BGRA 1LAWA 1TKXA 4CJQA 2XY7A 4E7IA 3M8PA 3SUQA 4FJ8A 4CJ3A 3AVKA 1FXXA 4NCGA 1L3SA 4FLZA 4KHQA 2WONA 1S1XA 4KHUA 4CK1A 1B9FA 3DLKA 1TKZA 4CGGA 3NCIA 3AO2A 4KAZA 3AV9A 3B6PA 4J2AA 4FYDA 4F8RA 4FJ5A 3JSMA 1WSJA 3QIPA 4I2QA 4M3RA 1J54A 4AHSA 2PYLA 4OLAA 3HP6A 3S3OA 2IC3A 1S6QA 1XWLA 3AO5A 3AO3A 3VQ4A 4DTXA 1KFSA 2G8KA 2FBTA 1VRTA 1WSFA 4CEAA 1NJXA 3QINA 4RW9A 4Z4GA 1CXUA 4DSKA 3HP9A 4DTOA 2P1JA 1QHTA 2Z1HA 3SV4A 1CXQA 4CF9A 3NH0A 2DFHA 4DTNA 3OYHA 1L5UA 1ASUA 1XHXA 3ZSQA 1RBVA 4CF8A 3SPYA 1HPZA 1SV5A 1JLGA 3QIOA 1NJZA 3NBPA 3VQCA 3C95A 1JLEA 4Y1CA 4HUGA 3NDKA 1JL2A 1X1PA 1BHLA 3DYAA 3OVNA 3TAQA 5D3GA 3ZT0A 4B9NA 2DTUA 4AHVA 2HVIA 4M3TA 3RMDA 2OA8A 1RTDA 3HYFA 3SUPA 2QKBA 5JS1A 3NF8A 4BDPA 1FKOA 3F9KA 3E01A 3HM9A 4F4KA 3LANA 4KPYA 4W5NA 2F96A 3KLEA 4DSIA 4FJXA 1MU2A 1CZ9A 3OYBA 4YFUA 1T7PA 4OKKA 2HMIA 3ZSOA 3CM5A 3SYZA 4N47A 3HO1A 1RCHA 2RF2A 4FJMA 1RT2A 1HJRA 4C8OA 4FJLA 3NGYA 1LWFA 4W5QA 4DG1A 4FZXC 2P5GA 4MQ3A 4DTUA 3P1GA 3KKRA 1WN7A 4DU1A 2QXFA 3OJUA 1BQNA 1QSYA 4DQRA 3NH2A 4B9MA 3MEGA 3PO4A 4KO0A 3QO9A 4KKOA 3V9UA 4H4MA 2OPSA 3V9WA 4ZTFA 2D0BA 3NF7A 3KKSA 1NKEA 4C8KA 1FKPA 4C8MA 4HHTA 3PO5A 4I9LA 2OYQA 3MXMA 2KQ2A 2HHXA 4DLEA 4CHNA 4M41A 4FLUA 3RMAA 3AA4A 1SL1A 5FRNA 4JLHA 1KLNA 2HW3A 1ZBFA 1B92A 4DSEA 4QOZB 4RW7A 1RTIA 1RTHA 1XHZA 1EXQA 4KI4A 3C6UA 2YNIA 1IKXA 5KTQA 3K58A 4K8XA 1HMVA 1HYZA 4ELUA 1LAVA 4H8KA 3O3HA 2GV9A 4DSFA 3PV8A 4DWIA 2E6MA 3VQDA 1TAUA 4CK2A 1XC9A 3L3VA 3PUFA 4DQSA 1SKRA
chains in the Genus database with same CATH superfamily
3O3FA 4ICLA 1BISA 4HWIA 2OTLV 2P22C 2UXCK 3EKSA 5TKYA 2WDRA 5LA6B 3OY9A 1N0JA 1HPMA 1LUWA 5CY4A 3TSQA 4JI2O 4NXMK 4DUZK 1KRPA 5HLFA 4K43A 1XNQO 1VP7A 3ZCMA 3X2QC 4DMNA 3L2VA 1K5QA 2NN4A 3APOA 3BEHA 4DV0B 4O8UA 1J5EB 2D5RA 3ENBA 2CDYA 2QXLA 2DMXA 1IKWA 4RW4A 1C0FA 3U3YA 2OTJN 4PI0A 5AQWA 5IY5C 2X6AA 3VEXA 3T3FA 3PX0A 4J7ZA 2VWKA 1NOYA 5CBFA 1VSLA 1WB8A 4MSWC 1ZUQA 5B66Z 4WYBA 4CC6A 4KB0A 3NGIA 1GK9A 1Z2GA 3VGMA 1B9DA 5LP6B 3ML0A 4GKKB 4X66B 3N4PA 3AEDA 3BZKA 4X62O 1NU1H 1K33A 2ODMA 3KCYA 4PA1A 4JNEA 1NGJA 1O9HA 4CI6A 3OT7A 2NRVA 4K8ZA 4GY2B 4N56A 4LF9B 2K1EA 2NRTA 3VQXA 4LF5O 5LGTA 1GLBG 5BY1A 1HDJA 4O4IB 2HBJA 3JARA 2X6NA 2QJ1A 1IKVA 3ZT2A 2YX6A 4B8CA 1VBA4 1NNEA 1VQMN 3AVCA 5HRRA 2W41A 3TETA 3J80N 4DR6O 5C42A 1L0LH 3OYNA 3VA3A 2X6BA 3CFPA 3E8BA 4FMTA 3P4IA 4KFBA 2CAZC 3MX5A 4ISEA 1NGBA 4DFMA 4RW6A 1BQMA 5D5PA 3TI0A 2ZDIC 3T4DA 3CJBA 3K9SA 4QIWF 4TUYA 1Y74B 1FK9A 4ZBMA 2E74B 3SJAC 3AEFA 5CB4A 2Q0UA 4FW2A 3W0LA 4BRNA 4JKAA 3SFEA 4X64O 4KBOA 3AAQA 3B6OA 4OPKA 5LMNB 1VQ6V 1SESA 3I56V 3JXUA 2HP8A 4FFKA 3HSCA 1YJ9N 4BACA 5C12A 2Z1IA 4JYAK 4DTJA 4E2LA 2A0LA 3QMLA 4G2KA 3S3MA 4G9ZA 3JD1A 2VYPA 1X3MA 4MLHA 1NK9A 1RILA 3SYCA 4YY3O 3B8AX 3P5JA 4CZFA 1KLMA 4NVPA 3TK1A 1J9AA 4CGIA 1W0HA 2IJIA 1R1BA 1GRJA 4BE0A 1TYQA 4C1NI 2CH7B 1SA0B 3E86A 4KHPB 1TL3A 2ASOA 3DRPA 1VMGA 5F2VO 3HVTA 5BREA 3PLAA 3ZSWA 1PP9H 2YXHA 3OS1A 1FXKC 4JD2A 1KB9F 5M1NA 4FK2A 3QO7A 1TVRA 2GBOA 1GLDG 1KXPA 5ITZB 5JMVA 4YHHO 1F7YA 1VSJA 4LY7A 3TAFA 4KUMA 2FKXA 5B1BB 1HNZB 3J81N 1XUQA 2WQYA 1VF6C 2JEXA 1FXKA 3K03A 1M9NA 3CCMV 4IDKA 1QQOA 4K0KK 4FWRA 1NR1A 4DR2K 3BF3A 1E3MA 4DR5K 1YUWA 4GKJK 4K0KO 4JI1B 4WBNB 2UXCO 4B1XB 1M93A 2B76A 4DV5K 4OGEA 1YVWA 4JAAA 4PDWD 3FZFA 4L8JA 5KA5A 4JV5K 4J2EA 3SAFA 3RYCB 1KU9A 1HKBA 2Q8VA 2O8CA 2F9WA 3H1KH 2R9IA 1YCIA 1ESVA 3FKSG 1ZBSA 4DHYA 4PA9A 1NGFA 2DPNA 1JLCA 3OGCC 2ZM6K 3QNEA 5GONB 4CFAA 4JYAB 1M56B 2Q73A 2WP9A 2QWNB 1P90A 2IOCA 2F4VO 1FPOA 3TWHA 2X6CA 1N33K 4AQYB 3L4IA 4GKJO 3P31A 4CF0A 1QLEB 1SKVA 3VR9A 1AVMA 4FM2A 3CMAN 2HHSA 4GKKO 4JZ2A 3LDSA 3WFVA 3RBZA 3SV3A 4ZI7A 2PAVA 3LWLA 1I3AA 5GW7A 1T05A 1U48A 3HBTA 3AE2A 2QKSA 3NXSA 3SNNA 5B1AB 2G8WA 3KLIA 3CCLV 1YJWV 3ZMTA 3H46O 1FW6A 3QB0A 2HJDA 5IJ0B 1VSEA 3A5LC 5KRSA 1ZC6A 4PL8A 3AEBA 1FJGO 2WLMA 3JAKB 3SBTA 1VQNN 1N5YA 2W6JG 1WAFA 2FBWA 4QCLA 2E2NA 2Q1NA 1K6YA 3E66A 4GVMA 4CFCA 1W7AA 3VESA 4BDYA 3AG3C 1PM9A 3AARA 3I0RA 4AHRA 1WP8A 5GAHP 1NJYA 2YS8A 1KVAA 1YTAA 1BSMA 1RT4A 1Y4MA 4KV8A 5I3UA 5BPLA 2J4RA 1BIUA 1OHHG 2Y0PA 3U6FA 3VQQA 4MVOA 4CEDA 4WFBL 4H0YB 1R3JC 4IFEA 4O44A 3H9VA 5IJ9B 4UV9A 4DR3O 3O8MA 2PYJA 1BZKA 3MD0A 2UUAO 4UB6Z 1TK0A 5C3JA 4UCUA 4KTWA 3IDHA 4DR3K 4IFVA 5AQSA 1GOAA 4E7KA 1DF4A 4K35A 5MLCQ 3WB1A 1NQTA 1QHAA 3FZHA 1UJWB 3QEVA 1YEWA 2EIMC 3CRQA 1S76D 4H13B 4LH5A 5LP6C 4BRPA 1NBMG 5BPNA 1XMQK 3K5OA 2QK9A 4J7JA 1TL1A 2H94A 4DR1K 3VOUA 3T1HO 3VF4A 4A59A 1OVYA 2A40A 1RDWX 1Q81O 4R8CA 1RM1B 1S1WA 1HKCA 4H5TA 2Q67A 4TV9B 4HVJA 4YNQA 2Q7HA 2VWJA 2LFRA 1M90W 4MFBA 1RVF4 3F5TA 3D2EA 3IG1A 4BR4A 3VQ6A 2QGNA 2V1DA 2D0AA 4O5FA 3FB5C 1G15A 3OYFA 1F23A 3OYLA 3M5RA 2KQXA 3LAKA 1GMGA 3JD74 3T1HB 2CGLA 4NO7A 2DWEC 3K06A 4OX9B 3C6AA 2ZE8A 1GLCG 1P4RA 5A2QO 4AI8A 3CMEN 5BXZA 2A1RA 4B9QA 3QERA 3HOTA 2LW7A 1T6CA 1Q7YO 3SQ0A 2XASA 3C7NB 2BSKA 3DSQA 4CZIA 3HT3A 1YIJV 4ZTJA 2UXBO 4M3YA 3J8F4 3CC2N 1NK4A 1BHBA 1N34K 4LF9K 5EU7A 1U04A 1GN6A 4JD2B 1JCEA 4OXSA 5FPMA 4CECA 2H88A 4EEQA 3SPJA 1EWRA 1Q3EA 4CHOA 3E89A 4DSJA 3JSLA 5KX5B 3CM6A 1JR9A 5LGNA 2VS0A 2ZE5A 1EETA 3T19A 2P9UA 2E8AA 4JI8K 1WUAA 3AA5X 5ADXH 4O5BA 2DYSC 3T7ZA 3THWB 1WBDA 3B8NA 2BH1A 2PTMA 4BQZA 4YOYA 3CFOA 2R70A 5J9PC 3LP2A 1Q86O 4YIPA 5H9CA 1O13A 4YTMA 2OCCB 1TKTA 2YNGA 1N33O 1NVPB 5IYBO 3CCEN 3NFAA 3AVNA 4FWOA 4IO9L 2G8UA 3Q7BA 1GLLO 3QO8A 3DXRB 3E22A 4EIAA 4JYCA 4JHDB 2YI8A 2UUCO 4CBXA 4R5PA 1X9WA 4G27B 4CERA 1LW2A 4HCCA 3HJFA 1R3KC 1BCCH 1H1VA 3ZETA 2R7YA 3AGRA 4CJ4A 5FPOA 2UU9O 5GAGP 1Z5VA 2JK5C 3DC5A 1BL3A 3G71V 3S41A 3KZIZ 2OZSA 3H1LH 4CGJA 4FJLA 3ULEA 2ARHA 3JCUZ 5L3CA 4I9QA 1G4YB 4TUYB 3ABMC 3EFFK 1CP9A 4QAGA 3CCSN 3QEXA 3AK2A 5CB4B 1MDUB 4JI0K 5L3GA 4PUOA 1COV4 5CE3A 2XY8A 1NTKH 4H44B 3WU2Z 4XEIA 2A6AA 3H08A 1P7BA 4CJWA 5E1AC 3EY1A 2O8BA 4W5TA 3OMIB 4FK4A 1EQYA 3AVMA 4C8LA 4DV4B 4H5RA 3HPOA 4ELTA 3IRXA 1HQEA 5L3FA 4DV7B 5H6RA 5KA6A 2G38A 3CJ7A 5EXWA 5FRMA 3CXCU 3QEWA 1RBUA 1YTFB 1X9MA 4H5WA 1N32B 4DV1K 4JRQA 1PNLA 2IJHA 2FF3B 5EYPA 3JALA 3P3NA 4KTZA 4FZ0A 4CJTA 4DV0K 4AHUA 4CCHA 1IBKK 1XMQO 1S1TA 3CJCA 5C25A 5KMGA 2FBVA 3VQPA 3W3DA 1AL24 5FLXO 3W7UA 1LCUA 3WQUA 1VQ4V 2NRZA 1W59A 4FIPC 2FXUA 2D0PA 3IFXA 3ZN0A 3ENOA 1RUJ4 4X66O 4CF2A 4IT5A 1C0TA 1QSLA 4O4JA 4CZHA 3RGBA 4FFBB 3AVFA 3MN5A 4FVMA 1K5SA 4KHPO 3ABLC 1D5NA 5B1NA 1S77D 1BGXT 3C6TA 1XNQK 3CFRA 1RT5A 5C24A 3RMBA 3BZCA 1WBBA 4ZHRA 4IZ9A 1RP3B 1JCGA 3CERA 4PI2A 1B6QA 4EHTA 1XEQA 5H5NA 4MS2A 4J80A 5KQDA 5CHIA 1E1QG 3G25A 3SAGA 4LSNA 1VSHA 4XBFA 5L3DA 4FJKA 4FPAA 2ZCEA 4YIOA 2LQTA 2EIKC 2VG7A 2ZGYA 3DM2A 5F0XA 3LM2A 1RBSA 5J2PA 3NR7A 4DQQA 3O4QA 1MQTD 1OOPD 3OTFA 3FFIA 3J8AA 4UVBA 4GV6A 2VRZA 4DV7K 3IAYA 1N8RW 2Q5ZA 2EIKB 4X65O 5LOVB 3KZBA 3CC7N 2Q6AA 3TXQA 1QVFM 2ADQB 1YAGA 3QFUA 1TKXA 2QA4N 4FJCC 1ZWIC 1JQ0A 3CCVN 4E7IA 2XY7A 3OW2U 3VPZA 3ZEDA 5IT9O 4JKDA 3S3WA 4CJ3A 4F6RB 3CJ9A 3O9RA 4BRAA 2DN9A 4F4LA 4DV1B 1S1XA 2WONA 4CK1A 4OGQB 4KHUA 1TKZA 1N32K 2BTFA 4CGGA 5C0YA 1GN4A 5AZJA 1N32O 2OTJV 4JI8O 3B6PA 4J2AA 2NRHA 3WG7B 4LNUB 4DR6B 1WSJA 3QIPA 1J54A 4AHSA 4JEPA 4UY8O 2IIRA 1XBLA 3AE7A 3HB3B 3AG2C 3MWTA 3RSEA 4CEAA 3OW2M 2O8EA 3QINA 4RW9A 3HP9A 2YCHA 3ASOB 2QDOA 3O08A 4FSVA 4FWMA 3OYHA 3O9SA 4UCOA 4JTDB 3TCUA 3SPYA 3P4PA 5KUKA 3QIOA 3NBPA 2V4DA 1POV0 3CHWA 3P3PA 2AHYA 3WEEB 4J41A 1JL2A 1TUBA 4JK9A 2Q97A 3DYAA 4BRIA 1NGAA 2LJ2A 3WXIA 1XDCA 2XOKG 5D3GA 2HVIA 3RMDA 1COWG 2OA8A 1RTDA 5C93A 5KLVH 5LBQA 5KAIZ 2UXDO 3F9KA 4F4KA 3LANA 4XDJA 4W5NA 3RT3C 3KLEA 4J42A 3SPCA 3ID6A 4DQ8A 3OYBA 3CM5A 1NH2D 4J8FA 4I9WA 3CCVV 1RCHA 1HJRA 3NGYA 5L3BA 1Q6HA 2FSKA 3P4SA 1E4FT 1WN7A 3AK1A 4JAUA 5FLXN 3OJUA 3MXMA 4UV8A 2AW9A 2HR3A 4DUYB 2EIMB 3PO4A 3DC6A 1NA1D 1SRYA 4LF8O 1HNWO 4UCVA 1GAXA 1VBB4 3W7WA 4I6MB 4CH3A 4YY3K 1NKEA 4HHTA 4C8MA 1AR5A 3IC9A 1MWMA 2WAMA 4LC9B 4IOAL 3SPGA 2HHXA 4GX1A 3RMAA 2Z3YA 5FRNA 2HW3A 1KLNA 4IJNA 4DSEA 1RFYA 1WAZA 4X64K 1TUEB 1U2VB 3AGKA 3B4SA 1BUPA 4K42A 4P2ZA 2KSDA 5BZBA 3I5DA 2CGKA 4WQ4C 4LF8K 1HNWK 1LAVA 3PIPL 4H8KA 4DSFA 4OX9K 2VQEB 4MO5A 1VF6A 4BRLA 4NLBA 1TAUA 2WUSA 4OX9O 4PL7A 4DQSA 3U9ZA 1K7DA 1VBC4 4LF4O 4LFBB 1JCFA 4JAVA 4QPKA 4J2BA 1KAXA 4X8AA 1Y74A 3CPWU 2RN2A 3LZJA 4FK0A 1RDAA 1VQ4N 4FFBA 5IWAB 1VRH4 5DM7L 3SQ2A 4Q4V4 1WA8A 1S72N 4JV5O 3RYFB 4NB5A 4LBEC 3OJSA 3HM8A 2E75B 2HBLA 3SYQA 4OPAA 1J95A 4X65K 4YOVA 4JI2K 3C90A 4BIOA 4DUZO 3HKBB 4NXMO 4CEFA 1NK0A 4FXDA 3GVMA 2UUBO 3TU5A 1HNXB 5FROA 4BRQA 5J2MA 2RHKA 2D3OW 1VQON 3JD4A 1KP2A 2ATKC 1K4DC 2UYTA 2ZD1A 4JRPA 3D7EO 2YIDA 5B3SB 3SPIA 1KFDA 4ICGA 5BRFA 1PKXA 1I0HA 4JI1O 3K59A 3SDLA 1NBWA 1GM9A 1AP5A 1SQPH 4E0DA 1R084 2IM9A 4E3SA 1AI6A 2Y48A 3L0QA 2GBZA 4NR1A 3K5NA 3OEEG 3AVGA 4M45A 2CK3G 2JWKA 3SR2C 3CJ1A 1QSSA 2DOSA 2QM7A 1S5JA 1YXBA 2FLOA 4H5VA 3L2RA 4N76A 4ILJA 3RYIB 5AQTA 4BW5A 4LNUA 2QTDA 4E89A 1YTUA 1Q82W 3E2EA 4B1UB 3ITHA 3AE6A 2F4VK 1NZ6A 1XNRB 2ASMA 3OYCA 1SS3A 4Y0WA 3MX2A 1HXS4 4F2SA 2O8EB 1SQGA 2FSNA 1Q86W 3VEVA 2ZXWC 3CRCA 1FAFA 3RWRD 3TSUA 2A06H 4DR5B 3CRAA 3CCEV 1VSMA 4DSLA 1ILYA 4CEZA 3JD3A 3LSQA 5EBMC 1NLVA 1WOQA 3DWLA 3THXA 1DTQA 1NTZH 4DV3K 4H4OA 4CW7B 5BR8K 3R8EA 5E41A 3VQWA 2E76B 1K73O 4CS2A 2R9AA 2P06A 2ZQMA 4BY9C 4WFFA 2RR14 2VQFB 3O4NA 4YOXA 4J11A 1ZLZA 3CXCM 4BDZA 3WG7C 1K3EA 3OTOK 1LR1A 2Y69B 4EFEA 3T1YO 2Y0IA 3LDCA 4CBUA 3FX7A 2Y4TA 3ABTA 5K1XA 3OA9A 3GQHA 4L3QA 3U11A 3NH1A 3OYAA 2JS3A 2FB5A 3OYMA 4HTLA 3CC2V 1Q90D 3ALYA 4I7ZB 4X66K 4U7OA 4YSZA 3VA0A 2GWJA 4FK5C 1G6UA 3T1HK 1YJNN 1NWKA 1D4XA 4LF9O 3AE3A 5LP6A 3V1QA 4PA3A 2VGNA 3DXKB 3G10A 1JPXA 2V7QG 3ZHUA 5KPRA 1RTJA 5FPNA 3H1QA 4BR9A 4QGPA 1KKDA 3ENHA 3ZRXA 5CA0A 1C1CA 5DMRA 2KKZA 1GN3A 1KD1W 1UAXA 4HCBA 3JYCA 4JYAO 1QZ6A 3QLHA 1X9SA 1Y6XA 5KRTA 1U97A 3BUZB 1OCZC 1RNHA 4M3XA 1H2GA 1YQ3A 4Q4Y4 3AG4C 2KW4A 2EILB 1HNVA 3KK1A 1OH6A 1D4M4 3K9JA 3FB8C 2VQEK 3AVIA 4CZZA 3I8BA 4GW6A 1DGSA 4DF8A 3THYA 1RGIA 3AE8A 2YC0A 3E8HA 2I5JA 1H38A 1S22A 2G8FA 2LP7A 1J6ZA 2JGDB 3N2KB 2LFSA 3F7YC 3H3NO 2PLV4 1CLQA 1P49A 4BRCA 2A1SA 4C23A 1PL4A 3W7TA 4YY3B 4WQ5C 3LPUA 3ULEB 3I33A 4JKCA 4GMJB 4IXCA 3P4RA 2A3ZA 2D1KA 2QWRA 3FZMA 5J2QA 3AG1C 2GEMA 3L2WA 1ZXOA 3T1YB 3UKRA 2ZE7A 1NGHA 4NYFA 4JI2B 2XO7A 2H89A 1MZFA 3RMCA 2PI4A 2ITGA 3BDPA 2WA3A 4TV9A 1RUD4 3E8FA 3RVYA 1RDDA 5JQGB 4G1QA 4LFAK 2UUCK 1HX1A 1NH2B 2B4JA 1RDCA 3H01A 4CIEA 2Q9LA 1VSKA 4FJ9A 2I7NA 4MDAA 4XH5A 5LMUO 2QM4A 5LL6Y 4M63C 1DTTA 1YITN 4FPBA 1S6PA 4NB4A 4C1NK 4BRMA 1DK1A 3LP1A 1HUXA 1S5HC 2YEVA 4CJEA 3UIQA 5JVHL 2E20A 3GE1A 3Q4HA 4DTRA 1HJOA 3A5OC 4FWLA 4R79A 5HRSA 3HL8A 1OCOC 1D2DA 4YOUA 1D9DA 4Q4X4 3ZSZA 1GO3F 4CD3A 4MTGA 2KFNA 2EJRA 1NS1A 1AR1B 4BRFA 1KBHA 2NLXA 3C94A 1K73W 4JN4A 2ITMA 4PDMA 2F1MA 3CMAV 5I9EB 4DV4K 1NGEA 3AG7A 3ZT4A 3R1XA 2MW2B 3CP1A 4CH5A 3CSXA 4MTFA 4PY5A 3A0BZ 1QQCA 1JCHA 4B1WB 2YDEA 4WBNA 4IG0A 3EN9A 3FYEB 1QQNA 4U3JB 5TKWA 3F5WC 5J2UA 1H8HG 1X3NA 2ZQBA 4CESA 1EN5A 4DUYK 1Z7S4 3DLRA 4EB6B 2FYUH 4QNHB 4Z2WA 2HNYA 2P9NB 2ZD9A 2FC0A 3W7XA 1IBMK 4O4IA 2PY5A 1S3XA 3MHHC 3O9TA 5LHHA 2Q7GA 1J5EO 4YTPA 4HAMA 5GTHZ 1BA1A 1XL6A 1US6A 4PA7A 4BE1A 1KVCA 5HP1A 2W6KA 2CTWA 2W42A 1SQXH 1DLOA 3CYOA 4E4EA 4FWPA 4B1YB 1I5YA 3UB5A 5IYZB 3LDEA 3K5LA 4OKEA 1AR94 1KUQA 3E35A 1LW0A 5HFMA 4CK3A 4CD1A 4LSLA 1R6KA 3ZMZA 2QWLA 1UWBA 4CJVA 3CWBH 4LF7K 4FJNA 1JFFA 5IYDO 5K1PA 2HHTA 4JI8B 1HYVA 3KG2A 5JJJB 3GB7C 2EINB 4JYYA 3OMAB 1JMKC 1QR9A 4LH7A 1DEJA 2V51B 1NJWA 4PKGA 4E1NA 3SUOA 3FAVA 3CCQV 2QR4A 2WLLA 4Z4CA 2FBYA 3OD4A 3GBTA 4DS4A 5KAFZ 4Z4FA 1HR0B 2P7TC 3HSTB 1XI1A 2YNHA 1NKBA 3P38A 1KVBA 1RBRA 3CJHB 1TK8A 5AQLA 3CEIA 1QVFU 3G4SV 1VAZA 3L2UA 5K14A 3H45C 3L9DA 5CA0B 1LWCA 1PPJH 3KKYA 3LALA 4UB8Z 4H03B 5JVDA 2N05A 4FLXA 2P4KA 1HWYA 1QU7A 4CJLA 4I55A 3BEXA 2PI5A 3ZYYX 4B9SA 4ISFA 4CZLA 3AA3A 1S9GA 2DWDC 1Z6RA 3K79A 3G0ZA 3P39A 3QESA 4LF8B 1HNWB 4F3TA 3CC4V 1XILA 3ZX0A 4W5OA 1LV5A 1FKAO 1E79G 2YHAA 2XY6A 4NXNB 2YHXA 4DV7O 4BW9A 3G6BA 1VQ9N 4XH1A 5SZTA 3SMPA 2KG7A 4FLVA 3VETA 3O9QA 3NE6A 1WSIA 2F8SA 3ZMSA 3HR0A 4PWDA 4LF5B 3RYHA 4CEOA 4JF3A 2UXDB 2XUMA 1Q8IA 1ZBLA 4Z1MG 2XRIA 1VQPV 2KHOA 4WE1A 1SL2A 4GX5A 1S1VA 3FYIB 2QWQB 2HHHK 4U7NA 4FJ7A 1KSPA 3RN4A 5JQGA 2HKOA 1WSGA 3FB6C 3A0HZ 3O65A 2P9KA 3ZX6A 3DRSA 2PF4E 1K5MD 3EO3A 1HRHA 4ASUG 2W6IG 1TAQA 4X89A 3LPTA 4IG3A 1IO2A 3D36A 1EP4A 1XMOB 3DRRA 3B8MA 2W0FC 3MHSC 4CEEA 3KK3A 3SJBC 3HK2A 2OIGA 2IBZH 3H1IH 1L0NH 2AHZA 3F9MA 3HPLC 1CPYA 1Z05A 4MDBA 1GLFO 4BRHA 3EEQA 4D6TH 3H6EA 3SI6A 2A79B 3CXHF 2QM1A 1AJNA 2HG5C 1WLEA 3SUCA 3RRHA 1LNQA 2JRIA 2BE2A 5AG2A 4J9ZB 4JI3O 3VF6A 4BREA 4B3RK 3I55N 1KP3A 2Z1JA 3K3WA 3MXJA 1KQSM 1QCEA 3AAPA 3KJVA 1L3VA 1JXBA 4MT8A 3UO2A 5ELZA 3QNNA 4I5SA 2K9PA 3OBWA 5SWMA 1J53A 4FJHA 5KHJA 1URFA 3VN5A 3MN9A 5FPDA 4JI3B 1KFYA 4DV2B 4CFBA 4PA6A 5KGWA 5AQPA 3VBBA 4FWNA 4CZEA 1DTOA 2ZR3A 4EB6A 5LA6A 2WTUA 3ZMVA 1VSDA 1RT3A 5KHGA 2WPDG 1VIBA 5EIBC 3ICXA 3EKUA 2G8VA 2F93B 2O4IA 4O4HA 2A5XA 5B8HA 3WUHA 2H8PC 3WXJA 4MVUA 1WAJA 3CPWM 1VQKN 2FBXA 3KLHA 3D8CA 5CBHA 4Y1DA 4NTWA 4CHQA 2QKKA 3APQA 1N8RO 4WFGA 1ATSA 5D5QA 5BMVB 4FOEA 2RS34 1QVGM 3ZRVA 4CZJA 4CGDA 2HHQA 2ETJA 3ZBHA 2UUBK 4A61A 3M8PA 4JK8A 1EBOA 1N34B 5IYCO 1NGDA 3ZS8C 3AVKA 1S3JA 4FLZA 4X20B 1B9FA 3H1JH 5CMUA 1W97L 2XAQA 2JEUA 4JZGA 3AO2A 5KHKA 3HRGA 3AV9A 4KAZA 3JARB 3T69A 2QW9A 1F51A 3TSPA 3CE2A 5KHHA 3G67A 3JSMA 4F8RA 4I2QA 2MK3A 4WFHA 4B3MK 2BCCH 4OLAA 2O8FB 3AO5A 1S6QA 1XWLA 3F2KA 3OR7C 2QWPB 1VQKV 3AO3A 5KPTA 3LDLA 5JVDB 4K0KB 1WSFA 1CXUA 3D3QA 4X1IB 4B3SO 2P1JA 5TISZ 3SMSA 3OGIB 3NH0A 4DTNA 1L5UA 1XHXA 2IVPA 4CF8A 3Q4HB 2WC9A 4NKGB 1JLGA 2ZIMA 1ROPA 3BCCH 3C3SA 3G6EV 1IBMB 1NJZA 2QI2A 4Y1CA 5M1FA 1NJIO 2WLHA 3NDKA 4GZRB 4LC1A 4B7EA 3E9OA 5KX5A 1NGIA 3CI5A 3WB2A 4X62B 3MN6A 4AM6A 3JAWB 2WDQA 4B9NA 1FFXB 4IEEA 2ZNJA 3NVMA 3ABMB 1PD3A 3LNMB 1MSWD 3NF8A 4KH5A 1NVPD 3BY6A 2ZDIA 2ZM6B 2UU9B 4PELA 1FKOA 4BC2A 4CBWA 5H2FZ 2IW5A 3X2QB 1VQ7N 3RYHB 1T7PA 2Y4UA 4DK1A 4N47A 3DXMA 2NR5A 2UUAB 1RT2A 2P9LB 4C8OA 2Y69C 4YTNA 4W5QA 1AB3A 4DG1A 4PKHA 1B06A 2P5GA 4MQ3A 4DTUA 2WLIA 3SYPA 2Q0RA 4HNAB 2QXFA 1PIV4 4RUEA 2HLDG 4OPHA 4RUFA 2P9KB 1BQNA 1QSYA 1HP8A 4B9MA 1Q7YW 4KO0A 4KXRA 1VQ8N 4P30A 2QKAA 1WP7A 4JV5B 1MMMA 2YXLA 1VQLV 3ZRWA 2Q69A 3NF7A 3R66A 3KKSA 4PV1B 2BTQA 2Q4PA 1VQLN 3PO5A 1P8ZA 4JI7K 2JGDA 1DT9A 4I0XA 5AZJB 3BHPA 5IYZA 2YICA 3EXAA 5LHGA 5IDJA 2KQ2A 4KL1A 1IG8A 3M6GA 4M41A 4CHNA 4DLEA 1SL1A 4BQLA 4YSYA 4DR5O 4ZIBA 1R73A 4J7KA 1IBLB 1ZBFA 1VBD4 4RW7A 4DV6B 2PUSA 3RYIA 1XHZA 1ATNA 5B1AC 2XAHA 2DJVA 2YNIA 4DCHA 1AI5A 3CX5F 4IGGA 5JCOC 4K8XA 4LFCO 1HYZA 2KLAA 3JBG4 4BVOA 5B1OA 3OM3B 1IVSA 3VQYA 2E5LB 3HKEA 5DM6V 2XT9A 4Q20A 3HKDB 1VQOV 5AQIA 3SLCA 3VENA 5JWPA 4CK2A 3ZIAG 3L3VA 2IJKA 2F4VB 3FLCO 2OTLN 3AG3B 1NU0A 3O5BA 3U9DA 4DR1O 1BOTO 2HB5A 3THXB 4DR4O 1YDXA 1WSHA 3KCXA 3WNHA 3J7YP 4TQFA 2NRRA 2ZF5O 3WNEA 2X6SA 3CIPA 1O9GA 1G1XB 3ASNB 3GOIA 3TPQA 3L72H 1BI4B 4DB3A 5T7BA 2IS3A 1RT1A 3TAMA 2HVKC 1V54C 1ASWA 1QQMA 4W5RA 1D9FA 1J5OA 4YHHK 5LMNK 3M8SA 2YIBD 3B09A 1BIZA 2F95B 3ZEUA 5AZIB 3ETGA 4HZ3A 4DS5A 2Y1JA 4BGBA 1KAZA 4LD0A 4CZGA 4JYBA 1B3QA 1Y97A 2AA4A 3NHGA 3CIRA 3JAKA 5BMVA 4DFPA 3SPZA 4I6MA 1CZAN 5JLHA 3N2GA 4OVLA 3MDSA 3BAAA 5IWAO 4GX2A 4X65B 1MZEA 2GUIA 5HL7L 1M57B 1JVMA 4KHSA 4ZOLA 3PIOL 3OYGA 1NJIW 3HXMA 2GDSA 2QEXN 4A2AA 1R59O 4LF4B 1MA1A 2C2AA 4B9UA 3O9OA 2IDOA 4YDUC 2QEXV 2YKNA 5HFLA 4WF9V 1W0KG 4DFKA 2ATQA 4TQDA 1Q9YA 1OH7A 1MG1A 2D0CA 4JKEA 1RPOA 2HNZA 5EOYA 1EWQA 3JYTA 1NCQD 3AE1A 4F9OA 1ATRA 3VQ8A 3CCMN 4A57A 3MXIA 4FCYA 4UUJC 5JCOA 3JASB 4M3ZA 4ABMA 1UFIA 4GKKK 1FD9A 1AP6A 1Z25A 4CEBA 3LWMA 3ZSYA 4TV8A 4CF1A 1YI2N 4OJRA 1IBKO 5IWAK 2YI9A 3ZSRA 4KTQA 1HRV4 4ZKIA 3GL1A 4R6ZA 1RUE4 4MLEA 2H3OA 4H0OA 4RAIA 4DKWA 3DLEA 4FM1A 1ZTEA 2A3QA 1KC8W 4RW8A 4CHPA 2XY5A 4PA4A 3TAEA 3JAMN 4U7BA 2UU9K 5C8YB 4TT3G 3I0SA 3RFRA 4O4LB 4IOXA 1W9HA 4KHPK 2N74A 1TV6A 1JFFB 3S3XA 3SJJA 4AH9A 2DFEA 3KD5E 1IBMO 2IAJA 3WNGA 5EZYA 3M1FA 4BG9A 3HPGA 1JX9A 5JH7B 4UQGA 4CC5A 1NMDA 2RKIA 2Z1GA 4DU3A 1O1WA 1QLEC 1HW7A 4KH6A 3WEEA 4CJPA 1YJ9V 2ZE2A 3DXMB 4QS9A 1MSDA 4DR7B 1I7FA 5GIOA 2OCCC 1U47A 4M7XA 5B3SC 1V4SA 1L1FA 1BCMA 2A41A 2X5ID 4UVCA 1KECA 3L3UA 5KMGB 1YTFD 1SQFA 2HFEC 3C7NA 5EY4A 4KFMA 2PBDA 4EZ9A 2ACZA 1VHXA 4NCAA 1FFTB 3FZLA 2L6LA 4FW1A 1RT7A 3BRCA 1TGOA 4CS4A 2P4VA 5AFUA 1YVUA 1H2NA 4GUNA 4KP4A 1RDBA 4M3WA 5CA3A 3BFRA 1BCOA 1NMNA 4LFCK 4FVUA 3ABLB 2F66C 3ABUA 1GM7A 3FFQA 4B3MB 2M7WA 4CJ7A 4EFHA 1SQKA 4JI5B 1OCOB 1CZBA 4AHCA 1YSCA 3QFPA 4A5BA 4HTUA 1I5XA 5AQKA 4EAHD 1YQ4A 1SC5B 1U4BA 2Z5UA 1Y64A 2O4GA 4WCEV 2H3GX 2WOMA 5EBWC 1SKSA 3ULDA 5ADXA 3HZ6A 2LGQA 2ZT9B 3JD0A 5J2TA 1IBKB 3EZ5A 2A7WA 1JJ2M 3R65A 3CG7A 4U3JA 3LDPA 4AHTA 2ZJQL 3WNFA 1V4TA 1NK8A 2W6LA 3EE9A 1KC8O 2A42A 4YSXA 2DY4A 3HKEB 3A8TA 4JI4K 4FM0A 3HKDA 2FTKA 3FZKA 3WT0A 1D5AA 1RUH4 2P9PB 4BR2A 3U3GA 4V19S 3HTVA 4BR5A 1BS3A 1IG9A 1SKWA 1PO24 3GWOA 2DW4A 4QJFB 2UXNA 2XNDG 1HRI4 1BGYH 4E1JA 2R064 3HKCA 1RM1C 4DR6K 1S9EA 1RFQA 4F3OA 4A5AA 3A8YA 3F73A 5AQQA 1C6VA 3SJHA 4N21A 3IGAC 2OT5A 1YHQV 2AP1A 5JICA 2E1YA 4WQ4A 1HR0O 2YKMA 4LH4A 3ASMA 1BG3A 4D7TA 1QR8A 3K0GA 2Z0AA 1PL0A 3JAWA 4IOCL 3AVAA 4BR6A 1ZBUA 1VQNV 5AQHA 2EZPA 1BEV4 1NGCA 5AQXA 1S5LZ 2YSUB 1OJHA 1XNQB 1TVKA 2LO1A 2HHHO 1OV9A 3N2GB 1UA0A 3STZC 1SAZA 3T2MA 1BT8A 2VG5A 3TXSA 2HBMA 2F7TA 3LDOA 2ZKOA 3JATB 4B08A 2RS14 2Q31A 1XMOO 3LP0A 3MEDA 3QBXA 4JKFA 4O8KA 3V81A 4HNAA 3QETA 3VQ9A 4DF4A 3CRMA 3ZLJA 3KIOA 3CETA 3A0RA 4DRXB 4FWKA 3ZX3A 4CEQA 1RBTA 1QE1A 3SJQC 2IGIA 4GT1A 5CZ1A 3KTQA 3UE5A 2GELA 2BOCC 3EYZA 3DLHA 3CD6N 2KZMA 2RE2A 4RO2A 1I39A 1V55B 2B5UA 2E2QA 2HWB4 3AECA 2YNFA 4TSXA 3PJSK 5FDLA 3TAPA 3FFKB 4PQUA 4IHJA 2P9SB 3O6WA 1ASJ4 1HYSA 3NGZA 4WCEL 1F4MA 3E1YA 4LF7B 5BPMA 4DV0O 4L8RB 1YIJN 3UO3A 5JJEB 4UVAA 2G8HA 1DLBA 3LM9A 3J81O 1ZP0A 3QVNA 1K4CC 3BPZA 1LWEA 3V1RA 3CCJN 1XNRK 2AGAA 2ILMA 2HHUA 4BWAA 4C8NA 3OYDA 2X7RB 3AO4A 3TARA 1NK7A 1WLJA 4JKGA 4DTMA 1VBE4 2I7PA 4BROA 1G8MA 4AILC 3ZHVA 2GHYA 2QTSA 3ZT3A 2B1GA 1U2VA 1JLQA 2O8FA 1YT3A 2HBKA 1E4GT 5AR0A 1TAEA 3SZ2A 4DV3B 3VEWA 4HUFA 3O1WA 3ZCCA 1YZBA 1RT6A 2RS54 4ID1A 5C2FA 1VF5B 1GTOA 4JI0B 1H2KA 1FXHA 4P9PA 1ZX3A 2UXXA 3EHBB 3D6RA 1JJOA 4CZMA 3AEAA 2L35A 4LF6O 1XNRO 3CQ8A 2KKWA 5H1SQ 4FJJA 1H8TD 3D45A 1V54B 2QKCA 4MVQA 2ZR2A 1IBLK 2KFZA 2P6JA 1ZBHA 4GKJB 3M8AA 3RYFA 3CRRA 5AQVA 5AZIA 3NAEA 4JI4O 4FLTA 4BRGA 1EAH4 1F21A 2ETNA 1XUPO 1VQ6N 3VQ5A 4O2AB 1IKYA 3E9LA 5C10A 2LSNA 1VQ8V 3CCUN 4OLBA 4H37A 3OS2A 1ZBIA 5EX5A 3AEGA 5HRNA 2WA4A 4BC3A 1QZ5A 1TUBB 1VARA 2CTRA 4CJUA 1U6ZA 4CFDA 2BE3A 3RYCA 3A0IX 3KWGA 3J7ZO 3L6QA 1Z5WA 4YORA 5M1KA 2IU3A 4GX0A 2NRXA 4IDHA 1I94K 2NNUA 3FB7C 1HLUA 2YV0X 1FJGB 3WXKA 4GVEA 2HVJC 5AFUH 4B1VA 4WFNL 1IBLO 1NR7A 5H6QA 5LMUB 5BR8O 2AZ0A 4B3SK 2JDIG 3IC7A 2IH3C 3IUCA 4O4HB 3C65A 4ZHQB 4X1KA 3OE7G 2AZ2A 3ZSXA 1KTQA 1LOTB 1BO5O 1WJZA 5CR4A 4M3UA 2CGJA 2NNWA 4RG8A 4C7UA 3MECA 2CUGA 4KI6A 3FI7A 3ETEA 4BWJA 1QBZA 3SCXA 3LDNA 1T03A 3UCSC 3DLBA 1BE3H 4CJFA 1OCCB 4H0LB 4NYKA 5AQRA 2DQ0A 2FSJA 5C8YA 4JI7O 1AJQA 1K8AW 1W0JG 2V52B 1IZ3A 1NK6A 3MCAB 4E19A 2JLEA 3J80O 4DTSA 5I42A 2BANA 1S0VA 1X4TA 3ZHQA 5EZYB 4RHV4 5CYQA 2BOBC 3V9ZA 4FZYA 2OCHA 2QTOA 2IU0A 3OYIA 1K9MO 4JI7B 3DTUB 3AO1A 4JKHA 3RR8A 3ABKC 3H1HH 2O8BB 2DE0X 3JATA 4DV6O 1SQBH 5JS2A 5LHIA 1OH8A 2CTQA 4I55B 3JS6A 5AQYA 4DV6K 2YEVB 5CBGA 4BIZA 3ATVA 2KZZA 1T8EA 3K04A 3AY9A 4Z1VA 4UFZA 1GOCA 2YI1A 5GTIZ 4JTCB 1YF2A 3OR6C 4DRXA 4DR2O 1I94B 1W2BU 5HRPA 1GKFA 3CF5L 2GTAA 4X1YA 2X78A 5DM6L 1N36K 1SUQA 1QLNA 1R094 3CQXA 2ITDC 4CE9A 5LYJA 2ZJRL 2LW1A 2R074 1M1KO 2UXBB 3T1YK 3CD6V 2CH6A 2VGMA 5HBMA 3V9SA 3O1BA 1MA9B 1F4NA 4BR0A 3CYMA 4B3TB 1BA0A 3IKMA 2N04A 3UT5A 1VK0A 5J2UB 4DR4K 1NK5A 2BGGA 1SERA 3QBWA 3RWUA 3D2FA 1GH6A 2P9NA 2HOEA 4RWTA 2DFFA 2WU2A 4KB1A 4YHHB 3KD1E 4JI1K 2G8IA 2F8TA 1X59A 4LCUC 1GLJO 2HVHA 4HBNA 3VEZA 3RVZA 3P32A 2HSTA 4IJAA 3BGRA 5LMNO 2GWKA 3GG4A 2V7YA 4BC5A 4FJ8A 1RSOB 2XTAA 3UKUA 5LGUA 2QA4V 4NCGA 3DLLL 2O8DB 2Q0AA 1EZVH 3ETDA 3DLKA 2HEPA 2QSAA 1P7GA 4X88A 2ZM6O 4WQ5A 1OVQA 1N33B 2P67A 2PYLA 3FGUA 3HP6A 3UM7A 2IC3A 3LSSA 2RNBA 5AQGA 4MVRA 5AQMA 1KFSA 3VRAA 2G8KA 3AG2B 4DR3B 1M4UA 4DSKA 2VCPA 4DTOA 5IJ0A 2Z1HA 5EC2C 1NI8A 1CXQA 3PN1A 4CF9A 2DFHA 2BUPA 2CH5A 5JH7A 1ASUA 3ZSQA 1GLAG 5AQOA 3CJHA 2ZWHA 2Q68A 3SJCC 2OWOA 3M3ZA 3C95A 1JLEA 4JI4B 2E5LK 4BAYA 1IX9A 1BHLA 3THOA 4DUYO 4U67L 3OVNA 3E83A 3ZT0A 3SAHA 4K3AA 4AHVA 4M3TA 3TJTA 2EWSA 4FL9A 3I55V 1M5IA 4RWUA 4H5NA 2JJ1G 3E22B 3TTDA 3SUPA 3VGLA 2QKBA 5JS1A 4RTFD 3O9UA 1M90O 4KPYA 2F96A 5C15A 4DSIA 1ZAUA 1Y66A 1MU2A 4BR7A 2VQFK 1U96A 1HNZK 1PV0A 3LNNA 4JKBA 3ZETB 5GAEP 2HMIA 1SQVH 2GUZB 3ZSOA 1WPXA 4D7SA 3HO1A 1AILA 1OCCC 4X1KB 2RF2A 4WF9L 5ITZA 4MW8A 4DV3O 3F7VC 4GYCB 3LDQA 3MMVA 3L70H 3ZEUB 5BR9A 3CPEA 2KG7B 3P1GA 4DW0A 4YXWG 1E1RG 2RMKB 1M56C 1M1KW 4QS7A 5AQZA 1THZA 3FD9A 3NH2A 4DQRA 4NXNK 1R6TA 1VQMV 3MEGA 1EM1A 2Q36A 2XAJA 1K8KB 4KKOA 4DYLA 3V9WA 3PSIA 5JVGL 4ZTFA 3BY5A 1YXQA 2D0BA 1J5EK 4NLCA 4C8KA 1FKPA 2R044 4X9QA 2QWQA 4I9LA 2OYQA 4FZ1A 3H1VX 2WSSG 3SGIA 1X9JA 2WFBA 4JI6O 5BN9A 4UCRA 4FLUA 1XC3A 2RM24 4J9YB 1B92A 3G4SN 1VQ7V 4JI6K 2YUAA 4CBCA 4QOZB 2P9PA 5C2TA 1RTIA 1RTHA 1DGKN 1WB9A 3LSUA 1Y67A 2D4WA 2IVOA 4IIJB 1Q18A 3THYB 5F1XA 2ZE6A 1IKXA 4NXNO 3L73H 3JALB 3OAAG 4DW1A 3K0SA 3QG5A 5B1BC 3O3HA 2GV9A 1HNXO 2FF6A 2E6MA 3BA9A 2F9TA 5AJ3K 1SKRA 3MDQA 1HNXK 2WLKA 1Q81W 1SZTA 4O2BA 3TTCA 2RN9A 1K8AO 4CJRA 3CC4N 1OCRC 5J1EA 2QWRB 4X1YB 3CQYA 3NMUA 1Q6IA 2HWC4 2EILC 1C1BA 3JAMO 1JJ2U 5LYJB 2VQEO 3SUNA 2HF3A 4IYHA 2HHVA 1MNGA 4O4LA 2EINC 2OZMA 1FS0G 3B77A 3O4WA 3AVJA 3BA8A 1GN2A 4LFBO 4CHZA 4CVNE 2WLJA 3AVHA 2FL4A 2RPIA 1KCFA 1ZSPA 2IH1C 4R50A 3UT5B 3QDKA 5GADP 3THWA 3PX4A 2XHBA 2EX3A 4PDRA 3VF2A 1Q5OA 4N41A 4I4TA 1V55C 5AQJA 1L8DA 1W2BM 1JA8A 4O4GA 1K97A 4JS4A 4FLYA 3CJAA 2D0OA 5HOOA 3OS0A 4TWKA 1S1UA 3WQTA 3TANA 3QEPA 3V6DA 1SA0A 2VG6A 3K08A 3N27A 1G99A 3TABA 4UCSA 3M8RA 4DO2A 4DV2O 4FPPA 1HKGA 4GLXA 3MAQA 5BN8A 3ASOC 1JKHA 4YJ3B 5E84A 5BRHA 4HYOA 4I0XB 4PDVA 4GV9A 4LF5K 1HR0K 4B3SB 4IO8A 5LXTA 5LMUK 1BDGA 1Q9XA 1SZXA 4XDLA 5FPRA 1XQSC 4LR3A 5LJWA 4IHJB 1TUUA 4NYNA 1ZL8B 1VQ5V 4M7YA 3THVA 2HHHB 2QWOA 1NENA 3C3TA 4DK0A 2EIJB 4K25A 5IE9A 1VEWA 4JK7A 4J10A 3ZHRA 2B1IA 2NRWA 2X74A 5B5EZ 5EVZA 3EZWA 5KPZA 1EZJA 2P51A 2B9ZA 4TSFG 3CB2A 3ZJZA 4LFAO 1VRUA 3TTFA 4Q0BA 3IMXA 3CMEV 3VRBA 1I08A 2HMPA 4DV2K 1L3TA 2D2CB 2DYRB 3NF6A 4CGFA 4MO4A 2O8CB 1KKCA 1XMOK 3UKMA 2GTDA 1HNZO 5GINA 3BF1A 4NTXA 4FWSA 2WLNA 3VEYA 1XQ8A 3SK3A 4ID5A 1UPGA 3QF7A 3L8BA 4LWSA 4DFJA 1U45A 4QE9A 1VSIA 2Q2RA 4UCTA 1MWKA 4B8AB 4ELVA 2YJEA 4M42A 3KK7A 1NKDA 3K9KA 1B04A 3CS5A 2OPRA 2CTPA 3V9XA 4ILHA 4KX6A 3STLC 3ZSVA 4CIGA 2Y1IA 4NTYA 4DV4O 3VGKA 5KGXA 4JI5K 4BIUA 2ZINA 1N36O 3QICA 2F43G 4DR7O 2UUCB 3ISNC 3LDDA 2KTQA 3GDQA 4A2BA 1A32A 2R72A 1SETA 1YITV 1T6DA 4PJ0Z 3U8XA 5BRDA 1BHAA 1AJPA 3OTOB 1K8KA 4O2AA 4KH4A 3HOSA 1TVKB 1EN6A 2BTOA 3OYKA 3L2QA 4LP8A 1RUC4 4OKJA 4DV1O 1OKJA 5AQFA 5M1OA 2WLIB 3BP8A 3HPHA 3WXMB 1QS4A 2A9HA 3G6EN 1AI7A 1RUG4 2KB1A 1TA8A 3MEEA 4LF7O 1T5EA 3DXRA 1Y76A 3CCUV 1BQZA 1R6NA 3OEHG 3SYOA 3AG4B 1NGGA 5CYMA 1OCRB 4DLGA 4B9TA 3HVRA 2E88A 4CJSA 4FJIA 4DV5O 3NF9A 1H2MA 2P90A 3VERA 3C0BA 2B5JA 3ABVA 2BTQB 3K0DA 2IJJA 3DLGA 4J2DA 4YOTA 1RUF4 4I50B 4BG8A 2ASPA 3V1OA 4F6RA 1ZYQA 4YJ2A 3K2PA 2E2PA 1IDSA 2E1ZA 4A62A 1SF9A 3RR7A 2WU5A 3U0ZA 3PY8A 4QPJA 4Z4EA 4O2BB 3K5MA 1C0UA 3AVLA 4MVZA 2ZNIA 4Z4HA 2JJ2G 4Z0UA 3VQEA 3IFRA 4KHYA 3SPHA 1P84F 3HI0A 4BRKA 2BDPA 5A9GA 3EE8A 3SQ1A 4B3MO 1FJGK 4MTXA 1XMQB 1UA1A 3GQKA 3FE1A 3CCSV 3VTHA 3QEIA 1NEKA 2GTSA 3M8QA 2ITCC 4KHWA 3VQ7A 2YIBA 4PHZA 3VOVA 4Q5VA 5EK0A 2Q3SA 1WNSA 5J2NA 1KQSU 1UOCA 2EBOA 2YIAA 4DQIA 3ZHTA 3IS9A 4JKGB 2QWPA 3ATUA 1CEZA 2E4LA 3AA2A 3OYEA 2P5OA 1GM8A 4E1MA 1MABG 1SQQH 1IJJA 2E5LO 1C0MA 1TYQB 1H2SB 4F2RA 1BI4A 3AE4A 2CH7A 3VQVA 4AM7A 4LFCB 3R3LA 3ZT1A 3S9HA 2UUBB 1R3IC 3JD2A 1FYJA 4H33A 2XAGA 4IL6Z 4JS5A 4DQPA 1EO1A 2PW9A 1HQUA 1RPRA 4FLWA 4Q4W4 5EBLC 1OCZB 2RMU4 4JAXA 2YXYA 1KF6A 2VQFO 4YJ3A 4JI6B 1ITGA 1YHQN 3P83D 1FFXA 2Q0OC 1EX4A 5LXTB 4KREA 1AR64 1IH7A 3Q7CA 4JASA 2UUAK 5M1PA 3AE9A 1ZL8A 3U10A 2P9UB 5J2TB 4I7FA 1T44A 3I56N 3AG1B 1SL0A 4MVMA 4XH4A 4EZ6A 2PZSA 3CC7V 3AEEA 1AR4A 3LAMA 1AR74 2JS5A 2P9LA 1Q43A 5IT9N 3EL2A 5IY5B 1EKEA 4O55A 1VF7A 4LF6B 1JXEA 3D0PA 3ZMUA 3DMJA 2EHGA 2CGOA 4JPRA 4YXDA 4CJKA 3ABKB 3A2FA 3OFNG 4IBNA 5C2DA 5KI6A 4CJ5A 4PD4F 3ZRWB 1WB7A 1RMU4 1BMFG 1XOUA 2QWNA 4CH6A 3L74H 3TR8A 2ZIOA 1EV14 1RHI4 2EZOA 4DU4A 1R0AA 1NG9A 4CH4A 2UXBK 1RSOA 1GOBA 2NUBA 2RQ6A 5EIBD 4BE2A 1A5VA 4DR4B 4A5UB 3T1CA 4DXWA 4RQFA 1OH5A 4E7HA 3CCRV 1JL1A 1C0GA 4E7LA 1Q82O 1WSEA 4H0VB 4W4LA 1C1AA 1HNIA 2FMLA 3KK2A 5L3EA 4GB34 5KQ8A 4IYIA 5BR8B 1JLAA 4X20A 3O80A 4EP5A 4WFAV 3M7MX 4CZKA 2EIJC 1N0NA 2F23A 5DECA 5CA1A 3DOLA 5CZ2A 4CIFA 3PX6A 4GNIA 3E8GA 3ID8A 3DI6A 3MWPA 3L71H 4H0XB 3QTCA 4LF6K 1Z26A 2B6AA 1TKDA 4O0IA 3DOKA 2OPPA 4O0JA 3CCJV 5EYPB 1VSFA 2YJFA 4NCBA 4X1IA 5IJ9A 3VQBA 4E7JA 1NKCA 3OUSA 1Y76B 4YDUA 4U3FH 1LUVA 5DEDA 3C6HA 4Q6GA 1TUYA 3CCRN 4ILGB 5FL7G 1PVC4 4PHTX 3IJ4A 4N23A 2GUZA 3LL3A 3V4IA 4B7KA 1REVA 3KLGA 2HJFC 4H0PA 4I50A 3AVBA 2HF4A 3MCPA 2NLJC 4EP4A 1YI2V 2HNDA 1A5WA 3VR8A 1EN4A 1FXKB 4JI0O 2Q7EA 3OMNB 4IFYA 3KLFA 2WS3A 4X62K 5HROA 5FNVB 2P9IB 4BVPA 4MVSA 4XIUA 3QNOA 2QWOB 1QTMA 3SFDA 1EFRG 1JLBA 1TK5A 3ZRSA 2CE4A 5KUMA 3SYAA 4OPJA 4DR2B 5FPEA 3G80A 4BGAA 1JLFA 4CGHA 1AROP 4JTAB 3P30A 3OUFA 3EVKA 4EFBA 2OCEA 4Z4IA 1ASVA 5EC1C 2YHBA 1H8EG 1MOFA 2DYRC 3N4QA 1I94O 5LOVA 1PNMA 2ZXWB 4IIJA 2GUPA 3JASA 1BU6O 2JGUA 4W4KA 1IV0A 2LGWA 4F6EA 4LWSB 2RCVA 4OGCA 3LZIA 3J7AP 4FJGA 3ASNC 4BC4A 3O3GA 3RRGA 1N6QA 4XDKA 2GX9A 3SBGA 1D8YA 3B40A 2XAFA 1A5XA 3TAGA 3CHXA 3K57A 1KD1O 2HHWA 2R7FA 2PFUA 4WFBV 1IURA 5LJVA 4R7CA 2DQ3A 2E6LA 4N5SA 4B3OA 1YVNA 4DTPA 4KHNA 3LP3A 4AQYO 4YOWA 1U49A 1WA8B 4RQEA 3OBYA 1ORQC 1ZOYA 2YHYA 5M1QA 4DR7K 3AEIA 3A5NC 3U4LA 2VWBA 4YT0A 2QWMA 2ADPA 3R6MA 2JVDA 3HKBA 2W40A 1NOZA 3VQAA 4KRFA 3L4QA 4B9LA 3SQ4A 4LFBK 4JHDA 3OTOO 1SZ2A 4LH6A 4ISGA 4FZZA 1K92A 1KYOF 3QO5A 3WXLA 3S3NA 2UXCB 3MN7A 1SS6A 1BWFO 1K34A 4B3TO 3KHYA 4AQYK 1L3UA 1DF5A 1WPBA 3D36C 2E3CA 4MTOA 4IEIA 2RJZA 1GLEG 2WWWA 4CS3A 3T1AA 3ZHSA 4PDLA 4DUZB 4TOIA 4NXMB 3VTIA 4CHYA 4HUEA 1AR84 2OPQA 1KMIZ 1S72V 3N2KA 1N34O 4BWMA 4B9VA 2OANA 2EJ7A 2P9SA 1PO14 1XREA 3ZN1A 4DV5B 2AJQA 4IKFA 3RVCA 3RTVA 1DKGD 5DN6G 2AXTZ 3I8DA 1IXBA 2M6YA 5DK5A 4I2PA 3OYJA 4CJQA 1LAWA 1VQPN 1PNKA 3SUQA 3UKRB 4ZOLB 5E79Z 3DGEA 4B3TK 3MK6A 2JWLA 1FXXA 1L3SA 4KHQA 2R9RB 1BQ0A 1JOYA 3JSNA 5AQNA 5JLFA 3AE5A 3NVKA 4IWVA 3NCIA 4GV3A 3DJCA 2WLLB 4FYDA 3PSFA 1K9MW 5CA1B 4FJ5A 3W7SA 3D3IA 3B2EE 4M3RA 2QE7G 1Q6UA 3KVGA 3S3OA 1NT2B 4LFAB 4QS8A 3VQ4A 2DYSB 4Z94A 5GONA 2NZTA 4DTXA 3HKCB 5KHIA 1N36B 2W0XA 1VRTA 2FBTA 4K41A 4AF1A 2IVNA 3K9AA 1NJXA 4Z4GA 5AQUA 4TV8B 2BSKB 4OO1J 1M57C 1YJWN 1QHTA 4X64B 3SV4A 3CCLN 3LUTB 4ZI7B 1RBVA 1HPZA 2CGNA 1SV5A 4O4JB 3DAWA 4BRDA 3VQCA 3VMFB 4HUGA 4EKWA 3M99B 1X1PA 3H3OB 4FWQA 5LL6Z 2E2OA 3TAQA 2DTUA 3GWKC 2PGGA 4QE7A 5A2QN 3HYFA 4JGSA 2UXDK 2WDVA 1QVGU 4BDPA 4GCZA 1V9PA 1H2LA 2RDCA 3AK3A 1NM1A 2V7ZA 3E01A 3HM9A 1VQ9V 3ZX2A 5FNVA 2P9IA 3DXKA 4FJXA 1YJNV 1CZ9A 3TGUH 1BL8A 1AI4A 3WB0A 4OKKA 1KAYA 4YFUA 3SYZA 3T4ZA 1FXVA 3D2FB 4MW3A 1YF5L 1CXZB 3L75H 4FOIA 4WFEA 4FJMA 1XL4A 1LWFA 4I4TB 4FZXC 1L0VA 3KKRA 4DU1A 5GIPA 1ENVA 2QM8A 3VEOA 3G71N 1R3LC 5F2RA 1IXMA 3QO9A 5E26A 3V9UA 4H4MA 1VQ5N 4UXNA 2OPSA 2WBNA 3BABA 4ZHQA 1RUI4 3RW0A 2JIZG 3UKUB 5CN0A 4G28B 2EULA 2O57A 3KWIA 4WFAL 2O8DA 5JJNB 3E9PA 2GSMB 3A5MC 3BVOA 4DR1B 1OZ0A 4YJ2B 2OIEA 4B3RB 4FO0A 3AA4A 5LY3A 3CCQN 1QNMA 4JLHA 3OHRA 2ZJPL 1T3VA 4P9OA 3R9PA 3FR0A 4H0TB 1EXQA 4EHUA 3C6UA 4KI4A 3RSEB 3ETQA 2ZGZA 4RCHA 1NTMH 5KTQA 3K58A 1HMVA 3P4QA 1RDUA 4B3RO 4ELUA 1N4CA 3J7AU 4JI3K 3PV8A 3D2EB 4PKIA 4B1ZA 4DWIA 3VQDA 4LF4K 3FAVB 3UQ8A 3PUFA 1XC9A 2X0LA 4L87A 3JCZA 4JI5O 2YHWA
chains in the Genus database with same CATH topology
3O3FA 4ICLA 1BISA 2P22C 5LA6B 3OY9A 5CY4A 1KRPA 5HLFA 3L2VA 3ZCMA 4DMNA 4DV0B 1J5EB 2D5RA 1IKWA 4RW4A 3U3YA 4PI0A 3PX0A 3T3FA 1NOYA 2VWKA 1VSLA 4CC6A 4KB0A 3NGIA 1B9DA 5LP6B 4GKKB 4X66B 4PA1A 1O9HA 4K8ZA 4N56A 4LF9B 3VQXA 2X6NA 4O4IB 3JARA 2QJ1A 1IKVA 3ZT2A 4B8CA 3AVCA 5HRRA 5C42A 3OYNA 3VA3A 3CFPA 4KFBA 2CAZC 4DFMA 4RW6A 1BQMA 5D5PA 3TI0A 4TUYA 1FK9A 3SJAC 5CB4A 4FW2A 4OPKA 3B6OA 5LMNB 4BACA 2Z1IA 4DTJA 3S3MA 1NK9A 1RILA 3P5JA 1KLMA 4NVPA 1J9AA 4CGIA 1W0HA 4BE0A 1SA0B 4KHPB 1TL3A 3HVTA 3DRPA 3ZSWA 3OS1A 4FK2A 1TVRA 5ITZB 1VSJA 4LY7A 3TAFA 1HNZB 4IDKA 4JI1B 4WBNB 1M93A 4OGEA 4L8JA 4J2EA 3RYCB 1KU9A 1JLCA 5GONB 4CFAA 4JYAB 2IOCA 3TWHA 4AQYB 4CF0A 1SKVA 4FM2A 2HHSA 3LDSA 3SV3A 4ZI7A 3LWLA 1I3AA 1T05A 1U48A 3SNNA 2G8WA 3KLIA 5IJ0B 1VSEA 5KRSA 3JAKB 1N5YA 1WAFA 4QCLA 1K6YA 4GVMA 4CFCA 1NJYA 4BDYA 3I0RA 4AHRA 1KVAA 1YTAA 1RT4A 4KV8A 5I3UA 1BIUA 3U6FA 3VQQA 4CEDA 4O44A 5IJ9B 2PYJA 1TK0A 4UCUA 4KTWA 4IFVA 1GOAA 4E7KA 3WB1A 3QEVA 1YEWA 4LH5A 5LP6C 3K5OA 2QK9A 1TL1A 1S1WA 4HVJA 4YNQA 4TV9B 2Q7HA 2VWJA 4MFBA 3IG1A 3VQ6A 2D0AA 3OYLA 1G15A 3OYFA 3LAKA 3T1HB 4OX9B 2A1RA 3QERA 3SQ0A 3DSQA 3HT3A 4ZTJA 4M3YA 1NK4A 5EU7A 1U04A 4CECA 4EEQA 1Q3EA 4CHOA 4DSJA 3JSLA 5KX5B 3CM6A 1EETA 3T19A 3AA5X 4O5BA 2PTMA 3CFOA 2R70A 3LP2A 1TKTA 2YNGA 3NFAA 3AVNA 2G8UA 3E22A 2YI8A 4R5PA 1X9WA 4CERA 1LW2A 4HCCA 3HJFA 2R7YA 4CJ4A 5FPOA 1Z5VA 1BL3A 2OZSA 4CGJA 4I9QA 4TUYB 4QAGA 3QEXA 5CB4B 4PUOA 2XY8A 3H08A 4CJWA 3EY1A 4W5TA 4FK4A 3AVMA 4C8LA 4DV4B 3HPOA 4ELTA 3IRXA 1HQEA 4DV7B 5FRMA 3QEWA 1X9MA 1RBUA 1N32B 4JRQA 5EYPA 3JALA 4KTZA 4CJTA 4AHUA 4CCHA 1S1TA 5C25A 5KMGA 2FBVA 3VQPA 4CF2A 1C0TA 1QSLA 4O4JA 3RGBA 4FFBB 3AVFA 4FVMA 1BGXT 3C6TA 3CFRA 1RT5A 5C24A 3RMBA 4ZHRA 4PI2A 4LSNA 1VSHA 4FJKA 2ZCEA 3DM2A 2VG7A 5J2PA 1RBSA 4DQQA 3O4QA 3OTFA 3FFIA 3IAYA 5LOVB 1TKXA 2XY7A 4E7IA 3ZEDA 4CJ3A 4F6RB 2WONA 4DV1B 1S1XA 4KHUA 4CK1A 1TKZA 4CGGA 3B6PA 4J2AA 1WSJA 4LNUB 4DR6B 3QIPA 1J54A 4AHSA 4CEAA 3QINA 4RW9A 3HP9A 3OYHA 4UCOA 3SPYA 3QIOA 3NBPA 2V4DA 1JL2A 1TUBA 3DYAA 5D3GA 2HVIA 3RMDA 2OA8A 1RTDA 3F9KA 4F4KA 3LANA 4W5NA 3KLEA 3OYBA 3CM5A 1RCHA 1HJRA 3NGYA 1WN7A 3OJUA 4DUYB 3PO4A 4UCVA 4CH3A 1NKEA 4HHTA 4C8MA 2HHXA 3RMAA 5FRNA 2HW3A 1KLNA 4DSEA 1LAVA 4H8KA 4DSFA 2VQEB 1TAUA 4DQSA 4LFBB 4J2BA 2RN2A 4FK0A 3LZJA 1RDAA 4FFBA 5IWAB 3SQ2A 3RYFB 3OJSA 3HKBB 4CEFA 1NK0A 4FXDA 5FROA 1HNXB 5J2MA 2ZD1A 4JRPA 1KFDA 3K59A 4E0DA 2IM9A 4E3SA 2GBZA 3K5NA 3AVGA 4M45A 3SR2C 1QSSA 1S5JA 3L2RA 4N76A 4E89A 3RYIB 1YTUA 4LNUA 3ITHA 1XNRB 3OYCA 4F2SA 1SQGA 3RWRD 4DR5B 1VSMA 4DSLA 4CEZA 1DTQA 4H4OA 5E41A 3VQWA 4CS2A 2R9AA 2VQFB 3O4NA 4BDZA 4EFEA 5K1XA 3U11A 3NH1A 3OYAA 3OYMA 3ALYA 3VA0A 1G6UA 5LP6A 3V1QA 3G10A 1RTJA 1C1CA 5CA0A 5DMRA 1UAXA 4HCBA 3QLHA 1X9SA 5KRTA 4M3XA 1RNHA 2KW4A 1HNVA 3KK1A 3AVIA 4GW6A 1DGSA 4DF8A 2I5JA 2G8FA 3N2KB 1CLQA 1P49A 2A1SA 4YY3B 3LPUA 4GMJB 5J2QA 3L2WA 3T1YB 4NYFA 4JI2B 2XO7A 3RMCA 2ITGA 3BDPA 4TV9A 1RDDA 5JQGB 4G1QA 2B4JA 4CIEA 1RDCA 1VSKA 4FJ9A 2QM4A 1DTTA 1S6PA 3LP1A 4CJEA 3UIQA 4DTRA 5HRSA 4PY5A 3HL8A 1D9DA 3ZSZA 2KFNA 3C94A 2F1MA 3ZT4A 4CH5A 3CSXA 1QQCA 4WBNA 4IG0A 4U3JB 5J2UA 2ZQBA 4CESA 3DLRA 4EB6B 2HNYA 2FC0A 4O4IA 2PY5A 2Q7GA 4BE1A 1KVCA 5HP1A 2W42A 1DLOA 5IYZB 3K5LA 4OKEA 1LW0A 4CK3A 4LSLA 1UWBA 4CJVA 4FJNA 1JFFA 5K1PA 2HHTA 4JI8B 1HYVA 5JJJB 4LH7A 1NJWA 1JMKC 4E1NA 3SUOA 4Z4CA 2FBYA 4Z4FA 4DS4A 1HR0B 3HSTB 1XI1A 2YNHA 1NKBA 1KVBA 1RBRA 1TK8A 3L2UA 5K14A 5CA0B 1LWCA 3LALA 5JVDA 4FLXA 4CJLA 4I55A 4B9SA 3AA3A 1S9GA 3G0ZA 3QESA 4LF8B 1HNWB 4F3TA 4W5OA 1LV5A 2YHAA 2XY6A 4NXNB 4BW9A 5SZTA 4FLVA 2F8SA 3NE6A 1WSIA 4LF5B 3RYHA 4CEOA 2UXDB 1ZBLA 1Q8IA 2XRIA 4WE1A 1SL2A 1S1VA 4FJ7A 1KSPA 5JQGA 1WSGA 3DRSA 1HRHA 1TAQA 3LPTA 4IG3A 1IO2A 1EP4A 1XMOB 3DRRA 4CEEA 3KK3A 3SJBC 3HK2A 3SI6A 3RRHA 2BE2A 2Z1JA 3MXJA 3KJVA 1L3VA 1JXBA 3QNNA 5SWMA 1J53A 4FJHA 5KHJA 3VN5A 4JI3B 4DV2B 4CFBA 5KGWA 4EB6A 5LA6A 1VSDA 1RT3A 5KHGA 5EIBC 3ICXA 2G8VA 2F93B 2O4IA 4O4HA 1WAJA 2FBXA 3KLHA 4Y1DA 2QKKA 4CHQA 5D5QA 5BMVB 4CGDA 2HHQA 2ETJA 3M8PA 1N34B 3ZS8C 3AVKA 4FLZA 4X20B 1B9FA 3AO2A 5KHKA 4KAZA 3AV9A 3JARB 4F8RA 3JSMA 5KHHA 4I2QA 4OLAA 3AO5A 1S6QA 1XWLA 3AO3A 5JVDB 4K0KB 1WSFA 1CXUA 4X1IB 2P1JA 3NH0A 4DTNA 1L5UA 1XHXA 4CF8A 1JLGA 1NJZA 2ZIMA 1IBMB 4Y1CA 3NDKA 5KX5A 3WB2A 4X62B 3JAWB 4B9NA 1FFXB 2ZNJA 3NF8A 2UU9B 1FKOA 2ZM6B 3RYHB 1T7PA 4DK1A 4N47A 2UUAB 1RT2A 4C8OA 4W5QA 4DG1A 2P5GA 4MQ3A 4DTUA 4HNAB 2QXFA 1BQNA 1QSYA 4B9MA 4KO0A 4JV5B 2YXLA 3NF7A 3KKSA 2BTQA 3PO5A 3MXMA 3BHPA 5IYZA 2KQ2A 4KL1A 4CHNA 4M41A 4DLEA 1SL1A 4ZIBA 1ZBFA 1IBLB 4RW7A 4DV6B 2PUSA 3RYIA 1XHZA 2YNIA 5JCOC 4K8XA 1HYZA 2E5LB 3VQYA 3HKEA 3HKDB 4CK2A 3L3VA 2F4VB 2HB5A 1WSHA 3WNHA 4TQFA 3WNEA 2X6SA 1O9GA 5T7BA 1BI4B 2IS3A 1RT1A 3TAMA 1ASWA 4W5RA 1D9FA 1J5OA 3M8SA 2YIBD 1BIZA 2F95B 4DS5A 2Y1JA 4LD0A 3NHGA 1Y97A 3JAKA 5BMVA 4DFPA 3SPZA 3N2GA 4OVLA 3BAAA 4X65B 2GUIA 4KHSA 4ZOLA 3OYGA 3HXMA 4LF4B 4B9UA 2IDOA 2YKNA 4DFKA 2ATQA 1Q9YA 4TQDA 2D0CA 2HNZA 3JYTA 3VQ8A 3MXIA 4FCYA 5JCOA 3JASB 4M3ZA 3LWMA 1Z25A 4CEBA 3ZSYA 4TV8A 4CF1A 4OJRA 2YI9A 3ZSRA 4KTQA 3DLEA 4FM1A 4RW8A 4CHPA 2XY5A 3TAEA 5C8YB 3I0SA 3RFRA 4O4LB 1W9HA 1TV6A 1JFFB 3SJJA 4AH9A 2DFEA 3KD5E 2IAJA 3WNGA 5EZYA 3HPGA 5JH7B 4UQGA 4CC5A 2RKIA 2Z1GA 4DU3A 1O1WA 1HW7A 4CJPA 2ZE2A 4DR7B 1I7FA 1U47A 1BCMA 3L3UA 5KMGB 1SQFA 4EZ9A 4NCAA 4FW1A 1RT7A 3BRCA 1TGOA 4CS4A 1YVUA 1RDBA 4M3WA 1BCOA 2F66C 3FFQA 4B3MB 4JI5B 1CZBA 4AHCA 4HTUA 1U4BA 2O4GA 2WOMA 1SKSA 3ULDA 5J2TA 1IBKB 3EZ5A 4AHTA 3CG7A 4U3JA 1NK8A 3WNFA 2DY4A 3HKEB 4FM0A 3HKDA 1D5AA 3U3GA 1IG9A 1SKWA 3HKCA 1S9EA 4F3OA 3F73A 1C6VA 2YKMA 4LH4A 3ASMA 4D7TA 3JAWA 3AVAA 1ZBUA 1TVKA 3N2GB 1UA0A 2VG5A 3JATB 4B08A 3LP0A 3MEDA 3V81A 4HNAA 3QETA 3VQ9A 4DF4A 3KIOA 4DRXB 4CEQA 1RBTA 1QE1A 5CZ1A 2IGIA 3KTQA 3EYZA 3DLHA 2KZMA 1I39A 2YNFA 4TSXA 5FDLA 3TAPA 4PQUA 4IHJA 1HYSA 3NGZA 4LF7B 4L8RB 5JJEB 2G8HA 3BPZA 1LWEA 3V1RA 2HHUA 1NK7A 4BWAA 4C8NA 3OYDA 3AO4A 3TARA 1WLJA 4DTMA 4AILC 3ZT3A 1JLQA 1YT3A 1TAEA 3SZ2A 4DV3B 4HUFA 1RT6A 4ID1A 4JI0B 1JJOA 3CQ8A 2KKWA 4FJJA 3D45A 2KFZA 1ZBHA 4GKJB 3RYFA 3NAEA 4FLTA 1F21A 3VQ5A 4O2AB 1IKYA 2LSNA 4OLBA 1ZBIA 3OS2A 5HRNA 1TUBB 4CJUA 4CFDA 3RYCA 4KRFA 1Z5WA 2YV0X 1FJGB 5LMUB 3ZSXA 4O4HB 4PWDA 4ZHQB 4X1KA 1KTQA 4M3UA 4RG8A 3MECA 4KI6A 3FI7A 4BWJA 3SCXA 1T03A 3DLBA 4CJFA 5C8YA 1NK6A 4E19A 2JLEA 4DTSA 5I42A 2BANA 1X4TA 5EZYB 5CYQA 4FZYA 3V9ZA 3OYIA 3RR8A 4JI7B 3AO1A 3JATA 5JS2A 4I55B 2KZZA 1T8EA 4UFZA 1GOCA 4DRXA 1I94B 5HRPA 4X1YA 2X78A 1SUQA 4CE9A 5LYJA 2UXBB 5HBMA 3V9SA 3CYMA 4B3TB 3UT5A 1VK0A 5J2UB 1NK5A 2BGGA 3RWUA 2DFFA 4KB1A 4YHHB 3KD1E 2G8IA 2F8TA 2HVHA 4HBNA 3BGRA 4FJ8A 4NCGA 2Q0AA 3DLKA 2HEPA 1N33B 2PYLA 3HP6A 2IC3A 1KFSA 2G8KA 4DR3B 1M4UA