2PZSA

Phi29 dna polymerase complexed with primer-template dna (post-translocation binary complex)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTAC)-3'
total genus 165
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pzsA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pzsA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pzsA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pzsA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pzsA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pzsA06
1RDBA 2HHVA 1W9HA 4M3WA 3ZCMA 2KTQA 3SI6A 2X6NA 3HL8A 4N56A 3L2VA 4AHTA 3A2FA 3SUOA 4LSNA 1NJZA 3SUPA 3OYCA 3RR8A 4M3XA 4NCBA 4E1MA 2OPPA 4MQ3A 1VSFA 4CJRA 1TKDA 4ZHRA 1I3AA 3PO4A 1CZ9A 4CGIA 1BCOA 3PV8A 5KGWA 4O0JA 4CESA 4I9QA 3IS9A 3HPGA 4RW7A 3LP1A 2QXFA 4WE1A 5J2NA 4FLYA 3HYFA 3TAEA 3MAQA 2G8HA 4JLHA 3UIQA 1L3SA 4E89A 2G8WA 1VSJA 4Z4IA 2KFNA 1QHTA 3RWUA 4AHVA 3DLBA 3S3OA 4RW6A 2E6LA 5KRTA 3S3MA 3AA5X 3OS1A 1ZBHA 2HVHA 3S3NA 5C42A 3ITHA 4E7LA 1EX4A 4QCLA 3OYIA 3K5MA 3QIPA 4KHUA 3I8DA 1ASVA 1S6QA 1A5WA 4EP4A 2A1RA 1HMVA 1KFSA 1B9DA 5CYQA 3MXMA 4CCHA 3OS0A 2XY5A 2R7FA 4AHCA 1ZBIA 2PYJA 3K59A 2OZSA 4CGFA 2E6MA 1XHXA 4RW9A 2VWKA 3EY1A 4M3TA 4DFPA 3TWHA 2XO7A 2O4IA 1U4BA 1HQEA 1RT7A 3TAQA 2X74A 4DSEA 4EZ9A 1WSGA 3AVKA 4CK2A 3HVRA 1QSYA 3ZT1A 4DTUA 1J54A 2R7YA 2HB5A 4B9VA 4CJEA 1W0HA 1Z25A 4DTOA 4B9NA 2I5JA 3CM6A 3LWMA 4FK0A 4FLVA 4HVJA 4DG1A 3HO1A 3KLHA 3L2WA 1ZYQA 1IH7A 4C8KA 1T05A 4FJGA 2KFZA 4CJTA 3ULDA 1SL0A 4LH5A 4R5PA 3LP3A 5CYMA 1QSSA 2FC0A 5JS1A 1KRPA 2Z1GA 1RBSA 4BDZA 1GOAA 4K8ZA 4H4OA 3WNFA 2Y1IA 4KPYA 1TKZA 1D5AA 4CEEA 3V1OA 2P1JA 4DU3A 3JSMA 3VQCA 4FYDA 2B6AA 1RILA 2E4LA 3DLEA 3ZT3A 3V4IA 3T3FA 1L3UA 1LW2A 2JGUA 2G8KA 2PZSA 4NCAA 3OYKA 3AA4A 4GW6A 5DMRA 1T8EA 1WN7A 1Z26A 3C6TA 4CF1A 2D0CA 3NGYA 3OYDA 3NGZA 4BACA 3SV4A 4CIEA 3OY9A 4KHNA 4KO0A 3LZIA 4Z4FA 3THVA 1XHZA 4FJNA 3NH1A 2HHTA 2DFHA 2IAJA 1TK0A 3KK3A 1QSLA 3LPUA 3O3FA 4O4GA 3HSTB 3ZSWA 3O3GA 2PYLA 3LP0A 4FZZA 1J53A 2F8SA 4CEBA 1UAXA 1VSHA 1DLOA 2WONA 2XRIA 3O4NA 5J2MA 4FZYA 1O1WA 3LAKA 3KLFA 3M8RA 4DSLA 2QKBA 1Y97A 2OYQA 1VSDA 1UOCA 3KK1A 4DU1A 1NK0A 4ELVA 4FK2A 3U3GA 2B5JA 4CJUA 4KB0A 3E01A 3HXMA 1GOBA 4DTNA 1TGOA 4W5OA 1VRUA 4KHYA 3KJVA 1RT4A 4CF2A 4DQQA 3AA2A 3ASMA 2QK9A 3DRPA 3AVLA 1KVAA 2G8VA 4FJ5A 2KQ2A 4Z4CA 3AVAA 1EXQA 1U45A 4I9LA 1MU2A 3WNHA 1BISA 2BANA 3QEPA 1HYVA 4ZTFA 1S1UA 4F2RA 4FJ8A 2ZQBA 4KV8A 1RTHA 5HRRA 4BE1A 5HRPA 1S9EA 3OYEA 1FKOA 4PA1A 3VQ9A 3AVHA 3U6FA 1BIUA 1VSKA 4FK4A 2YNGA 1JL2A 4O5BA 4CHQA 1UA1A 4O44A 3CM5A 2BE2A 4I2PA 4ID1A 1GOCA 2YKNA 4FJKA 3CYMA 2QKKA 3LALA 2GUIA 3FI7A 3QEWA 1ZBLA 4FM1A 3AO1A 4G1QA 1JLEA 3NGIA 4CFCA 3OYFA 2NUBA 3MECA 4F8RA 3AVCA 4KREA 4CJKA 4AHUA 1RT2A 4F4KA 3VA0A 4OLAA 3AO3A 3RMBA 2G8IA 4F3TA 3C6UA 1IKWA 2XHBA 1BI4A 4DF4A 3L2QA 3SV3A 1KLNA 3K5LA 3HM9A 1RT3A 4GVMA 4JRPA 4BDPA 2G8UA 3SQ1A 3AV9A 3QIOA 2XY6A 3CFPA 5SWMA 3DMJA 3B6PA 3ZT2A 1NK7A 1U04A 2HHUA 3M8QA 5KI6A 4M3ZA 4DTPA 2OZMA 4BWMA 2P51A 4CHPA 3OJSA 1CZBA 3DRRA 4EZ6A 1LWEA 4IG0A 3NDKA 4B9UA 4C8OA 3OYMA 4OKEA 4BWJA 3I0SA 3V9XA 1J9AA 1S1WA 1WNSA 4KI4A 4DTRA 2AJQA 3DRSA 4OPJA 2ATQA 4DTXA 3IRXA 4NCGA 4KHQA 3V6DA 1VK0A 3LANA 1BL3A 1QE1A 3ZSVA 3QESA 4KB1A 3QLHA 3JYTA 1J5OA 4OJRA 1T7PA 4IBNA 4HUFA 3OYBA 1LAWA 3TAPA 1HPZA 1FK9A 1NK9A 3TAGA 2A1SA 3PUFA 5HROA 2KW4A 3PY8A 3AA3A 1QS4A 3V9ZA 4DTMA 2BDPA 5T7BA 2XY8A 4FJXA 1DTQA 4OGCA 3RTVA 4CGDA 1LAVA 2PW9A 1WSJA 2IGIA 3T19A 4DFMA 3QEVA 4E7IA 4CEAA 1KFDA 1RTDA 4ELUA 3OYJA 2DFFA 1T03A 3OVNA 3NH0A 5J1EA 1HRHA 3KK2A 3LAMA 4CHYA 3DLKA 3V9WA 1RDAA 4KTQA 4IFYA 1NK8A 3HPOA 1KVCA 4E1NA 3SCXA 4ICLA 1JLAA 3D45A 2IS3A 1ITGA 3H08A 3NBPA 1U49A 1RDDA 1TKTA 3F9KA 2YNFA 4I7FA 4YFUA 3DOLA 4DTSA 1L3TA 3VN5A 4FJIA 1TV6A 1RDCA 2Z1IA 3ZSRA 4CJVA 1Q9YA 2GBZA 3AVBA 1C0TA 4CEDA 3ZSXA 1WAFA 2KZMA 4FJ9A 3PX6A 2JLEA 2OPSA 3AVFA 4N41A 3RRHA 5FRNA 2DTUA 1G15A 1RBUA 3MEGA 5CZ2A 5FRMA 4QOZB 1WLJA 2IOCA 3TR8A 1C1CA 4FJJA 1JLGA 5HBMA 4PWDA 3SNNA 1X1PA 4JRQA 3HK2A 3DM2A 3VQ4A 1X9SA 2OPRA 3VQ7A 4KI6A 3VQ5A 3RMDA 3V81A 3RRGA 2GV9A 2ITGA 3ISNC 1BHLA 3HPHA 3K2PA 3O3HA 3L8BA 1TKXA 4IDKA 4JS4A 3SUQA 3K5NA 1NJXA 1N6QA 3RMCA 3HP9A 4FVMA 3EYZA 4DTJA 4DQIA 3K58A 2DFEA 2LSNA 1IKYA 1D8YA 4W5QA 4XIUA 3NF9A 1DTTA 3VQQA 5HRSA 4CJ3A 1CXQA 2D0BA 1SUQA 1YVUA 4F2SA 3NF7A 2HHQA 4Y1DA 3CG7A 4CHZA 4Q5VA 3SQ2A 1TAQA 1TK8A 5HRNA 1SKRA 1JLCA 4N47A 1BQMA 1BI4B 3AVIA 3G0ZA 1X9MA 1CXUA 4CJQA 4LH4A 1BGXT 4BE0A 4OKKA 4QAGA 1TK5A 2KZZA 1S1XA 4FW1A 5EU7A 2F96A 4LSLA 4PUOA 4AHSA 3VA3A 1U47A 1NK6A 1IG9A 1VRTA 5CY4A 4UQGA 4B9SA 4CIGA 3V9SA 4AHRA 3PX4A 3HJFA 4YNQA 3SUNA 4IG3A 3NH2A 4DFKA 4DFJA 1L5UA 4ZTJA 1NOYA 2YKMA 3QETA 4N76A 4EP5A 3DLRA 3CFRA 3LWLA 4BDYA 3HP6A 3QINA 4DS5A 4DSIA 4CEZA 1TVRA 3C94A 1LWFA 4KTZA 1FKPA 3VQ8A 1BQNA 3KLIA 4CGJA 4DQRA 4FZXC 4W5RA 3QEIA 3SYZA 2DY4A 4CFDA 4FM2A 4O0IA 3TI0A 1TAUA 3QEXA 4FLZA 3G10A 4KFBA 1NKCA 4M3YA 3O4QA 3KLEA 2HHSA 4CECA 3EZ5A 3LDSA 3NAEA 3KKRA 3ZSQA 2RKIA 1JXEA 2O4GA 2HNYA 3C95A 4GMJB 2Z1JA 4NYFA 1F21A 1LW0A 4HTUA 2X6SA 1SKWA 1FXXA 3OYAA 3LPTA 4FLUA 1KVBA 2XY7A 4HCBA 4FXDA 3NHGA 5E41A 1KSPA 4FLXA 3AO4A 2WOMA 2Z1HA 3NE6A 1SKSA 4FJMA 1SL1A 1RBTA 4CERA 3L2RA 4HHTA 4C8NA 4BE2A 4DSJA 4KTWA 4CE9A 5C25A 1EKEA 4CJLA 4B3OA 4M3UA 2YNIA 3KD1E 5HP1A 2HHXA 3BDPA 1NOZA 4CGGA 1RBVA 1R0AA 3HVTA 1D9DA 4E7HA 1U48A 4J2BA 4W5NA 4DMNA 1JLBA 4CGHA 3SPYA 3IG1A 4CEOA 1YTUA 1WSIA 3P5JA 4CF0A 4CJFA 4Y1CA 4CK3A 1Q8IA 4H8KA 5J2PA 1WAJA 2HNDA 3DLGA 3NF6A 2ZE2A 4OPKA 1KLMA 3CQ8A 1QTMA 1HYSA 1C0MA 4Z4HA 1NJWA 4B9MA 5C24A 3KIOA 4TSXA 1RNHA 2YV0X 1TL3A 1ASUA 5DK5A 4DU4A 1X9WA 1CLQA 1RBRA 5KTQA 3ZSOA 4JS5A 4O55A 1NK4A 4E19A 4PQUA 2FBYA 1UA0A 1S1VA 2VG5A 3NCIA 2Y1JA 4OGEA 1BIZA 4FW2A 4Z4GA 2HW3A 1JKHA 3L3VA 2HMIA 3KKSA 4J2DA 3PO5A 4DLGA 3QERA 3OS2A 4LD0A 3V9UA 3RR7A 3KD5E 2P5GA 2FBVA 4HUEA 2Q3SA 4B9LA 4HUGA 1A5XA 1RT5A 3AVMA 3FFIA 3MXJA 3AO5A 5I3UA 5J2QA 5SZTA 1RT1A 2ZD1A 4E7JA 4DQSA 4CJWA 4J2AA 3T1AA 1ASWA 2VWJA 4FM0A 1VSLA 1A5VA 1EETA 1WSEA 4N5SA 3QO9A 3LZJA 4K8XA 3VQEA 3IAYA 4W5TA 1IKXA 1TL1A 4CIFA 3K57A 1HNVA 1REVA 1RTJA 1C1AA 1HNIA 4OLBA 2IC3A 1NKBA 3ZSYA 1K6YA 1HQUA 1JLQA 3SZ2A 2PY5A 3VQDA 2EHGA 3DYAA 4ID5A 3SQ0A 1LV5A 5FDLA 3P83D 3AO2A 4I2QA 2W42A 1YT3A 4FLWA 4H4MA 1L3VA 4CJ5A 4CFAA 1NK5A 3OYHA 4LY7A 1QQCA 1SV5A 3SQ4A 3BGRA 4CHOA 4M3RA 4B08A 1HJRA 1KTQA 2X78A 4Z0UA 5K14A 3SPZA 4DQPA 3M8SA 3QNOA 2F8TA 4PY5A 5I42A 4CEQA 3ZT0A 3TABA 3ZSZA 1WSHA 2IDOA 4DWIA 4OVLA 1XWLA 3HT3A 1ZBUA 1N5YA 3TARA 4AH9A 3PX0A 4F3OA 5JS2A 4MFBA 1NJYA 2VG7A 3F73A 4CHNA 4IKFA 1RCHA 1C6VA 1Q9XA 4AILC 2YHAA 3S9HA 4CFBA 4L8RB 4M45A 1D9FA 3NFAA 2ETJA 3OYNA 3OYGA 4E3SA 5D3GA 3VQBA 2HVIA 1IKVA 3WNGA 1EP4A 1SL2A 2HHWA 2BGGA 1HYZA 3MEDA 4ELTA 1S9GA 2EX3A 1WSFA 1VSEA 1JLFA 2FBTA 4CJPA 3V1QA 3VQ6A 3MEEA 4C8MA 5KGXA 3TAFA 4FJHA 1RT6A 4KHWA 4KKOA 3L3UA 4Q0BA 5HLFA 4KHSA 4CF9A 1KCFA 2YHBA 4KAZA 4KRFA 3MXIA 5KRSA 3OYLA 4Z4EA 3M8PA 2OPQA 1C0UA 3DOKA 4DF8A 2RPIA 4FCYA 4CK1A 3DI6A 3ALYA 5FROA 1LWCA 4RW8A 4J2EA 3VQAA 2G8FA 1BCMA 1S6PA 4DS4A 5CZ1A 2OA8A 3AVJA 3I0RA 2YNHA 3WNEA 3SJJA 4RW4A 1I39A 3TAMA 4M41A 1S5JA 3QNNA 3CFOA 4CJ4A 3TANA 3KTQA 2RF2A 4FJLA 4C8LA 1VSMA 1S1TA 3V1RA 3AVGA 4CEFA 3LP2A 3ZT4A 3K5OA 3AVNA 4FLTA 1B92A 1XI1A 1C1BA 3D0PA 4DSKA 1RTIA 1JL1A 3RMAA 4OKJA 4B8AB 4IFVA 3KLGA 2D0AA 2VG6A 1IO2A 3L2UA 1ZBFA 3VQPA 4B8CA 4RG8A 2HNZA 1XC9A 4M42A 2D5RA 1YTAA 2FBXA 4E7KA 4HCCA 3B6OA 3DLHA 4DLEA 4B9TA 4CF8A 1B9FA 4CJSA 1UWBA 4NYNA 3NF8A 1NKEA 1JXBA 3OJUA 4FJ7A 2P5OA 4DSFA 2B4JA 3U3YA 2RN2A 4E0DA 1VSIA 3P1GA
chains in the Genus database with same CATH superfamily
2IU3A 1XDCA 3RVZA 5CR4A 1W9HA 3N2GB 1VQ6V 3P39A 2ZDIC 1D5NA 2RDCA 3SI6A 2KTQA 4N56A 1URFA 2QM7A 3SUOA 4X66K 4LSNA 1QVGM 4JKBA 1MG1A 2FL4A 2P9IA 4CJ7A 3RR8A 2QWPA 4LF5K 4NCBA 4M3XA 1EM1A 3C3SA 1BGYH 1VSFA 4MQ3A 4CJRA 4LF6B 3UQ8A 2ZR3A 5AQUA 2GUPA 2QKAA 1BWFO 3BVOA 3PV8A 4DUZO 2VQFK 4CESA 3FAVB 3IS9A 4N41A 1M93A 4YORA 2WLLB 1GN3A 4JLHA 4E89A 1L3SA 2RS14 5D5PA 3T1HO 3RYCA 1QHTA 3T1YO 5KRTA 1XMQB 4O8UA 2ZE8A 4X88A 5EVZA 1GAXA 3ITHA 1ZBHA 2HVHA 3O80A 1T6CA 3OD4A 4PDRA 3FB7C 2QWQA 5CBFA 2LW7A 1ASVA 4EP4A 3JCUZ 5LYJA 5CYQA 5LY3A 3J80O 3MXMA 3JSLA 5HFLA 5ITZA 1K8KB 3B8NA 2WLHA 4AHCA 4U7NA 2F7TA 1PM9A 3L4IA 1FPOA 3CMEN 4DUYO 4N21A 3MX5A 2K1EA 5C2TA 5C15A 5B8HA 3TAQA 2X74A 3UE5A 4YOUA 2JGDA 3CX5F 5L3GA 2A3ZA 3OAAG 3AVKA 3FR0A 4CK2A 3HVRA 2YXHA 4JI0B 2KKZA 5IYBO 3TXSA 4DTUA 4B3SO 1W0HA 2CGKA 1Z25A 2UXBK 1D4M4 4BR7A 4WFAL 1GH6A 1WBDA 1N8RW 1GM9A 4FK0A 4FLVA 3ZJZA 2UUBB 1PL0A 1HUXA 4H5RA 3JAKB 1K73O 2WLJA 3I56V 4DR5O 4FJGA 2ZINA 1VQ9N 3OR6C 5EC2C 1B06A 3ULDA 1SL0A 1CP9A 4JI0O 3LDNA 1VEWA 4R5PA 2GWJA 4DV4O 2FC0A 3FGUA 4DV3B 2Z1GA 3S41A 4PDVA 1BS3A 1DKGD 3MDQA 1E1QG 5C12A 2WTUA 3V1OA 1ROPA 3BY6A 1VQ7V 1FKAO 4DU3A 5KHHA 5TKYA 4JI2O 3LSSA 2E4LA 1S5LZ 4DR2B 4NCAA 3AECA 1ZWIC 3OYKA 1VP7A 3BF3A 1MABG 1T8EA 4CF1A 2D0CA 2YJEA 3N2GA 5JJJB 3NGYA 4BACA 4JASA 5BXZA 4CIEA 3GQKA 1SKVA 1RDWX 1NU1H 4I50B 1GN4A 3D3IA 4C23A 1BUPA 2R044 4AM6A 3QTCA 4DRXA 3O3FA 3E2EA 3HSTB 3CCVN 4FWLA 1OH6A 1DF5A 3C90A 3LP0A 4LF7B 3DXMB 2ARHA 1J53A 1RPRA 1OH5A 2XRIA 3CRRA 3L9DA 1DLOA 3SYQA 4FZYA 3LAKA 2P67A 3M8RA 3VQYA 3MHSC 3TETA 2O8FA 3JD74 3WEEA 3BCCH 2D1KA 2LO1A 2A42A 4ELVA 2EIKB 1VMGA 2B5JA 4JI7K 2LW1A 3ZRXA 1GOBA 4BRKA 3ABTA 5JLHA 4W5OA 4DTNA 1YXQA 2ZF5O 1IBLB 2P4VA 4MLEA 4B3MK 3KJVA 4FIPC 1LUWA 4DR3O 4CF2A 3ASMA 1QLEC 4ZI7B 3DRPA 3AVLA 1TYQA 1KVAA 5JVGL 3B77A 2FBWA 4OGQB 1U45A 1MU2A 2HSTA 2BTOA 1BISA 5EBLC 2BANA 4NLCA 3G71V 4F2RA 2QWLA 5AQWA 2HR3A 4A57A 2R074 4DUZK 4CVNE 2AW9A 4UY8O 4J7KA 5HRRA 2NRWA 5HRPA 3OYEA 4NB4A 1H8EG 5KUMA 1NGCA 5BMVA 3OE7G 1WUAA 4CZEA 1WAZA 2YNGA 5EY4A 1B6QA 3SPCA 1NMDA 4BQLA 4WBNB 4ID1A 2YKNA 4H33A 3UM7A 2P9SA 3CYMA 4FJKA 4JKHA 4JI8B 4JV5B 4G1QA 4LC9B 1JLEA 2UU9K 1IXMA 2QEXN 4CFCA 1KC8O 4F8RA 2GSMB 3K3WA 4M7XA 3ABKC 4CJKA 2VS0A 1RT2A 4F4KA 3GB7C 3C7NA 3RMBA 2WLIA 3EFFK 2YIBA 4OPHA 3NVKA 2QXLA 5GAHP 2ZM6K 1IKWA 4K42A 1RVF4 1ZSPA 4GVMA 2UUAO 2G8UA 1BOTO 3AV9A 4YJ2A 3QIOA 3KZBA 5SWMA 4QNHB 1Q7YW 4UCUA 2LGQA 1BG3A 3HM8A 1U96A 3SDLA 2ZD9A 1HDJA 1GLBG 2WFBA 4H5VA 4EB6A 2YXLA 3CHWA 4KL1A 3PLAA 4EZ6A 1LWEA 1BA0A 3OYMA 4BREA 4WFHA 4DO2A 1FJGB 4BRDA 1SQGA 1JX9A 3V9XA 1S1WA 1NGHA 4X65K 1S76D 1VBA4 2NRHA 4KI4A 3DRSA 4TV8A 4QPKA 4O2AA 2YHXA 3IRXA 4NCGA 5FNVA 1VK0A 3DC6A 3QESA 1VQON 3QB0A 2QWRA 4BROA 5AQNA 2X0LA 1P7GA 4OJRA 2HVJC 2OT5A 2JEXA 3OYBA 1LAWA 2A41A 1NK9A 2FXUA 3OMNB 3RFRA 4YHHK 1SQQH 3PY8A 2OTJN 3H1IH 4DR7O 5CB4B 2ZDIA 3V9ZA 4DTMA 5T7BA 5F2VO 1CEZA 4FJXA 3SPJA 4PJ0Z 5H6QA 3RTVA 2O8BB 1S72N 2OCHA 3T19A 3R66A 4DFMA 3QEVA 2NR5A 3OBWA 4E7IA 2F4VO 2UXDO 1QCEA 4X89A 2UUBK 4IOXA 3OVNA 3THOA 1YF5L 4X64O 1GM7A 5BZBA 3P4IA 4LR3A 3F7YC 3D2EA 4IFYA 3OGCC 5GADP 5JH7B 4F6EA 4UV9A 4AI8A 1YIJN 4D7SA 2PI4A 1U49A 3F9KA 2OANA 1L3TA 3E9LA 4JI7O 1TV6A 2BCCH 1Q9YA 3P4QA 1VQ8V 3GWKC 4X65O 4R50A 2QM8A 4M63C 1ZBSA 4CEDA 1WAFA 5KQ8A 2KZMA 5EK0A 2OPSA 2CGOA 1AI4A 3QNEA 3A8YA 3MCPA 5FRNA 2X6BA 5H1SQ 2R9IA 4M7YA 3LM9A 3OMAB 1J5EK 5HBMA 4YOYA 1RSOB 5TISZ 5KQDA 1NGFA 4FZ1A 3DXKB 2ZQMA 1H8HG 5LL6Y 1HXS4 1W97L 3RMDA 1R3IC 2GV9A 2ITGA 3SUQA 3APOA 4UCVA 4YOVA 1EBOA 4DV6B 2HBKA 5EOYA 1N6QA 3HP9A 4DV4B 4LF9O 2V7QG 1WB7A 2NLJC 3KWIA 1DLBA 2LSNA 3CCJN 1QR9A 4JK7A 3ZX2A 2Q0OC 3FLCO 1RFYA 3STZC 1SUQA 4CBUA 1YVUA 4JI2K 3CIPA 4Y1DA 2X6AA 4BGBA 4Q5VA 2Q67A 4N47A 1BQMA 1BI4B 1NI8A 1U2VB 1CXUA 4CJQA 5EC1C 4BE0A 3CP1A 1EO1A 5E79Z 5JVDA 4QAGA 4BQZA 2KZZA 4PUOA 4AHSA 3VA3A 1U47A 1NK6A 1IG9A 1YTFD 4ZKIA 3KVGA 4B9SA 5TKWA 4JKDA 1RSOA 4AHRA 4X1KB 5IJ0A 3V9SA 2HKOA 4YXDA 2M6YA 5FNVB 5KMGB 1Y66A 3OTOB 3IMXA 4QS7A 3SUNA 1L5UA 4RQFA 1NOYA 3U10A 1JMKC 3UB5A 4UUJC 2Z5UA 4TSFG 3CFRA 3LWLA 3QINA 4BG9A 1V9PA 2F95B 1FKPA 4BRPA 1BQNA 3VF2A 4F9OA 4RTFD 3IC9A 4LC1A 3N4QA 3TI0A 1EN5A 4JI8K 4JV5K 4JI1B 1QLEB 5LXTA 1TAUA 3G10A 2BUPA 3TSQA 2FB5A 4A59A 1CZAN 5GW7A 2IH1C 1BO5O 1Y76B 4FWSA 4GMJB 2Z1JA 2HBJA 1W0KG 2X6SA 1FXXA 3OT7A 1Z6RA 3VEYA 4FLUA 2V7YA 4HCBA 4JKFA 1JFFB 3GVMA 1KKCA 1KSPA 1NGIA 2W6KA 2WOMA 3NE6A 4FJMA 2HG5C 1NMNA 4DSJA 3X2QC 4DV6O 2QM4A 3VEOA 1G8MA 2VWBA 1MSDA 3W7TA 4B3OA 4JI2B 4M3UA 3KD1E 2WPDG 4K25A 2GBOA 3ABVA 4CGGA 3SBTA 1R0AA 1IX9A 4E7HA 1U48A 3H45C 2EIMB 3SPYA 2ZR2A 1YTUA 4UVAA 1WSIA 3ABKB 2OTLN 4PKIA 2FF6A 4PL7A 1Q8IA 1YUWA 3LDLA 4Z1MG 1YJWN 5C0YA 1WAJA 3DLGA 3OTOK 2D2CB 5LOVA 1KLMA 3CQ8A 2UU9O 5C24A 3H1KH 1RNHA 2YV0X 1TL3A 1ASUA 1F7YA 1CLQA 2RS54 1K9MW 1JFFA 3C65A 3CIRA 4MVZA 3ZSOA 2Z0AA 5CA0B 3VF6A 2NZTA 4PQUA 4ZI7A 4BRGA 4FPAA 1UA0A 5J2UA 1ILYA 4OGEA 1BIZA 1MNGA 2WA4A 3ZN0A 3W0LA 2UU9B 1JKHA 1ZL8A 2HMIA 4Z4GA 1RUJ4 3AE3A 4YSYA 4IJNA 4CS3A 5BY1A 3TTFA 3KD5E 3OS2A 4LD0A 4JI5O 4DCHA 1GTOA 3ETQA 4NR1A 4V19S 4HAMA 5LGUA 4QPJA 4DR2K 1RGIA 3FFIA 1ZX3A 1NENA 2P9IB 4LF4O 5A2QN 2ZD1A 1Q5OA 4E7JA 2GTSA 4DQSA 1JJ2M 4J2AA 3T1AA 1KB9F 4DUYK 1VSLA 1EETA 3SPHA 4I50A 3LZJA 1PP9H 1TL1A 4CIFA 4RWUA 1KKDA 3O9TA 3Q4HA 1SETA 5LP6C 1K6YA 1YITV 3ZMZA 2PY5A 3BY5A 2EHGA 3EVKA 3DYAA 4EFHA 2ITDC 5FDLA 4I2QA 2W42A 3GQHA 1YT3A 1QNMA 3I56N 4KXRA 2OCCB 2Q4PA 1NS1A 4CFAA 3OYHA 2B5UA 5GINA 4JN4A 5KHKA 4MDBA 4YJ2B 1RFQA 2UXBO 4B08A 1VQLN 1KTQA 3RSEA 5K14A 5LJVA 4MDAA 2B1GA 1GO3F 5I42A 4R8CA 5L3FA 4EB6B 2R72A 1WSHA 2E1ZA 2IDOA 4WQ5A 5C3JA 5BN9A 4OVLA 3BAAA 1F4NA 1N5YA 3TJTA 3VF4A 2IU0A 4ZIBA 1HP8A 4WCEL 1DTOA 4HBNA 2JGDB 3L75H 3VQWA 4MTFA 3CI5A 1K4DC 1QLNA 1GLDG 3KHYA 4RWTA 4GKKK 1NKDA 1JR9A 3K79A 2KG7A 3H46O 2XNDG 1M4UA 2QA4V 1NR1A 3TSUA 1XMQK 4WFBV 5LL6Z 3NFAA 2ETJA 4H5NA 2IJIA 3G80A 2UUCO 3VQBA 4FPPA 3GL1A 4PI0A 2HHWA 1I5XA 4LFCO 3ZETA 2IJHA 3ZRWA 1VQ8N 2F66C 4J7JA 4YTPA 1JLFA 4UCSA 2FBTA 3J81O 3MEEA 5KGXA 5B1NA 4CH6A 4DK1A 4KKOA 1FS0G 4B3TB 3ABMB 4CF9A 4HYOA 1SS3A 4KAZA 4KRFA 5JWPA 1YHQV 5KRSA 3OGIB 2HLDG 2DQ3A 5ITZB 5K1PA 1K8KA 2RPIA 1WPXA 4CK1A 4DF8A 4RW8A 4WFBL 1R1BA 4I55B 2G8FA 2ASOA 2ZE6A 1EN6A 3RVCA 1SQBH 4U7OA 4DR4O 5CZ1A 2OA8A 2Q31A 2QI2A 1NGAA 3I0RA 4JI4K 3SK3A 2KKWA 4BRQA 3TAMA 1L0LH 1YJNV 4M41A 2E1YA 3T7ZA 2H3OA 3QNNA 3TANA 1CPYA 2IH3C 2RF2A 4JAAA 4CEFA 2JEUA 3AVGA 3ZT4A 1C1BA 1MDUB 4GKKB 4CC5A 4B8AB 3RMAA 3EE9A 1BE3H 2OIEA 3QBXA 4J8FA 1IO2A 4LWSA 1Q3EA 1ZBFA 1WP8A 4B8CA 4RG8A 3ZRVA 4M42A 1NA1D 2GHYA 2LP7A 3L73H 4PA3A 2CGNA 3DLHA 1K92A 2D0PA 1M57B 4FPBA 5LMNO 3NF8A 4JI3B 4FJ7A 1DEJA 1SAZA 4UFZA 1HKGA 4LFBK 1YVWA 3P1GA 3K04A 4J80A 4DR7B 2QWNA 1OH8A 2XASA 3ASNC 3ZCMA 4DB3A 5AQPA 2MK3A 1OHHG 3O5BA 1AR74 4O4HB 4DV7O 4IT5A 4WFAV 3QFPA 1OV9A 2WLLA 3HZ6A 4BRCA 3HKDA 3H3NO 2EIMC 4YDUC 1AI7A 2NRTA 3PO4A 1CZ9A 3CS5A 1BCOA 2FLOA 1MZEA 1S5HC 4DV5O 3LL3A 5IYZA 2GDSA 4I9QA 3HPGA 3WU2Z 4RW7A 3LP1A 2QXFA 4WE1A 3WB0A 1K7DA 4FLYA 1DGKN 3THWB 2WLIB 3RWUA 2DYRB 2FF3B 3ULEA 3S3MA 3VR9A 1QZ6A 3OS1A 4WFNL 2VQFB 4E7LA 1YTFB 3VEWA 3S3NA 1VQ5V 3E9PA 4JD2A 1EN4A 2BTQA 3K5MA 4KHUA 2V1DA 1TVKA 5A9GA 2QKKA 3CCEN 2A1RA 5CHIA 3CCSV 3F2KA 1FFTB 2ZGZA 3OS0A 3K0GA 3SYPA 1O9HA 1NT2B 3ABUA 4JI1O 4BR9A 4PELA 5LA6A 4M3TA 2CTQA 3ZX6A 5AZIA 2O4IA 2UXBB 2XO7A 1U4BA 4X64K 3CF5L 1RT7A 1YCIA 4DSEA 3VMFB 3O65A 2WLKA 2F4VK 1T44A 3ZMVA 2UXDK 1Q86O 3ATVA 1P49A 2YIBD 1ATRA 3B09A 2HB5A 5JVDB 2P90A 2I5JA 3ULEB 3CM6A 2WDQA 3LWMA 4EHUA 3W3DA 5LMUO 1AI6A 3M5RA 3HO1A 5AG2A 3CHXA 3HKCB 1T05A 1XEQA 4CJTA 3TK1A 5KX5A 2ZJPL 4MW3A 2ZM6O 3AEEA 3LP3A 5JS1A 4BDZA 1RBSA 4LF5O 4IL6Z 4WCEV 4K8ZA 3A5OC 4MVMA 1VF6A 3J81N 2ZNIA 1TKZA 3T69A 5GTIZ 4KPYA 3CSXA 2FSKA 4CEEA 3CCQN 2P1JA 3JSMA 1N4CA 3EO3A 1R6NA 3BA9A 1N32O 3A0IX 3V4IA 4DV3O 5HFMA 1N34K 1F23A 1MA9B 2PLV4 1H2MA 4DXWA 2R064 2OTLV 4B3TO 5DMRA 2V52B 3CXCM 1HYSA 3ATUA 3NGZA 3SGIA 4KHNA 4GKJB 4KO0A 2MW2B 2AZ0A 4UXNA 2XTAA 4Z4FA 1FW6A 1R3KC 4FJNA 4ILJA 1IXBA 1RM1B 2IAJA 1QSLA 4FWNA 3L6QA 2P22C 4O4GA 2Q7HA 1VQNV 3BF1A 3PSIA 2F8SA 4CEBA 1VSHA 1E1RG 3O4NA 5IYZB 4PDWD 4GUNA 2I7PA 5DN6G 1BHAA 1IDSA 1ZC6A 2YI8A 1NK0A 4O4IA 3B2EE 5FPMA 4CJUA 4KB0A 4JTAB 2JWLA 4ISGA 4FFBA 4NXMO 1XNQO 1VRUA 5ELZA 4KHYA 4DQQA 2QSAA 3G25A 3L74H 1YSCA 4CS4A 2G38A 3MX2A 4Z1VA 3RYFB 4FJ5A 1EXQA 5B1AC 1Q86W 5LHHA 3QEPA 4GV9A 3CRCA 1WJZA 4JAXA 4IOCL 1MZFA 4NXMB 3MN9A 2H89A 4BE1A 2QW9A 1YAGA 2N74A 5EYPB 1AJPA 3VQ9A 1VQ4N 3AVHA 3U6FA 1BIUA 3VRBA 3N2KA 1SQKA 1D2DA 4FK4A 3WG7B 4CHQA 1UA1A 4O5BA 4O44A 3U11A 4I2PA 4UVCA 3U9DA 1GOCA 2ITCC 4H13B 4X20A 3QEWA 1XNQK 1UJWB 3NGIA 2VQEB 2NUBA 3CCMN 3AVCA 1VQLV 2Q7EA 3VETA 2W6LA 4AHUA 3ETDA 5AQZA 3VTHA 3VA0A 1H2NA 3E8HA 2UUAB 1Q7YO 2G8IA 4X62K 4F3TA 1NGJA 4K0KB 3DJCA 1YQ4A 2XHBA 1K4CC 5DM6L 4J41A 1NEKA 3AAPA 1YJNN 1WA8A 1OZ0A 4CZZA 1V4TA 4B7EA 3SQ1A 2O8CB 3ZEDA 2RS34 3RBZA 5C8YB 3FE1A 3CFPA 4BRLA 1SRYA 3B6PA 1SA0A 3ZT2A 4CZKA 4Q4W4 2HHUA 1BHBA 4DTPA 1I5YA 4CHPA 2RR14 3OJSA 4X1YA 3DRRA 1KC8W 3TSPA 3E8GA 3MWPA 3P4PA 5L3EA 4BWJA 1UPGA 2E2OA 4FSVA 1NQTA 4TV9B 3VEZA 3T1CA 4DR3K 3EKSA 1VHXA 3BZKA 4O5FA 4B7KA 2KB1A 2ZE7A 4YHHB 2ATQA 1XOUA 2ODMA 5JLFA 1QE1A 2E88A 4K41A 4UVBA 5LJWA 1P7BA 4JYBA 4D6TH 1T3VA 5IWAB 2EILC 2A40A 3CC2V 1T7PA 2YSUB 3CC7N 2H88A 2EJ7A 2QR4A 1FK9A 3TAGA 2QDOA 1W0JG 3VRAA 4FWRA 4DV2O 3AE2A 3CXCU 2HJFC 4L8JA 2F4VB 2UXDB 3FFKB 4DR6B 3L72H 1KAXA 4JYAK 1DTQA 5J9PC 1SERA 4LF4K 2PW9A 1WSJA 3BHPA 4BC5A 1E4FT 4CEAA 3OMIB 1VAZA 4X1YB 4CI6A 2HF3A 3OYJA 2DFFA 4A5AA 3UT5B 3J7AP 1Y76A 4JHDB 3KK2A 3LAMA 3ZEUB 4BR6A 4IIJB 1RDAA 1ZL8B 4MVRA 3ZHVA 1KVCA 3P3NA 2IS3A 3H08A 3C3TA 2P5GA 3SPGA 4OX9O 4I6MB 3VN5A 1Q18A 4CD1A 5BRHA 2Z1IA 4KBOA 2GBZA 4NO7A 1SQXH 4J9ZB 1RUD4 1C0TA 1K97A 4I5SA 1O13A 1Y4MA 4P9OA 4TOIA 3ZSXA 4O4HA 1MWMA 3PX6A 1K9MO 4XDLA 3CJ1A 3MCAB 5IWAO 4O4LA 4JTDB 3RRHA 1BQ0A 1RUI4 1RBUA 5CZ2A 4C1NK 5FPEA 1LNQA 4CZMA 4YY3B 5LHIA 4QOZB 4PWDA 4FJJA 2P9UA 1JLGA 3B4SA 5ADXH 5M1OA 3FYIB 2HVKC 4KI6A 3UO2A 2OPRA 1VQKN 3VQ5A 3F5TA 2BOCC 4DLGA 1BHLA 3K2PA 3O3HA 1TKXA 4CBCA 2QM1A 4IDKA 1FAFA 4JKGA 1HR0O 3RMCA 3ZIAG 2XAGA 3M8AA 1IG8A 2YICA 1D8YA 4W5QA 3M1FA 2XAFA 1DTTA 3EZWA 1OCCB 3CETA 3ENOA 4CJ3A 3THXB 1WB9A 2R9RB 1KXPA 3FZHA 3LDCA 1XNRK 2D0BA 4I6MA 3A8TA 3WXJA 2WU2A 4F2SA 3NF7A 2HHQA 1QR8A 4QE9A 3CG7A 1ZOYA 3UKUB 3TCUA 3SAFA 3AK3A 3AG1B 1OJHA 1HRV4 1TK5A 1AP6A 2DWDC 5JJEB 3R1XA 3AEAA 2YHWA 3FB8C 4FW1A 3ZHSA 4LSLA 2VYPA 3IKMA 1VQPV 1GK9A 2EULA 5CY4A 4EEQA 5JVHL 1P90A 3CJBA 2A9HA 4CIGA 3HJFA 2H94A 4JYAB 4DFKA 2QWNB 2RCVA 4DFJA 3AG4B 4ZTJA 2PUSA 4DV1O 2F43G 4N76A 4O2BB 3Q7CA 3JBG4 3DLRA 4ASUG 4YOWA 1PPJH 3OM3B 3GDQA 4JI5B 4CEZA 1TVRA 3C94A 3OTFA 1LWFA 4NXNO 1P8ZA 1GLLO 4FZXC 1HPMA 4TT3G 2DY4A 4NKGB 4O0IA 4NXMK 3TU5A 4H0VB 4B1ZA 3C6HA 3QEXA 1VQNN 4FLZA 1XNQB 4KFBA 2E5LB 2IJJA 4FJCC 3O4QA 2Y4TA 5I9EB 4M3YA 3NAEA 2LJ2A 1FYJA 1I7FA 1VSIA 2RKIA 3ZSQA 2O4GA 4ILGB 3JATB 4I7ZB 4NYKA 3C0BA 2Q6AA 2E3CA 4PKGA 3VGKA 5M1NA 4CS2A 1NTMH 2FKXA 2AZ2A 2O8BA 2EINB 4IXCA 3CMAN 3SMSA 4CERA 1SL1A 2RJZA 4C8NA 1YHQN 3SUCA 4KTWA 1JCHA 4I4TA 4AM7A 4GVEA 1VF6C 4BR5A 2ZGYA 1QBZA 1X3NA 5KAFZ 1KFYA 1YZBA 4MVOA 2GELA 1EWRA 3ZMUA 4WQ4A 1AR4A 4O4LB 2CGLA 3HVTA 3NVMA 5EZYB 4IJAA 4YSXA 5EX5A 2QWOB 2LFRA 5KLVH 4GKJO 2W0FC 1GMGA 3E8FA 3P5JA 2A06H 4FOEA 4G28B 3AE4A 4DRXB 2BSKA 4Y1CA 3SMPA 3H1JH 2HNDA 1QTMA 5LGNA 2HOEA 4Z4HA 1FJGK 1YI2N 5FPNA 5HOOA 1OCZB 2JIZG 1XMOO 2QTDA 4TSXA 1X9WA 4DHYA 5B1BB 1RBRA 3ETGA 5AQHA 4BW9A 4B1YB 1I94K 1OKJA 3NXSA 4B3RK 4JS5A 3VTIA 4OX9K 2FBYA 3F5WC 1TUEB 1M9NA 4I4TB 1G99A 3JAWA 4XH5A 3MWTA 1W2BM 1VQ5N 4CZLA 3L3VA 3AEGA 3PO5A 4YJ3B 3QF7A 4RUEA 2ZM6B 2R70A 4PHZA 4JI3O 2Q3SA 3CE2A 2VGNA 4LNUB 4HUGA 2L35A 5I3UA 2QWPB 1M56C 3O08A 2R9AA 1RT1A 1ASWA 4O2AB 3ZCCA 3T4ZA 2Q0AA 3ICXA 1K5SA 1A5VA 2YCHA 2OTJV 3VQEA 3T1HB 3T1YB 2HFEC 3E35A 1Z2GA 2JK5C 1N33B 3K57A 2NRZA 3THYB 4DR5B 5KHGA 1GM8A 4UV8A 3O6WA 3ZSYA 1NKBA 1HQUA 3T4DA 4G27B 1GLEG 3MN5A 3SQ0A 5AFUA 3RWRD 4MTXA 1AJQA 4FLWA 1BL8A 3E1YA 4CJ5A 4CZFA 1NBWA 2BTQB 3T1HK 3T1YK 3SQ4A 2HHHK 4EAHD 4LF9K 4M3RA 1H8TD 1EZJA 1Y74B 4LP8A 3ENBA 2X78A 4EFEA 4F6RB 1QHAA 2NRVA 3JCZA 4A2BA 3M8SA 3QNOA 4DQPA 4PY5A 3SJQC 4NTYA 1G4YB 3ZSZA 3H1VX 5KHIA 1XWLA 5H2FZ 5EXWA 3TARA 1J5EO 5JS2A 2O8FB 1NJYA 2P7TC 2UUCK 1YEWA 3F73A 3E22B 1RCHA 2I7NA 2YEVA 1E4GT 1C6VA 4QS9A 4LFCB 1Q9XA 5F2RA 4BR2A 3S9HA 1NU0A 4L8RB 4M45A 1KQSU 1N32K 1Z7S4 5IY5B 3VGMA 3OYGA 4E3SA 3WNGA 2WA3A 1EP4A 1SL2A 4JZ2A 4E4EA 1HYZA 3DXKA 4BRNA 3K06A 1S22A 2QWRB 4X20B 1WSFA 1KMIZ 4TUYB 4CJPA 3V1QA 4C8MA 4FJHA 3P30A 4X65B 3D2FA 4Y0WA 5HLFA 4KHSA 1TAEA 3SJAC 4DV0K 3S3XA 3SLCA 1HNXB 4X66B 4NTWA 3OYLA 5M1PA 5BMVB 4Z4EA 1VBE4 3M8PA 1C0UA 1SZTA 3JD0A 1BSMA 1XMOB 5FROA 1PNKA 2XOKG 3N27A 4J2EA 5AZJA 1IBMK 2ZNJA 1J5EB 1OCOB 4DS4A 4W4KA 1Q82W 5J2UB 1YDXA 3VGLA 5FLXN 2P9PB 1HWYA 2OCCC 2NRRA 5JMVA 1OCOC 3HKBA 1RMU4 1M90W 3U0ZA 1YJ9N 3KTQA 4FJLA 2RQ6A 3CCRV 1IBKB 4LF6O 5LHGA 1S1TA 4LFAB 4HNAB 3LP2A 1BDGA 4FLTA 4BG8A 3TXQA 2HHHB 4JEPA 5ADXA 2P9UB 3VOVA 5FPRA 3VOUA 1RTIA 3D0PA 2EZOA 1TUBB 3QMLA 3DXRA 1AJNA 3K9JA 3KLGA 4DUYB 5JQGB 2VG6A 1COWG 3ZLJA 5J2TA 2HNZA 2A3QA 4Q4V4 1R3JC 2FBXA 4E7KA 5BRFA 4O4JB 4CF8A 4CJSA 3P4RA 4WF9L 3BFRA 1UWBA 1Y74A 1NKEA 4DR6K 1JXBA 3OJUA 2P5OA 4DSFA 1SKRA 4E0DA 5FL7G 1FFXB 3LDEA 3H6EA 2Q0UA 2HHVA 3SJHA 1RUE4 2FTKA 1GLCG 1XQSC 5L3DA 4JYCA 4X62B 2X6NA 3HL8A 4GX5A 4WFFA 3A2FA 4AHTA 5IJ9B 3SUPA 1NJZA 4R7CA 2E5LO 3JAKA 4H0XB 4YY3O 2PF4E 2YEVB 3VBBA 4E1MA 2N05A 1TKDA 1XREA 3HTVA 3CXHF 3VENA 5CB4A 3BP8A 2VCPA 2PAVA 1ZTEA 1AROP 2G8HA 5J2NA 3SYCA 4OX9B 3HYFA 3MAQA 4QE7A 3OEHG 2G8WA 5AQMA 2CTPA 4ICGA 1YIJV 2F9TA 4AHVA 3SAGA 2KFNA 2EINC 3CQYA 5BN8A 2E6LA 1M1KO 3AA5X 5B1BC 4BAYA 3AG3C 5BPMA 4B3MO 1EX4A 1VQ7N 4XDKA 4LF8K 2X5ID 3OYIA 3QIPA 2Q9LA 3MD0A 4B3RO 1LUVA 3I8DA 1A5WA 3DAWA 1KFSA 1HMVA 1B9DA 4CCHA 3QICA 3A5LC 4H0TB 2ASPA 1DGSA 3R8EA 2Y69B 2UXCK 2P4KA 3DXMA 5C2DA 1K33A 1NTKH 4B3MB 1HNWO 3HKEA 1Z5VA 2E6MA 1XHXA 4RW9A 2VWKA 4XH1A 1IBLK 4DFPA 3TWHA 1NTZH 2WSSG 2KHOA 1BZKA 1EZVH 4LF4B 3CYOA 1WSGA 4K3AA 1QSYA 1MWKA 2WQYA 3HKCA 3R65A 3ZT1A 3APQA 4CJEA 4B9NA 1M57C 4LH6A 2KLAA 2XAQA 2Q1NA 1X4TA 2WU5A 1SC5B 1H2SB 5EIBD 3SJCC 4DG1A 5C2FA 3KLHA 3THWA 2WDVA 4C8KA 1PNMA 2V4DA 4E2LA 3VEXA 2KFZA 3AY9A 4ZOLB 3CC7V 3SYOA 5CYMA 3I55N 1KRPA 5AQRA 4DV7K 3WNFA 5M1KA 1R094 5EIBC 3VQVA 1P4RA 1M90O 4YDUA 3VQCA 4FYDA 1RILA 1T5EA 4LF7K 2GX9A 1SZ2A 5AQYA 4JI8O 3ASNB 4JV5O 1LW2A 2P9NB 5LGTA 3K9AA 1FFXA 3AA4A 2RMKB 4H0PA 3C6TA 2O8EA 4LWSB 5KMGA 3RN4A 1XHZA 3NH1A 3UO3A 2DFHA 3D6RA 2ITMA 3UKRA 1TK0A 4X1KA 5E26A 4YSZA 2W6JG 2EBOA 3O3GA 4BRIA 4IHJB 4DV6K 2XT9A 3J7ZO 3WQTA 1UAXA 2WONA 5J2MA 3JARB 4JI6B 5B3SB 4QJFB 4DSLA 1Y97A 3IJ4A 5E1AC 1UOCA 3D36C 4DU1A 4FK2A 2ADPA 3RYIB 5CBGA 3U3GA 4PD4F 3E01A 3HXMA 1ATSA 1TGOA 4BRAA 4JKGB 3H01A 2FYUH 5AR0A 1RT4A 1KD1O 3AA2A 3WG7C 4AQYO 2YJFA 4HWIA 5GONA 2A6AA 1SQVH 5D5QA 3KKYA 3KG2A 3WNHA 3ZX0A 2HWC4 4J7ZA 4FJ8A 3WXLA 3LSUA 2ZQBA 1YVNA 2WAMA 4KV8A 4PV1B 2HWB4 3AEDA 5MLCQ 1YITN 3QFUA 2HJDA 4GV6A 1S9EA 4BC3A 1WPBA 5LP6A 4ISEA 1VSKA 4JAVA 1VF5B 1JL2A 1FD9A 3OR7C 4ZHQB 3CM5A 2UXNA 5BPNA 3JD1A 4IO9L 3FI7A 2ZIMA 4J10A 5LOVB 1ZBLA 3AO1A 2EWSA 2KQXA 5BRDA 4X64B 1HKCA 4U67L 3FYEB 1JA8A 3AGRA 1Z5WA 4WYBA 1NJIO 3G6EV 3STLC 3KWGA 1K8AW 1SF9A 3U8XA 3VQXA 5AQSA 4FWKA 3SBGA 1KLNA 3L2QA 3SV3A 2ZIOA 1OVQA 1N33K 3HM9A 4DR4B 2E8AA 4JRPA 4IOAL 1XILA 2UUBO 2Q8VA 2XY6A 2ZT9B 1KF6A 4PDLA 1X3MA 2J4RA 2XAJA 1BQZA 1WLEA 4K0KK 1O9GA 3ASOC 2GWKA 3TPQA 3M8QA 3QDKA 4MVQA 1XC3A 2IIRA 2HBMA 4GB34 1YQ3A 4H5WA 2P51A 4BWMA 4B1VA 1CZBA 1RM1C 3NDKA 4C8OA 3ASOB 4I0XB 4KFMA 4YHHO 4OKEA 4ILHA 3C6AA 2GEMA 4KH5A 3I0SA 1KBHA 3UKRB 1OH7A 1J9AA 1WNSA 4DV3K 1B3QA 4JI1K 2XUMA 2AJQA 3CJCA 4BC2A 1RUC4 1UFIA 4JYYA 1J95A 4IO8A 3V6DA 3ZSVA 4OO1J 2ZE5A 3CRAA 4EHTA 3HOTA 1AR84 2WDRA 4FZ0A 3MMVA 4CZHA 3JYTA 4Z2WA 2CK3G 5B1AB 1VRH4 4DV4K 3AGKA 3O1WA 5FLXO 4IDHA 3DSQA 1SQPH 3H1LH 1PL4A 2A1SA 2JDIG 2QWMA 3JS6A 3PUFA 3G4SN 5HROA 3AA3A 3OBYA 2BDPA 3EEQA 4JI3K 3ZHQA 4OGCA 5BREA 1LAVA 1RUH4 4K0KO 3CCLV 1KAYA 4YTMA 2YHYA 4DK0A 4Q4X4 1RTDA 2YX6A 3U4LA 1W59A 3BUZB 3RYCB 5F1XA 3NH0A 3CMEV 4O4IB 2CH7B 3T2MA 1HRHA 2DMXA 3CCRN 3RYHA 3L2UA 4IYIA 3O4WA 1S3XA 4IEEA 1JCEA 4KTQA 4YJ3A 3WB1A 3NBPA 4RO2A 4WQ5C 1WBBA 1YF2A 1RDDA 1TKTA 2YNFA 4I7FA 5M1FA 3DOLA 4YFUA 4FJIA 1I0HA 5LA6B 1RDCA 3WXIA 1X9JA 3JAMO 4ZHQA 1VARA 2A79B 1IBKO 3K08A 4FJ9A 2QE7G 1FXKB 3CWBH 4GCZA 4NVPA 1M5IA 3P3PA 3B8AX 3JD3A 2ZJQL 5IT9O 2DN9A 2HF4A 3LSQA 1G15A 2VGMA 2WUSA 5FRMA 4LF9B 5AQVA 4DV7B 1WLJA 3I8BA 3SNNA 1X1PA 4JRQA 2E2QA 3I33A 3HK2A 1X9SA 2IBZH 3ZRWB 4DW1A 3F9MA 3V81A 3RRGA 4YTNA 4KHQA 4LF5B 1F51A 4JS4A 3WQUA 4YOTA 3K58A 1Q81W 1IKYA 2DFEA 1HRI4 1VQMV 3VERA 3VQQA 4IGGA 5HRSA 1Q82O 1CXQA 4TWKA 4J42A 4I55A 1TUBA 5KPTA 3IFXA 2EIJB 1TK8A 1T6DA 4H37A 1X9MA 4CD3A 1PKXA 4OKKA 2YIDA 1NVPD 1S1XA 4FL9A 2F96A 3HKEB 2PGGA 4LNUA 3LDDA 4UQGA 2E2PA 4U7BA 3RYIA 2VQEO 4IG3A 4BRFA 4MO5A 3AE9A 5AZIB 4UCTA 1U97A 3D36A 2NLXA 2YS8A 4RQEA 4BC4A 1L0NH 5JICA 4DS5A 3HP6A 3RT3C 4DSIA 1AVMA 4QGPA 1LR1A 4KTZA 1KP3A 2HP8A 4DQRA 5AQOA 1Y64A 3SYZA 4D7TA 4GZRB 4PA4A 4B3SB 4JPRA 4CFDA 3JYCA 4QS8A 1NKCA 2HHSA 4JGSA 3KLEA 4CECA 3EZ5A 3PIOL 1MMMA 4H0LB 1NH2D 1F21A 4HTUA 4FFKA 3CPEA 1QVFU 1NJIW 3LPTA 3EKUA 3OUSA 2XY7A 4FXDA 4NTXA 1KD1W 3NHGA 4F6RA 1K5MD 3AO4A 2EJRA 2WWWA 3DTUB 5B3SC 1SKSA 1PNLA 3G67A 2WBNA 1IJJA 1RBTA 1PD3A 3L2RA 4HHTA 4JK9A 3CC4V 3CPWU 1EKEA 4CJLA 3CC2N 3MK6A 5HP1A 2BSKB 2HHXA 3A5NC 3BDPA 1NOZA 1HX1A 2BTFA 3HKDB 1NGBA 2Q68A 4A61A 3B8MA 4J2BA 4W5NA 4FVUA 4DMNA 1JLBA 1NBMG 2W41A 3EHBB 4IHJA 3IG1A 3LDQA 4CEOA 3CD6V 2YI9A 3DC5A 2UXXA 5L3CA 4TQFA 4CJFA 1R6TA 4DV0B 3K0DA 3ZN1A 4GV3A 4DUZB 1FXVA 2A7WA 4H8KA 5J2PA 3DLLL 3HPLC 1YJ9V 3NF6A 1GN2A 4OPKA 1TVKB 1NJWA 4YIOA 3KIOA 4DU4A 5DK5A 4CZJA 1IBKK 4I0XA 4YIPA 1NNEA 1C0FA 1KAZA 2ADQB 1IVSA 2VG5A 3NCIA 2O8DB 2EIKC 4FFBB 4AF1A 4ZOLA 1PO14 1H1VA 2ACZA 4BIOA 2HW3A 3IDHA 3D2EB 3KKSA 2KG7B 2P9KA 4L87A 3V9UA 4DV1K 4CZGA 2D4WA 3RR7A 3LNNA 4GX1A 3CCSN 2FBVA 4HUEA 4EKWA 1IZ3A 4B9LA 5AQIA 5CA3A 2ILMA 4RHV4 5CA1A 4A62A 4BR4A 3OUFA 5SZTA 3W7WA 3GG4A 3FZLA 1HNWK 4FM0A 1K34A 1WSEA 4N5SA 3QO9A 1XUQA 3L71H 3FB6C 3IAYA 4K8XA 1IKXA 4UCOA 3SFDA 4TV8B 1HNIA 4OLBA 4MVUA 4JKAA 2M7WA 2DWEC 3ZS8C 4WFEA 5EBMC 4WF9V 3SZ2A 2ZWHA 2OIGA 3VQDA 3KZIZ 1YJWV 1ESVA 1LV5A 4Q6GA 5JQGA 2E74B 3AO2A 4BGAA 4H4MA 2JS5A 4MT8A 2Z3YA 4DR5K 4MS2A 4U3JB 1J6ZA 2H3GX 2P9KB 1SV5A 3BGRA 4FWPA 3JSNA 1AB3A 4MSWC 5JCOC 1NR7A 1RP3B 3K9SA 1HJRA 1ENVA 5CA1B 3D7EO 4LFAK 1M1KW 3ZEUA 1JCGA 4H0YB 4CEQA 3S3WA 3ZT0A 3SPIA 2HBLA 3TABA 5IWAK 1SA0B 4AH9A 2EZPA 4MFBA 1VF7A 2VRZA 3G6BA 4IKFA 3JALB 5JCOA 4JK8A 1VQKV 5AQJA 1XMOK 1N0NA 4AILC 2YHAA 1D9FA 5LP6B 4GT1A 5D3GA 1HLUA 1V4SA 1COV4 1IKVA 4EFBA 3O9SA 5KUKA 3H9VA 2BGGA 2IVOA 3MEDA 4ELTA 5BR8B 1S9GA 2JJ2G 4JI0K 2EX3A 1PIV4 2P9LA 3E8BA 4RUFA 1VQ4V 3VQ6A 4KP4A 4CH4A 5LXTB 4KHWA 3L3UA 5GAEP 5AZJB 4Q0BA 4DV0O 1KCFA 5BPLA 2Q36A 1R73A 3JAMN 2V7ZA 3CJHA 1JCFA 3DOKA 2F1MA 2FSNA 3W7XA 4H0OA 3UKUA 2L6LA 2B76A 2E2NA 5IT9N 3ABLC 3J80N 2Y4UA 1S6PA 5DEDA 1L8DA 3E66A 4AQYK 3AVJA 3WNEA 1S72V 2YNHA 3SJJA 1HNZK 1HW7A 5CBHA 2CUGA 2RE2A 3OTOO 2EILB 1S5JA 4CJ4A 1NM1A 4C8LA 4UCRA 3ZRSA 3V1RA 3K5OA 5IYDO 3CCVV 1B92A 1XI1A 3QVNA 4DSKA 2EIJC 4OXSA 4X9QA 1U6ZA 3CJAA 1JL1A 4GKJK 4OKJA 2O8CA 1GKFA 3P31A 1ASJ4 4IFVA 3EN9A 3OHRA 1V55C 1WP7A 2Y0PA 3CCMV 2YIAA 1ZAUA 1NWKA 2Q0RA 2JWKA 1GRJA 3HSCA 4U3JA 3M6GA 3RVYA 3VQPA 3HBTA 3ID8A 1KECA 3JD2A 4FK5C 3O8MA 1YTAA 1N36K 4HCCA 4DR1B 3R6MA 4DLEA 3J8AA 1B9FA 4LFCK 4YT0A 1IURA 2QWQB 3VEVA 5LYJB 2B4JA 2ZCEA 3U3YA 1I94O 3WXKA 3AG2B 1RDBA 2RHKA 2DJVA 3A0HZ 3CCUN 1BMFG 1NH2B 3K9KA 2NNUA 1K5QA 3THXA 4M3WA 3GWOA 4DV2B 3VESA 4PHTX 1QZ5A 3L2VA 3N2KB 3EL2A 2QTOA 2CH7A 3KCXA 2CGJA 4FWQA 5B1OA 5FPOA 5LMNB 3OYCA 5LMUK 3HKBB 2OPPA 2W40A 4FWOA 3E89A 2QJ1A 1OCZC 5AQKA 4ZHRA 3RW0A 1I3AA 4PDMA 5CMUA 4CGIA 1XNRB 2P06A 3JARA 4FWMA 1OCCC 1AP5A 4KHPO 4O0JA 2IW5A 5KGWA 4X1IB 2DE0X 3TAEA 3UIQA 2A0LA 3QO8A 4LBEC 1FXKA 3PIPL 1VSJA 2D0OA 1LCUA 2GUZA 4Z4IA 3UT5A 4GLXA 1NVPB 3DLBA 3J7AU 3S3OA 3AG1C 3BEHA 4RW6A 3QG5A 1DK1A 3MDSA 5C42A 4BRMA 2WLMA 4QCLA 2HEPA 2XAHA 1HJOA 2Y0IA 3KCYA 1S6QA 3P32A 3IFRA 3IGAC 5GIOA 4R79A 4WBNA 2XY5A 3DWLA 3CJ9A 3KK7A 2R7FA 1W7AA 1ZBIA 2PYJA 4BY9C 4YXWG 1CXZB 3K59A 4CGFA 4KUMA 2QTSA 4CH3A 5F0XA 4XDJA 3EY1A 1HQEA 3ML0A 3JASA 2FSJA 1L1FA 4EZ9A 3HR0A 4X1IA 1HR0B 2GTAA 2V51B 1H2KA 2QEXV 2IJKA 4TQDA 5K1XA 1J54A 3R3LA 2R7YA 4B9VA 4P2ZA 4DTOA 2E76B 4HVJA 1V54C 1ZYQA 3L2WA 1IH7A 3IC7A 3PN1A 2ZXWC 3A0BZ 1XL6A 2P9PA 3WEEB 4CZIA 4Q4Y4 4LH5A 3I5DA 1QSSA 4X62O 5AQFA 1GOAA 4YY3K 2O8EB 3L4QA 2Y1IA 5KPZA 2ETNA 1P84F 1Q81O 1D5AA 4OPAA 3TTDA 3AEFA 4MLHA 1FXHA 4DQ8A 3FZMA 5LMNK 2B6AA 3ZT3A 3DLEA 1L3UA 3T3FA 4PA9A 2JGUA 2G8KA 2PZSA 3BA8A 3FFQA 4GW6A 4JKCA 1WN7A 1Z26A 3RSEB 4B9QA 4C1NI 3OYDA 3SV4A 5J2TB 3LNMB 3OY9A 5GAGP 4CBWA 4NXNK 4JD2B 3GE1A 3LZIA 3THVA 2E20A 2QA4N 3SR2C 2HMPA 1VQ6N 2HHTA 2P6JA 3KK3A 1N8RO 3LPUA 1BCCH 1AILA 3DGEA 1GLJO 2Q97A 3ZSWA 2PYLA 2GTDA 4FZZA 4BIZA 1VBD4 1EQYA 3QO5A 4KX6A 1VQPN 3IUCA 3FZFA 4O2BA 4HZ3A 5DECA 2CH5A 1O1WA 3KLFA 2LGWA 3FAVA 5IYCO 4NXNB 2OCEA 2QKBA 2OYQA 5C8YA 2YUAA 1QQNA 2AA4A 4XBFA 1VSDA 3BZCA 4IFEA 3AG7A 4IZ9A 3ZHRA 4BVPA 1X59A 3HI0A 3KK1A 3CJHB 2UXCO 3U9ZA 4FOIA 3OA9A 3HOSA 2QK9A 2CDYA 3EXAA 2YXYA 3OW2M 1N32B 2FMLA 2Y69C 4NLBA 2G8VA 2X7RB 2IVNA 2KQ2A 4LCUC 3AVAA 3D2FB 4I9LA 4Z4CA 1B04A 1IBMO 1JVMA 3TGUH 1HYVA 2IM9A 4DR3B 1N0JA 3ZHTA 1S1UA 4ZTFA 1MQTD 4KHPK 1RTHA 4K43A 4G2KA 3VR8A 2DOSA 2BH1A 1FKOA 1N36B 3P38A 2QWOA 3AG4C 4PA1A 1SZXA 3NMUA 4DV5K 3Q4HB 1VBB4 2BE2A 4PKHA 5EZYA 4DYLA 4LFBB 3W7SA 2GUIA 3LALA 4LF7O 3LM2A 4I9WA 4FM1A 2Q5ZA 3JALA 4IYHA 4LF8B 4JKEA 3OYFA 1JQ0A 1JOYA 3MECA 4KREA 5HL7L 2LFSA 3CPWM 4HNAA 3AAQA 2NRXA 3QO7A 4QIWF 4GY2B 4OLAA 3AO3A 1MA1A 3FX7A 4EIAA 2DW4A 5C93A 1ZXOA 2UYTA 3CD6N 2RM24 2WLNA 1VQMN 1BU6O 4DV1B 3C6UA 1BI4A 4GX0A 1U2VA 4DF4A 4DR6O 3E83A 3K5LA 1HR0K 1I08A 1RT3A 3SYAA 4BDPA 1IBMB 4ZBMA 1XQ8A 2DYRC 1YI2V 1TUUA 4O4JA 3DMJA 5CE3A 3JAWB 4BWAA 4BW5A 2VQFO 1NK7A 1U04A 5KI6A 4M3ZA 2OZMA 1US6A 1XBLA 3PJSK 2UUAK 1ZP0A 2ATKC 4IG0A 1H2LA 3M99B 2HHHO 1D4XA 3CEIA 4PA7A 3ZYYX 4B9UA 1VIBA 3TTCA 1ATNA 3VPZA 4DTRA 4ISFA 3THYA 1IBLO 4OPJA 4DTXA 1R59O 4NB5A 1BL3A 1BT8A 3LANA 3O9QA 4KH6A 4KB1A 1H38A 3QLHA 1J5OA 1N34B 4IBNA 2AXTZ 3I55V 1SQFA 3SJBC 4J11A 2PI5A 1HPZA 2CH6A 4HUFA 3TAPA 1K3EA 1PVC4 4DKWA 2PFUA 2Q73A 4DW0A 3CQXA 1S3JA 2KW4A 3OFNG 4UB6Z 1QS4A 5KX5B 1KQSM 2XY8A 2JS3A 3RYHB 2Y48A 4CGDA 1DT9A 4W4LA 2IGIA 2RN9A 3NR7A 1KFDA 1TYQB 3AK1A 1NZ6A 4ELUA 1T03A 1NCQD 4U3FH 3BRCA 2QGNA 1Q6HA 4H4OA 4XEIA 4BRHA 4FMTA 5J1EA 4JI5K 3AE7A 4JI7B 4CHYA 3DLKA 5KPRA 4H5TA 3V9WA 1NK8A 3HPOA 3SCXA 4E1NA 1TUYA 4ICLA 2N04A 1JLAA 3D45A 3E22A 1ITGA 4BVOA 1WA8B 5GTHZ 4DTSA 4PL8A 4CJVA 3LDOA 1HNZO 3ZSRA 2RMU4 3AVBA 4DR1K 5KAIZ 4CH5A 1I94B 2JLEA 3AVFA 2DTUA 2UXCB 3OW2U 4P9PA 3MEGA 5KHJA 2IOCA 4TUYA 3TR8A 1C1CA 4TV9A 1SESA 2B9ZA 3H1HH 3DM2A 3VQ4A 5BR9A 3VQ7A 4ABMA 3L70H 4E1JA 3X2QB 1WB8A 3LUTB 3ISNC 3WFVA 1F4MA 1HNWB 3HPHA 3L8BA 3SFEA 3G71N 3K5NA 1NJXA 2AHYA 4FVMA 3EYZA 4DTJA 3B40A 4H03B 4DQIA 1R084 4XIUA 3NF9A 1V54B 3AE6A 2AGAA 4MTGA 3FB5C 3OEEG 1NGGA 1OOPD 1VBC4 1ZUQA 4RAIA 4LF6K 4Q20A 5AQLA 2AP1A 4CHZA 3SQ2A 1TAQA 4MW8A 5HRNA 1JLCA 2YI1A 2JRIA 1QVFM 3AVIA 3G0ZA 2PTMA 2E75B 3MHHC 1BGXT 4LH4A 1Q90D 1EWQA 3AK2A 5EYPA 3ABMC 5EU7A 1EAH4 1HNXK 1G6UA 1RDUA 1VRTA 1S0VA 3L0QA 3K0SA 3PX4A 4YNQA 3NH2A 1N36O 1OCRB 3G6EN 3QBWA 1NGDA 3CCEV 2YKMA 3QETA 4B3SK 3FD9A 4J9YB 2O57A 4EP5A 4BDYA 4DR2O 1TA8A 1RPOA 1K73W 4B3RB 1AR5A 3VQ8A 2CE4A 4K35A 1QU7A 3KLIA 4JYAO 1R6KA 3M3ZA 4CGJA 5KA5A 3PSFA 4W5RA 3QEIA 3E86A 2F9WA 4AQYB 4FM2A 3AG3B 3D8CA 1N34O 3ID6A 4KH4A 4MO4A 3J8F4 5AJ3K 1IV0A 3LDSA 2YC0A 3KKRA 4JI6K 2K9PA 5GONB 3ENHA 1PO24 1MOFA 2HNYA 1GN6A 3C95A 4L3QA 4NYFA 3SAHA 1SKWA 1LW0A 1E3MA 3OYAA 2W6IG 1KVBA 2CTRA 4Z94A 3CERA 3GBTA 5E41A 4FLXA 2Z1HA 2NN4A 1GLAG 5EBWC 4IEIA 4BE2A 3LDPA 4CE9A 5C25A 1SS6A 3ABLB 3RGBA 4B1WB 1KU9A 2YNIA 3K03A 4F4LA 2WP9A 1NG9A 4LFAO 3ZETB 3P4SA 1RBVA 1D9DA 4GYCB 5A2QO 2F23A 4FO0A 1JJOA 3O9OA 3AEIA 2B1IA 1Q6IA 3WT0A 2Q69A 4CGHA 1A32A 1G1XB 3E9OA 2OZSA 1XUPO 1C0GA 4JTCB 4JF3A 1JJ2U 2DPNA 1AI5A 5M1QA 4CF0A 3ETEA 4B3TK 3ZMTA 4KHPB 2BOBC 1N33O 4CBXA 5C10A 4CK3A 2WC9A 3R9PA 3FZKA 2ZE2A 3DXRB 4JI6O 1C0MA 4B9MA 1WOQA 4IWVA 2P9LB 5GIPA 4B1XB 1Y67A 1VQ9V 3Q7BA 4XH4A 5L3BA 4RCHA 4WFGA 1V55B 5KTQA 4B1UB 2LQTA 4BR0A 3D3QA 4LFBO 4YOXA 1AL24 4O55A 3BPZA 4E19A 1NK4A 1RUG4 1S1VA 2Y1JA 4PI2A 1H2GA 4FW2A 5AQXA 4JZGA 1AR64 4IIJA 4J2DA 4UB8Z 1Q43A 4H44B 2P9SB 2BE3A 3QERA 2WS3A 5IE9A 3FKSG 3JD4A 1QQOA 2IVPA 4X8AA 1RUF4 5IJ9A 4JNEA 1A5XA 1RT5A 3AVMA 3CJ7A 3JATA 2DQ0A 3MXJA 1LOTB 3AO5A 5J2QA 3C7NB 4CJWA 1KYOF 2Q7GA 2Q2RA 1KP2A 3WB2A 4BIUA 2VWJA 3WUHA 3G4SV 4DR7K 2W0XA 3J7YP 2JJ1G 4W5TA 2JVDA 4WQ4C 3AG2C 3ZMSA 4X66O 5LBQA 1HNVA 1REVA 1RTJA 1C1AA 1R3LC 2IC3A 4JI4O 5FPDA 3CCLN 3ZHUA 1JLQA 1K8AO 5LMUB 2OWOA 3F7VC 1XNRO 2GUZB 1DF4A 4DV5B 4O8KA 4ID5A 3O9RA 3P83D 4A5BA 1FJGO 3EE8A 4HTLA 1L3VA 1BEV4 1BA1A 5AQTA 2NNWA 1NK5A 1EFRG 3A5MC 4LY7A 1QQCA 3UCSC 1S77D 1ORQC 3UKMA 4CHOA 3H1QA 2KSDA 3CCUV 3O9UA 3CCQV 4Z0UA 3SPZA 4P30A 2F8TA 1QQMA 3AE8A 4GX2A 3ZBHA 5AQGA 4JHDA 5AFUH 3CRQA 2D3OW 1MSWD 4DWIA 2YDEA 5JJNB 3HT3A 1JPXA 1ZBUA 1L0VA 5B66Z 3PX0A 4DR1O 4F3OA 4CC6A 2E5LK 2VG7A 1PV0A 2AHZA 5IDJA 3CRMA 4CHNA 5DM6V 1RHI4 3A0RA 1QVGU 1OVYA 5E84A 1XMQO 4MVSA 5BR8O 4CFBA 1M56B 1HKBA 3OYNA 1Q6UA 4GKKO 2HVIA 3AEBA 5CN0A 2PBDA 5H6RA 1ZLZA 2CAZC 2X6CA 3CCJV 1AR1B 3BABA 1VSEA 2ZXWB 5KA6A 2CTWA 5JH7A 1Y6XA 4MTOA 3TAFA 1RT6A 2ZKOA 3RYFA 4CW7B 3AARA 2YHBA 1NLVA 3MXIA 3CC4N 4PA6A 2P9NA 1GLFO 2OPQA 4FCYA 3HRGA 4GNIA 3DI6A 3ALYA 1LWCA 5AQQA 4R6ZA 3H3OB 2H8PC 5H5NA 2VQEK 3VQAA 3WXMB 3ZX3A 1BCMA 3MN7A 3AE5A 1HNXO 4A5UB 3JASB 3MN6A 2QKSA 4DR4K 5BR8K 2O8DA 4LH7A 1POV0 4RW4A 1I39A 2DYSB 1W2BU 5B5EZ 3W7UA 3CFOA 3JXUA 1THZA 1E79G 1VSMA 3N4PA 3O1BA 2DYSC 1VQOV 1HNZB 3AVNA 5DM7L 4LF8O 1NGEA 2ASMA 1XL4A 4G9ZA 1KUQA 2UUCB 1EV14 3M7MX 1OCRC 4N23A 2D0AA 2A5XA 3AE1A 2C2AA 2RNBA 5IY5C 2ZJRL 3HB3B 1XC9A 2QKCA 2D5RA 4C7UA 1AR94 5CA0A 3B6OA 3CB2A 5H9CA 4JI4B 1Z05A 4DV2K 4B9TA 3CMAV 4NYNA 4JAUA 3BEXA 3GOIA 1YXBA 2F93B 1FXKC 4A2AA 5IJ0B 2RN2A 1JXEA
chains in the Genus database with same CATH topology
1W9HA 3N2GB 2KTQA 3SI6A 4N56A 3SUOA 4LSNA 3RR8A 4M3XA 4NCBA 4MQ3A 1VSFA 4CJRA 4LF6B 3UQ8A 3PV8A 4CESA 3IS9A 4N41A 1M93A 4JLHA 1L3SA 4E89A 5D5PA 3RYCA 1QHTA 5KRTA 1XMQB 1ZBHA 2HVHA 3ITHA 1ASVA 4EP4A 5LYJA 5CYQA 3MXMA 3JSLA 5ITZA 4AHCA 3TAQA 2X74A 3AVKA 4CK2A 3HVRA 4JI0B 4DTUA 1W0HA 1Z25A 4FK0A 4FLVA 2UUBB 3JAKB 4FJGA 2ZINA 3ULDA 1SL0A 4R5PA 2FC0A 4DV3B 2Z1GA 3V1OA 4DU3A 5KHHA 2E4LA 4DR2B 4NCAA 3OYKA 1T8EA 4CF1A 2D0CA 3NGYA 3N2GA 5JJJB 4BACA 4CIEA 1SKVA 4I50B 3QTCA 4DRXA 3O3FA 3HSTB 3LP0A 4LF7B 1J53A 2XRIA 1DLOA 4FZYA 3LAKA 3M8RA 3VQYA 4ELVA 2B5JA 1GOBA 4DTNA 4W5OA 1IBLB 3KJVA 4CF2A 3ASMA 4ZI7B 3DRPA 3AVLA 1KVAA 1U45A 1MU2A 2BTOA 1BISA 2BANA 4F2RA 5HRRA 5HRPA 3OYEA 5BMVA 2YNGA 4WBNB 4ID1A 2YKNA 4FJKA 3CYMA 4JI8B 4JV5B 4G1QA 1JLEA 4CFCA 4F8RA 4CJKA 1RT2A 4F4KA 3RMBA 2YIBA 1IKWA 4GVMA 2G8UA 3AV9A 4YJ2A 3QIOA 5SWMA 4UCUA 4EB6A 2YXLA 4KL1A 4EZ6A 1LWEA 3OYMA 1FJGB 1SQGA 3V9XA 1S1WA 4KI4A 3DRSA 4TV8A 4O2AA 3IRXA 4NCGA 5FNVA 1VK0A 3QESA 4OJRA 3OYBA 1LAWA 1NK9A 3RFRA 3PY8A 5CB4B 3V9ZA 4DTMA 5T7BA 4FJXA 3RTVA 3T19A 4DFMA 3QEVA 4E7IA 3OVNA 3THOA 4LR3A 4IFYA 5JH7B 1U49A 4D7SA 3F9KA 1L3TA 1TV6A 1Q9YA 4CEDA 2KZMA 1WAFA 2OPSA 5FRNA 5HBMA 3RMDA 2GV9A 2ITGA 3SUQA 1N6QA 4UCVA 4DV6B 3HP9A 4DV4B 2LSNA 1SUQA 1YVUA 4Y1DA 4Q5VA 4N47A 1BQMA 1BI4B 1CXUA 4CJQA 4BE0A 5JVDA 4QAGA 2KZZA 4PUOA 4AHSA 3VA3A 1U47A 1NK6A 1IG9A 4B9SA 1RSOA 4AHRA 4X1KB 5IJ0A 3V9SA 3SUNA 5FNVB 5KMGB 3OTOB 1L5UA 1NOYA 3U10A 1JMKC 3CFRA 3LWLA 3QINA 1V9PA 2F95B 1FKPA 1BQNA 1TAUA 3TI0A 4JI1B 5LXTA 3G10A 4GMJB 2Z1JA 2X6SA 1FXXA 4FLUA 4HCBA 1JFFB 1KSPA 2WOMA 3NE6A 4FJMA 4DSJA 2QM4A 4B3OA 4JI2B 4M3UA 3KD1E 4CGGA 1R0AA 4E7HA 1U48A 3SPYA 1YTUA 1WSIA 1Q8IA 1WAJA 3DLGA 5LOVA 3CQ8A 1KLMA 5C24A 1RNHA 2YV0X 1TL3A 1ASUA 1CLQA 1JFFA 3ZSOA 5CA0B 4PQUA 4ZI7A 1UA0A 5J2UA 4OGEA 1BIZA 4Z4GA 2UU9B 1JKHA 2HMIA 4CS3A 3KD5E 3OS2A 4LD0A 3ETQA 3FFIA 2ZD1A 1Q5OA 4E7JA 4DQSA 4J2AA 3T1AA 1VSLA 1EETA 4I50A 3LZJA 1TL1A 4CIFA 1K6YA 5LP6C 2PY5A 2EHGA 3DYAA 5FDLA 4I2QA 2W42A 1YT3A 4CFAA 3OYHA 5KHKA 4YJ2B 4B08A 1KTQA 5K14A 5I42A 4EB6B 2R72A 1WSHA 2IDOA 4OVLA 3BAAA 1N5YA 4ZIBA 4HBNA 3VQWA 1M4UA 3NFAA 2ETJA 3VQBA 4PI0A 2HHWA 2F66C 1JLFA 4UCSA 2FBTA 3MEEA 5KGXA 4CH6A 4DK1A 4KKOA 4B3TB 4CF9A 4KAZA 4KRFA 5KRSA 5K1PA 4DF8A 5ITZB 2RPIA 4CK1A 4RW8A 4I55B 2G8FA 5CZ1A 2OA8A 3I0RA 2KKWA 3TAMA 4M41A 3QNNA 3TANA 2RF2A 4CEFA 3AVGA 3ZT4A 1C1BA 4GKKB 4CC5A 4B8AB 3RMAA 1IO2A 1ZBFA 1Q3EA 4B8CA 4RG8A 4M42A 3DLHA 3NF8A 4JI3B 4FJ7A 4UFZA 3P1GA 4DR7B 3ZCMA 4O4HB 3HKDA 3PO4A 1CZ9A 1BCOA 5IYZA 4I9QA 3HPGA 4RW7A 3LP1A 2QXFA 4WE1A 3WB0A 4FLYA 3RWUA 3S3MA 3OS1A 2VQFB 4E7LA 3S3NA 2BTQA 3K5MA 4KHUA 1TVKA 2QKKA 2A1RA 3OS0A 1O9HA 1NT2B 5LA6A 4M3TA 2O4IA 2UXBB 2XO7A 1U4BA 1RT7A 4DSEA 1P49A 2YIBD 2HB5A 5JVDB 2I5JA 3CM6A 3LWMA 3HO1A 3CHXA 3HKCB 1T05A 4CJTA 5KX5A 3LP3A 5JS1A 4BDZA 1RBSA 4H4OA 4K8ZA 2ZNIA 4KPYA 1TKZA 3CSXA 4CEEA 2P1JA 3JSMA 3BA9A 3V4IA 5DMRA 1HYSA 3NGZA 4KHNA 3SGIA 4GKJB 4KO0A 4Z4FA 4FJNA 2IAJA 1QSLA 2P22C 4O4GA 2Q7HA 2F8SA 4CEBA 1VSHA 3O4NA 5IYZB 2YI8A 1NK0A 4O4IA 3B2EE 4CJUA 4KB0A 4FFBA 1VRUA 4KHYA 4DQQA 4CS4A 4FJ5A 3RYFB 1EXQA 3QEPA 4NXMB 4BE1A 5EYPB 3VQ9A 3AVHA 3U6FA 1BIUA 3N2KA 4FK4A 4CHQA 1UA1A 4O5BA 4O44A 3U11A 4I2PA 1GOCA 4X20A 3QEWA 3NGIA 2VQEB 2NUBA 3AVCA 2Q7EA 4AHUA 3VA0A 2UUAB 2G8IA 4F3TA 4K0KB 2XHBA 3SQ1A 3ZEDA 5C8YB 3CFPA 3B6PA 1SA0A 3ZT2A 2HHUA 4DTPA 4CHPA 3OJSA 4X1YA 3DRRA 4BWJA 4TV9B 4YHHB 2ATQA 1QE1A 5IWAB 1T7PA 1FK9A 3TAGA 4L8JA 2F4VB 2UXDB 4DR6B 1DTQA 2PW9A 1WSJA 3BHPA 4CEAA 4X1YB 3OYJA 2DFFA 3UT5B 3KK2A 3LAMA 1RDAA 4IIJB 1KVCA 2IS3A 3H08A 2P5GA 3VN5A 2Z1IA 2GBZA 1C0TA 3ZSXA 4TOIA 4O4HA 3PX6A 4O4LA 3RRHA 1RBUA 5CZ2A 4QOZB 4YY3B 4PWDA 4FJJA 1JLGA 4KI6A 2OPRA 3VQ5A 4DLGA 1BHLA 3K2PA 3O3HA 1TKXA 4IDKA 3RMCA 1D8YA 4W5QA 1DTTA 4CJ3A 2D0BA 4F2SA 3NF7A 2HHQA 3CG7A 1TK5A 5JJEB 4FW1A 4LSLA 5CY4A 4EEQA 4CIGA 3HJFA 4JYAB 4DFKA 4DFJA 4ZTJA 2PUSA 4N76A 4O2BB 3DLRA 4JI5B 4CEZA 1TVRA 3C94A 3OTFA 1LWFA 4FZXC 2DY4A 4O0IA 3QEXA 4FLZA 1XNQB 4KFBA 2E5LB 4M3YA 3O4QA 3NAEA 1I7FA 2RKIA 3ZSQA 2O4GA 3JATB 2E3CA 4CS2A 1SL1A 4CERA 2RJZA 4C8NA 4KTWA 4I4TA 4O4LB 3HVTA 5EZYB 3P5JA 4DRXB 4Y1CA 2HNDA 1QTMA 4Z4HA 4TSXA 1X9WA 1RBRA 4BW9A 4JS5A 2FBYA 4I4TB 3JAWA 3L3VA 3PO5A 4YJ3B 3QF7A 2ZM6B 2R70A 4PHZA 2Q3SA 4LNUB 4HUGA 5I3UA 2R9AA 1RT1A 1ASWA 4O2AB 1A5VA 3ICXA 2Q0AA 3VQEA 3T1HB 3T1YB 1N33B 3K57A 4DR5B 5KHGA 1NKBA 3ZSYA 1HQUA 3SQ0A 3RWRD 4FLWA 4CJ5A 2BTQB 3SQ4A 4M3RA 2X78A 4EFEA 4F6RB 4DQPA 4PY5A 3M8SA 3QNOA 3ZSZA 5KHIA 1XWLA 3TARA 5JS2A 1NJYA 1YEWA 3F73A 3E22B 1RCHA 1C6VA 4LFCB 1Q9XA 3S9HA 4L8RB 4M45A 3OYGA 4E3SA 3WNGA 1EP4A 1SL2A 1HYZA 4X20B 1WSFA 1KMIZ 4TUYB 4CJPA 3V1QA 4C8MA 4FJHA 4X65B 5HLFA 4KHSA 1TAEA 3SJAC 1HNXB 4X66B 3OYLA 5BMVB 4Z4EA 3M8PA 1C0UA 1XMOB 5FROA 4J2EA 2ZNJA 1J5EB 4DS4A 5J2UB 3HKBA 3U0ZA 3KTQA 4FJLA 2RQ6A 1IBKB 1S1TA 4LFAB 4HNAB 3LP2A 4FLTA 2HHHB 5FPRA 3D0PA 1RTIA 1TUBB 3KLGA 4DUYB 5JQGB 2VG6A 5J2TA 2HNZA 2FBXA 4E7KA 4O4JB 4CF8A 4CJSA 1UWBA 1NKEA 1JXBA 3OJUA 2P5OA 4DSFA 1SKRA 4E0DA 1FFXB 2HHVA 4X62B 2X6NA 3HL8A 4AHTA 3A2FA 5IJ9B 3SUPA 1NJZA 3JAKA 4E1MA 1TKDA 5CB4A 2G8HA 5J2NA 4OX9B 3HYFA 3MAQA 2G8WA 2KFNA 4AHVA 2E6LA 3AA5X 1EX4A 3OYIA 3QIPA 3I8DA 1A5WA 1KFSA 1HMVA 1B9DA 4CCHA 1DGSA 4B3MB 2OZSA 3HKEA 1Z5VA 2E6MA 1XHXA 4RW9A 2VWKA 4DFPA 3TWHA 4LF4B 1WSGA 1QSYA 3HKCA 3ZT1A 4CJEA 4B9NA 4LH6A 1X4TA 4DG1A 1H2SB 5EIBD 3SJCC 3KLHA 4C8KA 2V4DA 2KFZA 4ZOLB 5CYMA 1KRPA 3WNFA 5EIBC 3VQVA 3VQCA 4FYDA 1RILA 1T5EA 1LW2A 1FFXA 3AA4A 3C6TA 5KMGA 1XHZA 3NH1A 2DFHA 1TK0A 4X1KA 3O3GA 4IHJB 1UAXA 2WONA 5J2MA 3JARB 4JI6B 4DSLA 1Y97A 1UOCA 4DU1A 4FK2A 3RYIB 3U3GA 3E01A 3HXMA 1TGOA 1RT4A 3AA2A 5GONA 5D5QA 3WNHA 4FJ8A 2ZQBA 4KV8A 1S9EA 1WPBA 5LP6A 1VSKA 1JL2A 4ZHQB 3CM5A 3FI7A 2ZIMA 5LOVB 1ZBLA 3AO1A 4X64B 1Z5WA 3VQXA 1KLNA 3L2QA 3SV3A 2ZIOA 3HM9A 4DR4B 4JRPA 2XY6A 1O9GA 3M8QA 4BWMA 2P51A 1CZBA 3NDKA 4C8OA 4OKEA 3I0SA 1J9AA 1WNSA 2AJQA 3V6DA 3ZSVA 3JYTA 3DSQA 2A1SA 3PUFA 5HROA 3AA3A 2BDPA 4OGCA 1LAVA 4DK0A 1RTDA 3RYCB 3NH0A 4O4IB 1HRHA 3RYHA 4KTQA 4YJ3A 3WB1A 3NBPA 1RDDA 1TKTA 4I7FA 2YNFA 4YFUA 3DOLA 4FJIA 5LA6B 1RDCA 4ZHQA 4FJ9A 4NVPA 1M5IA 1G15A 5FRMA 4LF9B 4DV7B 1WLJA 3SNNA 1X1PA 4JRQA 3HK2A 1X9SA 3V81A 3RRGA 4KHQA 4LF5B 4JS4A 3K58A 2DFEA 1IKYA 3VQQA 5HRSA 1CXQA 4I55A 1TUBA 1TK8A 1X9MA 4OKKA 1S1XA 2F96A 3HKEB 2PGGA 4LNUA 4UQGA 3RYIA 4IG3A 4UCTA 4DS5A 3HP6A 4DSIA 4KTZA 4DQRA 3SYZA 4D7TA 4B3SB 4CFDA 1NKCA 2HHSA 3KLEA 4CECA 3EZ5A 1JXEA 1F21A 4HTUA 3LPTA 2XY7A 4FXDA 3NHGA 4F6RA 3AO4A 1SKSA 1RBTA 3L2RA 4HHTA 1EKEA 4CJLA 5HP1A 2HHXA 3BDPA 1NOZA 3HKDB 4J2BA 4W5NA 4DMNA 1JLBA 4IHJA 3IG1A 4CEOA 2YI9A 4TQFA 4CJFA 4DV0B 4DUZB 4H8KA 5J2PA 3NF6A 4OPKA 1TVKB 1NJWA 3KIOA 4DU4A 5DK5A 2VG5A 3NCIA