2PZSA

Phi29 dna polymerase complexed with primer-template dna (post-translocation binary complex)
Total Genus 165
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
165
sequence length
571
structure length
571
Chain Sequence
PRKMYSCAFETTTKVEDCRVWAYGYMNIEDHSEYKIGNSLDEFMAWVLKVQADLYFHNLKFAGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLGYKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKNDIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRGGFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHIRCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYISGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKENGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIPDVIKDIVDPKKLGYWAHESTFKRAKYLRQKTYIQDIYMKEVDGKLVEGSPDDYTDIKFSVKCAGMTDKIKKEVTFENFKVGFSRKMKPKPVQVPGGVVLVDDTFTIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Replication, transferase/dna
molecule keywords 5'-d(GACTGCTTAC)-3'
publication title Structures of phi29 DNA polymerase complexed with substrate: the mechanism of translocation in B-family polymerases
pubmed doi rcsb
source organism Bacillus phage phi29
total genus 165
structure length 571
sequence length 571
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2007-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03175 DNA_pol_B_2 DNA polymerase type B, organellar and viral
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.690 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2pzsA04
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 2pzsA01
3.30.1770.10 Alpha Beta 2-Layer Sandwich TPR 1 domain of DNA polymerase TPR 1 domain of DNA polymerase 2pzsA03
3.90.1600.10 Alpha Beta Alpha-Beta Complex Palm domain of DNA polymerase Palm domain of DNA polymerase 2pzsA02
4.10.80.20 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 5 2pzsA05
4.10.80.30 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 DNA polymerase; domain 6 2pzsA06
3WNEA 4AHSA 4CF1A 1ASVA 3LP0A 3ZT4A 1KLMA 2E4LA 3OJSA 5J2QA 3QIPA 2PW9A 4FLZA 1WAJA 4DQQA 1U49A 1NJYA 2OA8A 1Y97A 4B9MA 4KI4A 4FXDA 2GBZA 1XC9A 1LWFA 2A1RA 2RKIA 1D5AA 2KW4A 2OPQA 2YV0X 2Z1IA 1S5JA 1SKSA 1W9HA 1ZYQA 4B8CA 4K8ZA 3LAMA 4M3XA 3K5NA 2HNZA 4CK2A 1U45A 4QAGA 1RT5A 4Q0BA 1NK7A 1GOBA 3DRPA 3SQ1A 5FDLA 2DY4A 1RTIA 4FJMA 1VSIA 4OVLA 3OY9A 4KREA 3TAMA 3CM5A 4HUEA 2IGIA 4DSEA 4CJTA 3AVCA 3DLBA 1VSMA 5KGXA 3O3GA 3HM9A 2HVIA 5CY4A 4BWMA 4LSLA 3TAGA 1UA0A 1JLCA 1RBVA 3HT3A 3JSMA 4UQGA 1RILA 3LAKA 4B9LA 1NK4A 1YVUA 2HHWA 5HRRA 4IDKA 3VQ5A 2OPSA 4E7LA 3TABA 3NF6A 2Z1GA 3VA3A 4FVMA 4CFCA 3HVRA 1TV6A 2IDOA 3DLGA 3TANA 4GMJB 2FBTA 3KKRA 1NKCA 4DFMA 3SPYA 3TARA 1X9MA 4IBNA 3V9XA 3MEDA 1CXUA 1VSJA 1QQCA 1O1WA 1C0MA 3OYKA 1RDCA 2G8WA 1VSHA 2P5GA 4CEEA 4B9UA 5DK5A 5HROA 5SWMA 4AHCA 3PUFA 3QERA 4MQ3A 3ZSRA 4CJ5A 4ELUA 3AVMA 4CEDA 2PY5A 4FW2A 4O4GA 3OYAA 1WN7A 3AVKA 3OYNA 4H4MA 3VQQA 1TAQA 4Y1DA 4DTMA 4W5OA 2VG6A 1N6QA 2QK9A 3DLKA 4FJHA 3SUPA 3AO2A 4KFBA 4NCBA 3T1AA 4EP5A 4K8XA 1JLEA 1RBRA 4Z4FA 2D0CA 5CZ2A 3KK3A 3L3VA 2XY8A 3PX4A 4C8NA 4NYNA 4C8OA 4KHYA 2HHQA 4CJ4A 3RTVA 1HMVA 4NYFA 2Y1IA 4FZZA 3QNNA 3P5JA 1WAFA 2YNGA 3C6TA 4DSLA 4CEAA 2Q3SA 3LWMA 4FJ7A 2HHTA 3I0SA 4CF8A 4CFDA 3V9SA 4CE9A 1LW0A 4ID1A 4DWIA 1S6QA 3ZSVA 3M8SA 1LAVA 3HL8A 4GW6A 3NHGA 2B4JA 1VSFA 4ZTFA 1U48A 4B9SA 4DTSA 5J2NA 1LWCA 4DU3A 1EKEA 3IS9A 3KLFA 2WOMA 1ITGA 2GUIA 1QSYA 3S3OA 3RR8A 4OLAA 3OYBA 1QHTA 2Z1JA 3KLHA 3ULDA 3PX6A 1S9GA 3ITHA 3WNGA 2OZMA 1RTHA 3AVFA 3KD5E 1J5OA 2KFNA 4FLWA 4EP4A 3VQ7A 2FBVA 3L8BA 4AHUA 4KHSA 1YT3A 3H08A 5E41A 1EP4A 2I5JA 3OYJA 1ZBLA 4EZ9A 4F4KA 3RRHA 2D0AA 5DMRA 4PWDA 3OYFA 3RMAA 1HNIA 4N5SA 2G8FA 1JL1A 4BE2A 3KIOA 3SQ4A 4CEBA 4CECA 3SCXA 3HO1A 4PQUA 1U04A 4FYDA 1BL3A 4O44A 3EY1A 4B9VA 4DTPA 5HRSA 1QS4A 3E01A 4DQRA 1KLNA 3TAEA 1U4BA 2HHXA 3QO9A 1DLOA 4RW8A 3NGZA 2G8VA 4CGDA 1L3UA 4KAZA 4FJKA 1LAWA 4LH4A 1B9FA 1KTQA 4W5RA 1EXQA 2W42A 5I42A 3O4NA 2OZSA 2HVHA 4QCLA 1FKOA 3P83D 4DMNA 1B9DA 1A5VA 4CJEA 1WSIA 4DFKA 3V81A 4I9QA 4PUOA 2IOCA 2DFFA 3KLEA 1UOCA 4I9LA 3LDSA 4GVMA 4CJLA 4BE1A 2Z1HA 4LY7A 4F2SA 4OLBA 1S1XA 4CF2A 3SUQA 3SV4A 3LP3A 4CK1A 4WE1A 4FLYA 4CF0A 4E1MA 1JL2A 4G1QA 5I3UA 1HQEA 3V1RA 3LANA 4M3YA 3SQ0A 1KFSA 4F3TA 4CGFA 1CLQA 1SL1A 4LSNA 2G8UA 2X74A 1W0HA 3AVLA 2OPPA 4JLHA 4CHPA 1NK6A 2QXFA 2PYJA 2B6AA 1BCMA 1WSGA 1CXQA 4LD0A 4DTJA 3DOKA 5KTQA 2IC3A 2BDPA 1JXEA 4W5NA 3DI6A 3AVHA 3PX0A 3KD1E 1SV5A 3IG1A 3V9WA 1HRHA 3TWHA 1L3TA 4HHTA 3BDPA 4DSIA 4DQSA 3MXMA 4AHVA 1BHLA 2G8IA 3C6UA 3EZ5A 1NJWA 4FJGA 4CIGA 5FRMA 2ATQA 1XHZA 4KB1A 3ASMA 2BE2A 4W5TA 1RDDA 2PZSA 3K58A 2DFHA 4DTOA 1Z26A 4HTUA 4M3RA 3O3HA 5CYQA 1T8EA 3NBPA 1Q9XA 3QEXA 4BDPA 2OYQA 4FJXA 1GOCA 3ALYA 4CGGA 1QE1A 3HPHA 1T7PA 4Z0UA 4E19A 1HQUA 1L5UA 3L2UA 3AVAA 1WSFA 2FBYA 4DS4A 4DTNA 4DF4A 3OS1A 1BI4B 1BQMA 1IKWA 1I39A 4ICLA 1CZ9A 1WSHA 2O4GA 2X78A 1ASUA 2YNHA 5J2PA 4DSKA 3HK2A 1DTQA 4Z4HA 4FK2A 2ITGA 4DTXA 5HBMA 2QKKA 4I2QA 2JGUA 3SNNA 4L8RB 3AA5X 3KTQA 3QETA 1U47A 1YTUA 3SI6A 2VWJA 3CFOA 3VQDA 4Z4GA 2E6MA 4NCGA 1DTTA 1C0TA 3CYMA 2F8SA 3HSTB 1G15A 1RT3A 1N5YA 4KTZA 4N76A 4BWJA 3OYEA 1RT4A 4CIFA 5FROA 1TVRA 2YHAA 4CJUA 4B3OA 1REVA 3ZSQA 4CFBA 3L2QA 2YKNA 1UAXA 4RW6A 4CIEA 3AVGA 3OYIA 3EYZA 1NJZA 4KB0A 4C8MA 4JRPA 4HUFA 1BQNA 3KK2A 4E1NA 3ZSZA 4CJKA 1TK0A 3ZSWA 4FZXC 4Z4CA 2XRIA 3NF9A 4ELVA 1FXXA 1IO2A 5T7BA 2F96A 4KRFA 3QNOA 1BISA 4F3OA 3VQ8A 4KPYA 4HCCA 3LPTA 3DLEA 3K5LA 2P1JA 4N56A 1SL2A 3MAQA 4FK0A 4CHOA 4YNQA 4MFBA 4FM1A 1RTJA 2KQ2A 2DFEA 4JS5A 3U6FA 3ZSYA 4CEFA 2FC0A 1LV5A 4FJIA 2YKMA 3C95A 3LZJA 1JXBA 3CG7A 4I2PA 5CZ1A 1ASWA 3DM2A 3LALA 3SPZA 3THVA 5C25A 4KV8A 4R5PA 1VSLA 4CJWA 3SUOA 3JYTA 1KSPA 5JS1A 2KZMA 1LW2A 2EHGA 3LP1A 3KLGA 1TKZA 1IH7A 1VK0A 3MXJA 2R7YA 3PO4A 4DQIA 3OYCA 4QOZB 3AO5A 3DLHA 4F2RA 1K6YA 1KCFA 3TR8A 3RMDA 1UWBA 4OGCA 1KVCA 3WNFA 4M42A 3V1OA 1S6PA 2JLEA 2HB5A 4AH9A 4FJ5A 3RMCA 3I8DA 5D3GA 2OPRA 4BE0A 4FJ8A 1A5WA 3K5MA 4AILC 5HRPA 4CFAA 3SUNA 4KHWA 4CJVA 3K57A 1JLAA 1YTAA 3OYDA 4RW9A 1TL3A 3L3UA 1RNHA 3TAQA 4O55A 4Z4IA 2DTUA 1S1TA 3VQCA 4Q5VA 3VQ9A 5J2MA 4IFYA 1SKWA 3ZT0A 2IS3A 3WNHA 1UA1A 2KFZA 1S1VA 1NK8A 2XHBA 1EX4A 2VG5A 3AV9A 4IG3A 4OGEA 4CJQA 4E89A 1VSEA 3KK1A 1KRPA 4PY5A 2KZZA 4OKJA 3HXMA 3BGRA 4XIUA 3SZ2A 1WSJA 3AA2A 4C8KA 1XI1A 5J1EA 1BCOA 1RT6A 2D5RA 4CJRA 5HLFA 4M3ZA 4FK4A 2EX3A 4N47A 5EU7A 3CM6A 4DF8A 1HYZA 4FW1A 1C0UA 4DU4A 3KKSA 2XY5A 3NF8A 4FLVA 3HYFA 1JLBA 2RN2A 3DRSA 4DTUA 5JS2A 3OS0A 4DSJA 3OJUA 4FJ9A 1WNSA 4KKOA 5C24A 3ZCMA 4I7FA 1BIZA 4H8KA 3ISNC 4Y1CA 3LWLA 2HHVA 2QKBA 3MEEA 3CFPA 2NUBA 1JLQA 3QLHA 3QEWA 3RRGA 5K14A 2G8KA 1VRUA 3HJFA 3VQPA 5KGWA 1T05A 1Z25A 4E7IA 1HYSA 4FLTA 3B6PA 3NAEA 1C1AA 3NE6A 3CFRA 3A2FA 4ZHRA 3NH0A 2XY6A 1R0AA 4CGHA 1VRTA 4OPJA 3NH2A 4E3SA 1MU2A 3QEVA 3V4IA 3OVNA 3V1QA 4CGIA 2LSNA 4CJSA 3NCIA 3KJVA 4IG0A 2ZQBA 4DG1A 4CK3A 1S9EA 4ZTJA 4KTQA 3DRRA 4FLXA 3G10A 1J54A 3QIOA 5HP1A 3DOLA 1ZBFA 4E7KA 3V9UA 2A1SA 4HCBA 4B8AB 3ZT2A 1XHXA 2XY7A 4KHNA 4FM2A 3LP2A 1NKEA 1TL1A 3IAYA 1RBUA 1TKTA 1HYVA 3M8QA 3G0ZA 4CHYA 1C1BA 3AVJA 2XO7A 4ID5A 4BDYA 3SV3A 1QTMA 3P1GA 3FFIA 3IRXA 4BDZA 1IG9A 4M3UA 3OYMA 4M45A 4CHNA 4YFUA 3AVNA 1IKXA 2O4IA 3K5OA 4C8LA 4JRQA 3SYZA 4CERA 4DS5A 3HP9A 1KFDA 5CYMA 3QESA 3VQ6A 4HVJA 2ZD1A 3AO4A 4M3WA 2P51A 2BGGA 4J2DA 1RBSA 4AHTA 4DFJA 1VSDA 2YNIA 3S3NA 3K59A 1WLJA 1NKBA 3ZSOA 4CGJA 4OPKA 1HPZA 5KRSA 1WSEA 4H4OA 3VQEA 2RF2A 4TSXA 4DLGA 1RT1A 1T03A 3OYGA 1KVAA 1NJXA 3PV8A 4E0DA 4Z4EA 1C6VA 3ZT1A 2Y1JA 3PO5A 3T3FA 4J2BA 3AO3A 1RTDA 3QEPA 2BANA 4ELTA 3RR7A 3K2PA 4CJPA 4FJNA 3ZSXA 1TKXA 4OKKA 3L2RA 4CEOA 4CJFA 1I3AA 3VQAA 4B9NA 1IKYA 4KO0A 4FJJA 3NFAA 1VSKA 3FI7A 4CHZA 4B9TA 4FLUA 1RBTA 4OKEA 3HPGA 2IAJA 2R7FA 1B92A 3S3MA 4IKFA 2YHBA 2E6LA 2HNDA 3VA0A 4M41A 3RMBA 4DTRA 1JKHA 5KI6A 2F8TA 1QSLA 3AA3A 1S1WA 4J2EA 1JLGA 1XWLA 4RG8A 4E7HA 3S9HA 3B6OA 4DLEA 5HRNA 3HVTA 4AHRA 1HNVA 4FJLA 3T19A 3D0PA 3PY8A 3O4QA 2X6SA 3OS2A 3NDKA 3KLIA 4PA1A 3VN5A 4W5QA 1NOYA 3AO1A 2HHUA 2FBXA 3MEGA 4CHQA 3OYLA 4DU1A 1QSSA 4EZ6A 1RDAA 3LPUA 3AA4A 4DSFA 1JLFA 4LH5A 1TK8A 3V6DA 1BI4A 3U3YA 3NH1A 3CQ8A 1ZBIA 2X6NA 1Q8IA 1J53A 1J9AA 2PYLA 3MECA 4OJRA 2ZE2A 4BACA 5SZTA 1FKPA 3SJJA 4O0IA 3I0RA 3SQ2A 1SL0A 4CEQA 1D9DA 3AVIA 3HPOA 4IFVA 4O0JA 3OYHA 1S1UA 2AJQA 1IKVA 4DQPA 3NGIA 3RWUA 1SUQA 1TGOA 4KI6A 4CEZA 1C1CA 3V9ZA 4FCYA 1NK5A 1L3SA 2HMIA 4NCAA 4CJ3A 1F21A 4RW7A 5C42A 1GOAA 3HP6A 3U3GA 1BIUA 3DYAA 3TAFA 1CZBA 3VQ4A 4E7JA 1X9SA 4CCHA 3L2VA 3DLRA 3NF7A 3M8PA 1RDBA 2RPIA 3L2WA 3ZT3A 3MXIA 1X9WA 3NGYA 2VWKA 3VQBA 4KHUA 4CESA 4N41A 4M3TA 3C94A 2P5OA 1RT7A 1ZBUA 2D0BA 3D45A 5FRNA 1D9FA 3TI0A 2KTQA 2B5JA 2VG7A 2WONA 1EETA 3LZIA 4RW4A 1TKDA 1RCHA 5KRTA 4KTWA 1A5XA 3F9KA 1LWEA 2GV9A 1HJRA 4HUGA 3TAPA 4B08A 1KVBA 1L3VA 2HHSA 4FZYA 1RT2A 2YNFA 4O5BA 3UIQA 4F8RA 1ZBHA 4JS4A 1NK0A 1NOZA 2HNYA 1BGXT 3DMJA 4DFPA 1TK5A 4J2AA 4KHQA 1SKRA 1FK9A 3AVBA 2ETJA 4FM0A 2HW3A 3O3FA 1D8YA 2G8HA 1Q9YA 4CF9A 3F73A 3QEIA 1NK9A 3QINA 1TAUA 1X1PA 3M8RA
chains in the Genus database with same CATH superfamily
3E86A 3MD0A 2FB5A 3ZT4A 1KLMA 2E4LA 2PW9A 1U49A 3O9OA 4HNAB 4JZGA 4DQQA 4KI4A 3SMSA 4FXDA 3KZIZ 3WB0A 2E75B 4I55A 1A32A 4NB5A 1SKSA 2F1MA 1ZYQA 3LAMA 3FFKB 2XUMA 3ASNC 4K35A 4DV3B 1WAZA 2NRVA 2RHKA 5FPOA 3TAMA 4BIZA 4MO5A 5TKYA 2OTJN 4DSEA 1IZ3A 4CJTA 4UUJC 1DGSA 2K1EA 3O9RA 2UXDO 2ADPA 3PSFA 2UXBB 1MSDA 5LJVA 1IX9A 3T1CA 1RBVA 3JSMA 4MVSA 4DR4K 2WSSG 5HRRA 1AI4A 1TVKB 1K8KB 4BR2A 3J80O 1QVFU 4WBNA 2LGWA 3EHBB 2IH3C 3TABA 3KWGA 4JI3K 5GIOA 1TV6A 2XOKG 3VOUA 1YJWN 4YSYA 2FBTA 1NKCA 1FXKA 1U97A 1BQZA 3A8YA 3V9XA 1CXUA 1VSJA 1VF7A 1JPXA 2LFRA 5KQ8A 3OYKA 2CTQA 3EFFK 4EAHD 3HM8A 4CEEA 4B9UA 5HROA 5SWMA 3AG2B 1EV14 2O8DA 2PY5A 3FR0A 4O4GA 3OYAA 2QWQA 4WFAL 1B04A 4LFAB 1GLEG 3J8AA 5AQQA 3VQQA 3SPCA 1N6QA 2FL4A 1US6A 4X1IA 3ABTA 4KX6A 4NCBA 1RUF4 5AQYA 3T1AA 4FOIA 4EP5A 3B77A 3NXSA 4A62A 4P2ZA 5CZ2A 3KK3A 1GH6A 2XY8A 5CA3A 3C0BA 3L3VA 2HHQA 4KHYA 2Q68A 1B3QA 2P9UB 4BIUA 1I94O 4X89A 1R59O 1SC5B 3BA9A 4B9QA 2HP8A 4IIJA 5KMGA 2RS54 3JXUA 4KP4A 3P5JA 1WAFA 1YI2V 1HDJA 1L0NH 2NRRA 2YNGA 4FPBA 2Q3SA 4CEAA 4FJ7A 4CF8A 4JKGB 1R3KC 1P7BA 3MN7A 3BZCA 4DWIA 3ZSVA 1T6CA 3M8SA 3HL8A 2ZXWB 2JWLA 1M4UA 2DPNA 3JAKA 1K8AW 2HBJA 3WXKA 3ETGA 1GLCG 1EKEA 1YF5L 5GADP 2WOMA 1ITGA 1SF9A 2YICA 3GWOA 3OT7A 3AGRA 5FPNA 3MN6A 3RR8A 3O4WA 3ULEA 1QHTA 4JAXA 5GAHP 2Z1JA 3KLHA 4DR2B 3ULDA 1VQLN 5C12A 4RAIA 4RQEA 3ITHA 1N34K 1HNZB 3AVFA 1J5OA 1BU6O 4FLWA 3VTHA 1Q82O 4CC5A 4YOXA 3MHHC 1YT3A 5E41A 1EP4A 5BR9A 3OYJA 3CXCM 1ZBLA 2D0AA 3O9QA 1GM7A 1ZUQA 1HNIA 4BC2A 4JI4O 5LMUO 4YJ2B 1HKGA 4BRFA 5C15A 4CEBA 3SQ4A 2GX9A 3ID6A 3TSQA 1U04A 3HO1A 2GTDA 4O44A 2Y69B 4J11A 3E35A 1N33B 4GV6A 5LHGA 4DUYO 4LH7A 1VQNV 3E01A 3WXIA 4Z94A 3QO9A 3CMAV 2ZJQL 3ABVA 2R9RB 4JAVA 4RW8A 1EBOA 2A42A 3BAAA 1XMOO 5I42A 4Z2WA 2CH6A 3AAPA 2UU9K 1PO24 4BRNA 3EXAA 2ADQB 4LFBK 1OJHA 4BG8A 4DFKA 4C23A 4LBEC 3V81A 4IJNA 3TTFA 2QM4A 2IOCA 3DWLA 1M90W 2WTUA 2BCCH 4HTLA 1JQ0A 3JALB 3CQXA 4MTFA 3CPEA 4CJLA 2R044 2Q67A 2ITCC 2CAZC 4CF2A 2ZM6K 3L75H 1AL24 1FXHA 5AQIA 2RE2A 4FLYA 3U9DA 4M3YA 1XNQO 3LANA 3K0GA 2YHWA 1CLQA 1PKXA 4B3TO 4LSNA 4PA3A 4LF4O 3ZLJA 1J5EO 2QXFA 1BCMA 1VQ8N 4YDUC 3TTCA 4LD0A 4DTJA 3DOKA 2ZCEA 1VQ9V 2IIRA 5BPNA 1W2BM 1JXEA 3RYCB 1HW7A 3FGUA 2O8EA 5HFLA 2WLLA 3TWHA 2DQ3A 5KHGA 3CHXA 1TUYA 5BPLA 3P4IA 2FMLA 4JV5K 3GQKA 2E88A 2DMXA 4PA9A 1AI6A 3EZ5A 1UPGA 2ZKOA 2YXHA 1RDWX 3LSUA 2ATQA 3ASMA 2BE2A 5BR8K 2VQEO 1XMQB 2CGLA 1IVSA 2DFHA 4DTOA 5IYZA 4RWTA 2JVDA 3O3HA 2RNBA 1P8ZA 3FYEB 4U3JA 3LM9A 2OCCB 5EOYA 3APQA 1VMGA 4CGGA 2B1IA 2HVKC 4DR5O 1IXMA 1HQUA 3SYPA 1BQMA 4G2KA 1P49A 1R3LC 4DSKA 4MVZA 1PL4A 2ASPA 3CCEN 3IMXA 2F66C 3WG7B 4TSFG 4I2QA 3P39A 4GVEA 4GZRB 3T1HK 1YJNV 3KTQA 1MSWD 1U47A 3D6RA 3ZEUA 5KHHA 4DR3B 3B8MA 2VWJA 2F4VB 4FOEA 1V55C 2N05A 3AEAA 1C0TA 3CYMA 2VGNA 1BGYH 1NM1A 4B3RO 3OYEA 5B1BB 3AEGA 4W4KA 1TVRA 4CJUA 4B7KA 1NEKA 1QHAA 4DR6O 3L2QA 1UAXA 3AEBA 3AVGA 3EYZA 2ZGZA 1W7AA 4KXRA 4HUFA 4PL8A 2QWPB 4KUMA 1NNEA 5BRFA 2CH5A 4X20B 4B3MK 2Y48A 1ASJ4 1IBMO 5GONA 1VQ5N 3J7YP 5T7BA 4CD3A 1R6KA 3QNOA 3AG4C 3ABKB 2ZDIC 3VQ8A 5FPDA 2RM24 2LP7A 2X0LA 2P1JA 4CW7B 1GLAG 3F2KA 1Z05A 1VQOV 2YI9A 2QM1A 4MFBA 4QS7A 4B1VA 1VQKN 4DV0O 4JI6O 4F4LA 4PKGA 3ZSYA 3UKRB 2DN9A 2QI2A 3CG7A 4IYHA 3GVMA 2P9PB 4B1UB 3SPZA 5C25A 5H6QA 4CJWA 3RYIB 1FXKC 1KSPA 4JI8O 5JS1A 3LP1A 3MHSC 4EFEA 1TKZA 2GWKA 4NTYA 3PO4A 2CH7B 3EN9A 5EIBD 3AO5A 3DLHA 3UKUB 4F6RA 4OGCA 3H45C 1MDUB 4M42A 3W0LA 1W59A 3EE9A 2HB5A 1KKCA 2Z3YA 5ADXH 4X66K 4JI4B 5A9GA 4GUNA 3K5MA 3SJAC 3R6MA 1V4TA 1QZ5A 4R79A 5HRPA 4CJVA 3SUNA 1QVGM 1NBWA 3P38A 4DR7B 2CDYA 2AZ0A 3SLCA 2Q5ZA 2Q7GA 5DM6V 2ZINA 1GLFO 1RNHA 3TAQA 4DUYB 4I6MB 2DTUA 1N36O 4NXMB 4DK1A 5LGNA 2IS3A 3MCPA 1UA1A 1S1VA 4JTAB 3KCXA 3AEIA 4JGSA 4JPRA 3G67A 2KLAA 2WDQA 4O4LA 1M1KW 2VG5A 4OGEA 4DB3A 3G6BA 5IJ9B 3IUCA 4E89A 4KAZA 1AR74 4DR1K 3GG4A 3BGRA 5KA6A 2FSNA 4LF8B 4C8KA 1XDCA 1GMGA 3E8BA 4RCHA 1T6DA 1L0VA 1XBLA 4N47A 4JV5B 5EU7A 1LR1A 4OPHA 3HKEB 1HYZA 3C7NB 2A0LA 4FW1A 3H1QA 2XY5A 1XNQB 4IWVA 5KRTA 4YOTA 2JRIA 4X64B 3E89A 5JS2A 4DSJA 3ABMC 4FJ9A 2QGNA 3HI0A 5C24A 3UT5A 4X1KA 3ZCMA 3JCZA 4I7FA 2UUBK 2VGMA 3CRQA 1WJZA 1JCFA 4H8KA 3SAHA 3ATVA 5JVDB 4TOIA 4IOAL 3CHWA 3WU2Z 3HOSA 5KPRA 4U7BA 5L3BA 3I55N 4LC1A 2RS34 1YHQV 2NUBA 5K14A 2G8KA 2UYTA 1T05A 5JH7A 3S3WA 5B3SC 2AP1A 3B6PA 2F23A 3ETQA 3T69A 3ZRWB 3HOTA 2Q0AA 2BUPA 1WLEA 3NH0A 2OANA 4CGHA 1R0AA 4FFBA 1SQPH 4J7KA 4O4IA 3KVGA 2O8FB 3V1QA 1FPOA 4IG0A 4GX1A 2VQEB 1S9EA 1NJIO 4ZTJA 1AR94 4KTQA 3CRCA 1JMKC 3CCSV 2GTAA 3D2EB 3DRRA 3G10A 3AK1A 1OVQA 3VF4A 4HCBA 1Q18A 1RUC4 2RCVA 3J7ZO 3VF6A 4IYIA 3NVKA 1TKTA 3J81O 4TV9A 1C1BA 4BDYA 4CBCA 3UQ8A 3SV3A 3QVNA 3HKBA 3FFIA 1IG9A 3OYMA 1NTKH 2O4IA 3RYFB 1IKXA 4C8LA 4GKJB 4DR4O 2KQXA 4UCUA 1KFDA 3TU5A 3VQ6A 3AO4A 1KXPA 4XH5A 3R8EA 2HKOA 4M3WA 1RBSA 5AZIB 4TQFA 4BGBA 4YY3K 1YJ9V 1WLJA 4OPKA 1XL6A 4R6ZA 2QWOB 1VQ4V 3WQTA 4B1YB 2O8BB 1MG1A 3RVZA 4H4OA 1H2SB 3RFRA 3DXMA 4EHUA 5CN0A 4BR6A 3ZT1A 4XH4A 4J2BA 4DR6B 4YJ3B 3C65A 4ILGB 1SZXA 4AQYO 3CRMA 1SQVH 5LJWA 1KD1O 1I08A 4MLHA 3K2PA 5K1XA 3BP8A 4DHYA 4CJFA 4DV7K 2ZIMA 2YJFA 4PI0A 1PO14 4FJJA 1WPBA 2QM8A 1VSKA 1M5IA 5AQUA 4CHZA 2A41A 4FMTA 3L70H 4OKEA 2UXCK 2R7FA 1JX9A 3C3TA 3H01A 4JI6B 3JSNA 3CCMN 4BC5A 3JASA 4HWIA 3JD2A 3FZKA 1WOQA 4BGAA 1D5NA 2BE3A 4LP8A 4J2EA 1XWLA 4RG8A 2D0OA 3HVTA 3W7TA 4FJLA 1FFXB 3TXQA 3LDCA 1OH6A 4JI8B 1OCCB 3JCUZ 4PELA 1SAZA 2BSKA 5F2RA 5CMUA 4E2LA 4UY8O 1K9MO 1PNLA 4O2AA 2AA4A 4CZZA 3KKYA 3BA8A 4W5QA 2CTWA 1NOYA 3AO1A 3R1XA 4JI0K 2XAHA 3VQWA 3G6EN 3CCVV 3MX5A 2CTRA 3T1YB 2W6LA 3N4QA 4DSFA 5JJJB 1M93A 3V6DA 4PHZA 3U3YA 4I50A 1N34O 1QLNA 2X6NA 1HNWK 1B6QA 5IYDO 2Q9LA 2NNWA 2H88A 1HX1A 2QTOA 1YVNA 3HPOA 4IFVA 4JYAB 4YIPA 2XT9A 1RFYA 1TUEB 3CJ9A 2DOSA 1SUQA 1N36B 4KI6A 3V9ZA 4FCYA 1H2LA 4NCAA 3P31A 1Y76A 4I4TA 4CJ3A 3THYA 2A7WA 3D36C 2NRWA 4Q4W4 1J6ZA 3VQ4A 2IVNA 4CCHA 3DLRA 3ENOA 2CK3G 4ISEA 3ZT3A 2UU9O 2ZR3A 1Q7YO 3TCUA 4DR7K 4KHUA 4M3TA 3C94A 4CZEA 1RT7A 3DJCA 3KCYA 1ENVA 1HXS4 1MMMA 3F9MA 2B5JA 1K4CC 2UXXA 3OW2M 5KTQA 3LZIA 4DKWA 4RW4A 3AE5A 5C3JA 2ZR2A 1JJ2U 3THOA 1E3MA 3JS6A 1L3VA 2L6LA 1KVBA 4JKBA 4CS2A 5KPTA 2YNFA 1E1RG 5EBMC 1ZBHA 5CA1A 4J9ZB 3DMJA 4LF8K 1QU7A 4JK9A 2W41A 2CGKA 1GKFA 4JKAA 5IWAO 2P4KA 1DF4A 3RT3C 4CF9A 1WUAA 3SUOA 1RSOA 4CH6A 3IFRA 2A79B 3N4PA 4B3SK 4CF1A 4YT0A 5J2QA 5LXTB 4FLZA 4J7ZA 4NR1A 1WAJA 3L71H 1NJYA 1N32K 1Y97A 3AY9A 1OVYA 4B9MA 2QW9A 5IT9O 1WA8A 1Z6RA 2OPQA 2Q73A 4PJ0Z 2IU0A 1W9HA 3P4RA 2BTFA 4M3XA 4TV8B 2H94A 3UM7A 3O1WA 4WF9V 2HNZA 3WEEB 2EINB 3B4SA 1RT5A 1NK7A 3DRPA 1H8EG 2KG7A 1M57B 1IBLB 5BR8O 1RTIA 1UJWB 2YXYA 4KREA 2GDSA 3CC2N 3HB3B 1SZ2A 2IGIA 2QA4N 2Y0PA 3JBG4 2XAQA 3SBGA 3O3GA 5CY4A 1JLCA 1HR0O 2E2NA 2JIZG 4UQGA 3LAKA 1YHQN 1YVUA 4NO7A 2HHWA 3VQ5A 3OR7C 5E1AC 1K8AO 1GN6A 3NF6A 2V7QG 1P90A 5C2FA 1BMFG 1R6NA 4TUYA 3QBWA 3TANA 2IDOA 3JATA 3Q4HB 1JCGA 1DTOA 2P67A 4IBNA 4F6EA 1BA0A 1IBKB 3MEDA 1VQ7V 1QQCA 4GB34 1I7FA 2JS5A 1C0MA 3H3NO 3L6QA 2O8EB 2G8WA 1FXVA 1GN2A 3ZN1A 1Q7YW 1LUWA 2Q0UA 4AQYB 3ATUA 4MQ3A 1FJGK 3QICA 4FW2A 2OIEA 3AG3B 1WN7A 1SQKA 4DV4B 3OYNA 3THXA 1H2MA 4DTMA 4GX0A 4K3AA 1BDGA 5AFUA 3CF5L 3AO2A 2BOCC 5ITZB 1KU9A 1CP9A 3HPLC 5J2UB 2UUCO 1QLEC 4B3MO 1YF2A 1RBRA 2QXLA 3EKSA 2D0CA 4Z4FA 4WQ4A 3QB0A 4NYNA 4C8NA 5AR0A 1LOTB 1NGCA 4DV1B 4IHJB 5H1SQ 2DQ0A 3DC6A 4NYFA 2Y1IA 3QNNA 2P9SB 4DSLA 1FW6A 4EB6B 3I0SA 4H0TB 4CFDA 4H5VA 4OX9K 1AVMA 1M90O 1FKAO 4GW6A 3NHGA 2B4JA 5LMNK 4ZTFA 1BOTO 4G27B 4O4HA 4K43A 5CR4A 5EY4A 3CI5A 4DU3A 4LFCK 3D2FB 3VGKA 1QSYA 4FJCC 2P9LA 3S3OA 3CC7N 3CPWU 4C1NI 4UCOA 3FLCO 4KH4A 2Y4TA 1RTHA 1SRYA 3KZBA 4MO4A 4MVRA 2F7TA 5IY5C 2FBVA 5I9EB 1VEWA 4GV3A 5BMVA 2P9KB 3SDLA 2E2OA 4X9QA 4D7TA 4DYLA 2WBNA 5DMRA 5JLHA 3OYFA 1E1QG 4N21A 5JVHL 2G8FA 1JL1A 3FZHA 4CECA 2GUPA 3UO2A 1XNRB 2YUAA 4YSXA 3EY1A 4IOCL 2FF6A 4A2AA 1LNQA 5L3FA 2RQ6A 2YDEA 4FWMA 3J81N 3TAEA 1U4BA 1K73O 3WFVA 3NGZA 4MSWC 4FJKA 2EIKC 1F4MA 3HKBB 2WC9A 1EXQA 3CCUN 3DGEA 4LWSA 4QCLA 3GB7C 2BTQB 3AG1B 4OXSA 5LP6C 1RHI4 1A5VA 3A0RA 4Z1MG 3GBTA 3AG7A 4JYAK 3ZCCA 5M1PA 1JOYA 4DR1O 3G4SV 3JD1A 2DFFA 1UOCA 4LF9B 1SKVA 3TK1A 3LDSA 3CIRA 4GVMA 2YCHA 4FWKA 1FFTB 4BE1A 4LY7A 1VP7A 4F2SA 1S1XA 4LF7K 1V54C 3SV4A 1XL4A 3GDQA 2W6IG 3LP3A 4CK1A 5AQZA 1VIBA 4WE1A 3DXMB 4JI7B 1JL2A 5I3UA 4BY9C 3OD4A 4YIOA 4FSVA 2WQYA 4F3TA 4EKWA 4CGFA 3DXKA 2DYSC 5DECA 2X74A 3AVLA 2OPPA 2PYJA 1R3IC 2DW4A 3LDOA 3CCRN 3BEXA 3ZX3A 1ORQC 2VCPA 2BDPA 3IDHA 1L1FA 1OZ0A 5JJEB 1BEV4 4W5NA 1MZFA 4NTXA 3AEFA 3AVHA 1JCHA 2YEVB 4GX2A 4XBFA 1NKDA 3JD74 1HRHA 5LY3A 2YHXA 3VGLA 3BDPA 4JD2A 3JAMO 3JD0A 3ENBA 2E5LO 1NGJA 5KUMA 2WLNA 3CJHA 4H37A 1S22A 1KAZA 1HNXK 3A5LC 4HYOA 1NJWA 2H8PC 3D3QA 3ZHRA 5FLXN 4CIGA 4FJGA 5FRMA 3HKDA 2HHHK 4KB1A 2ZDIA 3MDSA 3C90A 1VBB4 3VMFB 4ZOLA 2WA4A 2Q0RA 1RDUA 1NMNA 1Z26A 4FIPC 2BSKB 4XH1A 2GTSA 5CYQA 1T8EA 4PDMA 2UUAB 2W6JG 3NBPA 1Q9XA 2F43G 5KX5A 5E79Z 5F0XA 1B06A 3ALYA 2WLHA 3ZMTA 2GHYA 4E19A 4YHHK 5BZBA 3AVAA 1WSFA 4M63C 3L2UA 3OS1A 3M3ZA 4KBOA 4P9OA 1I39A 2X78A 2YNHA 5J2PA 4CC6A 1G6UA 4LF6K 1K9MW 2HBKA 3QNEA 4RUFA 5LYJA 2ZWHA 2ITGA 4P9PA 4Z4HA 4DTXA 5HBMA 4FK2A 4YY3O 2JGUA 3LDQA 3SNNA 3CE2A 4GY2B 4DUZO 2ACZA 1MNGA 3QETA 2FBWA 2A06H 4RTFD 1YJWV 5GTIZ 3SI6A 1URFA 1WB8A 2P6JA 2Q2RA 3VQDA 4NCGA 1DTTA 4CBUA 4GLXA 2QEXN 4JI2B 1BL8A 4K0KB 1G15A 2JS3A 2ZXWC 4AM6A 3CXCU 5FROA 1HJOA 1GO3F 2H3OA 3ICXA 4UV8A 1MWMA 1REVA 1YTFD 2HBLA 3BUZB 3ZSQA 4CFBA 4W4LA 2JEUA 4DV6K 2KB1A 2IH1C 5LGTA 3SPGA 4E1NA 1TYQB 2UUCB 1TK0A 3ZSWA 4FZXC 2OCHA 4DV7O 3ABUA 4I0XA 1PVC4 1FXXA 3CCJN 2ZE8A 4JI1O 4BRMA 3K04A 2F96A 1RMU4 1EQYA 4F3OA 1C0FA 1S72N 4KH5A 4JYBA 1YZBA 1K33A 3LPTA 3DLEA 3K5LA 1MA1A 1YITV 1IURA 2E2QA 3THWA 2UXCO 1M1KO 3J7AP 4YNQA 1RM1B 4FM1A 1YIJN 4ILHA 1NU0A 2YS8A 5H6RA 1VQMN 1JXBA 2Q31A 5CZ1A 2PTMA 1WB9A 4YTPA 3DM2A 2DWDC 1SS6A 4R5PA 1KC8W 5FNVB 1NGEA 4X62K 4R50A 2KZMA 1M9NA 3QO5A 5L3EA 4RWUA 3QMLA 1IH7A 2W6KA 4DV2K 2D4WA 4J42A 2R7YA 2LJ2A 4LNUA 4DXWA 4QOZB 3O65A 4JI0O 1K6YA 1XREA 3WNFA 1OH7A 5TISZ 3CX5F 2HBMA 3E22A 4CZKA 4X65K 3BFRA 3ETEA 2ATKC 3BVOA 2JLEA 5IT9N 4AH9A 1VQLV 5D3GA 3I8DA 4OPAA 1BG3A 2ZT9B 5F1XA 1ZL8A 4CH3A 4BE0A 4X1YA 3K03A 3E1YA 3P4QA 1A5WA 3OTOB 4AILC 4AM7A 3EKUA 1NVPD 1G99A 1JLAA 4WQ4C 1YQ3A 4RW9A 5KAFZ 1TL3A 4QNHB 3E9LA 3CSXA 2QWRA 1N8RW 1GN4A 4Z4IA 3JARA 4NXNO 1S1TA 2VQFB 3VQ9A 3VQCA 1YSCA 1VRH4 1SKWA 3ZT0A 1ZAUA 1NK8A 1N0JA 4JHDA 1AI5A 4KH6A 1OCZC 4PKIA 3H1VX 4PY5A 3LDLA 4JAUA 1KRPA 2KZZA 1P84F 4UCRA 2X5ID 4U67L 4XIUA 3LDDA 1U2VB 4XEIA 3DXRB 2A9HA 4YORA 3N2GB 1XI1A 5GTHZ 1Q3EA 2DE0X 2LW1A 1BCOA 3E9OA 2D5RA 4BRGA 3ETDA 4C7UA 4DRXA 4AI8A 1U6ZA 1V4SA 5M1FA 2RR14 1K4DC 3FX7A 4WFFA 5FL7G 3KKSA 1OHHG 2PFUA 2JJ2G 3M8AA 4FLVA 4JI5K 3HYFA 2IVPA 5D5QA 4GKKO 3OS0A 4H0YB 1SQBH 2MW2B 4WFHA 1GAXA 3HSCA 2W40A 2P9IA 5GIPA 4LF9K 2YIBA 3CCQN 2OCCC 4R8CA 3QFUA 4BRDA 3APOA 2FKXA 4FFKA 1YXQA 3OM3B 1VQ8V 3CFPA 1OH5A 2YX6A 1RPRA 1VRUA 4DV5O 1BA1A 3H1JH 3F7YC 4B3SO 1Z25A 2X6CA 2QDOA 2AGAA 2E5LB 1D4XA 2I7NA 1K73W 1PIV4 3A2FA 4ZHRA 4QIWF 1VRTA 4E3SA 3QEVA 1MU2A 3M7MX 1NENA 1CEZA 3VBBA 3ZRSA 4BWAA 3H6EA 4CJSA 2ZQBA 1F4NA 3UO3A 2UXDB 3A0BZ 3MK6A 2O8CA 1NGBA 1X59A 5IE9A 4FLXA 1NTZH 1NI8A 5B1BC 1J54A 5HP1A 3DOLA 1VBA4 2RMKB 2A1SA 3S41A 1ZOYA 2I7PA 2GUZA 3SBTA 2H3GX 1NKEA 2R9AA 1RBUA 4PA4A 2VWBA 4DV3K 3G0ZA 3AVJA 1QTMA 3X2QB 3P1GA 3H9VA 4BDZA 4CHNA 4YFUA 3AVNA 3WB1A 5C0YA 3K5OA 3WT0A 2FYUH 4DS5A 1ZXOA 3QDKA 5AQKA 5CYMA 2UXNA 3QESA 2UXBK 1RUD4 2OTLV 2ZD1A 5C10A 1K97A 2A6AA 2OT5A 5CB4B 4YTMA 3OEHG 4DFJA 2B1GA 3K59A 4ZI7A 2EIMC 4J7JA 5LOVB 1HPZA 2ZIOA 2Q1NA 3CETA 1UFIA 5KRSA 3WB2A 4DLGA 3CC4N 3ZHQA 5C8YA 1T03A 2E74B 3OYGA 4FPAA 1KVAA 3ZX6A 4BW9A 4E0DA 2Y1JA 3I56N 2A5XA 2HWC4 3RR7A 3W7WA 4CJPA 1WB7A 3N2KA 4OKKA 1I94B 2DYRC 3L2RA 1NCQD 1OOPD 4JI1B 3VQAA 1Q43A 2IVOA 3U11A 3O08A 1WBBA 4LFAK 4JI2K 3ASOC 3RSEB 2HVJC 2X6AA 3D36A 3AE1A 2HF3A 5JCOC 1JFFB 4I9WA 2HF4A 4FLUA 3H1HH 1TUBB 3RWRD 4IKFA 2HNDA 1QR8A 3NVMA 1AB3A 2JGDA 3VA0A 3RMBA 3K9SA 1JKHA 3CCLN 4BRAA 1AR5A 1KAXA 2H89A 3T7ZA 4OX9O 4A5BA 3S9HA 3B6OA 3Q7BA 4RUEA 5HRNA 4AHRA 5M1OA 3T19A 2A3ZA 1KAYA 2ARHA 1DLBA 5TKWA 3JYCA 2HWB4 3OS2A 1RUJ4 3SPIA 5EYPA 5AQTA 4PA1A 2IW5A 1R3JC 2LQTA 4CZGA 4LFCO 4H0PA 3MEGA 4EZ6A 1MOFA 4BR4A 1QSSA 3SYOA 4I55B 3LPUA 3HR0A 2ZE6A 4LH5A 1TK8A 3JAMN 3AECA 3VR8A 1TUUA 1ZBIA 5LMUB 4BR0A 1Q8IA 1J53A 4OJRA 2PYLA 5AQJA 4BACA 2ZE2A 3SYAA 3SJJA 4J41A 3A0HZ 4DR2K 1PPJH 5J2TA 3SQ2A 1HNZK 4NTWA 1Y74A 3RYHA 4CEQA 4IEIA 2LGQA 4LF7O 3WXLA 3AVIA 2QKCA 2V4DA 1S1UA 4JK7A 2HJFC 1IKVA 1XMOB 1T5EA 2P22C 3RWUA 4NXNB 1L3SA 1RUE4 1Z2GA 4IO9L 1Q5OA 3TAFA 1BS3A 3SJCC 3ZHSA 4WBNB 1HRV4 1X9SA 4KHPO 4ILJA 2NLXA 1N33K 1IV0A 4MVQA 3NF7A 1RDBA 4ZKIA 1OCRC 2ZJRL 3MXIA 1FXKB 3ABLC 3NGYA 3G71N 4N23A 2XAGA 4CESA 3ZBHA 2D0BA 4DW1A 2QKAA 5FRNA 1D9FA 2KTQA 2WUSA 3B40A 3QO8A 2WONA 3DAWA 4KL1A 4CJ7A 4WCEV 4B3TB 3L4QA 1KP3A 4LF4B 1J5EB 2CGJA 1TKDA 4KTWA 1A5XA 4WQ5C 5BPMA 2GV9A 4HUGA 2O8DB 4PDWD 4H03B 5LL6Z 2QWQB 4O5BA 4YSZA 1GM9A 3VQXA 3QTCA 4ZHQA 2HNYA 4X1IB 4D7SA 4LF5O 1RFQA 2ASMA 5M1NA 1SKRA 1FK9A 5EBLC 4R7CA 1HP8A 3AVBA 3ZHTA 5B1NA 1D8YA 2G8HA 5EZYA 3F7VC 3CYOA 3FAVA 3QEIA 1NH2D 5CA0A 5JQGA 1OKJA 4CS4A 4DV5B 4O2BA 2WLKA 3WNEA 4IIJB 5KMGB 4AHSA 4M7XA 3CIPA 3M8RA 4EEQA 3SK3A 4H13B 4QGPA 3K9JA 1WPXA 5B1AC 5AQGA 1GLDG 5AZJA 3ZRVA 2GBZA 1XC9A 1LWFA 2A1RA 1D5AA 2Z1IA 3GE1A 1S5JA 5BN8A 5LA6A 4K8ZA 3R66A 4O4JA 3JAKB 1HNXO 4CK2A 1NTMH 3ZS8C 3U0ZA 4A2BA 2DY4A 4FJMA 4DR5B 1ILYA 1U96A 3ULEB 3DTUB 1HWYA 4HUEA 3CD6N 4YOVA 2X7RB 3DLBA 5KGXA 3L72H 1XMQK 2WLIA 4LNUB 4LSLA 4BWMA 3ABMB 3HT3A 4B9LA 4JI3O 5E26A 5C2DA 4YHHO 3K9AA 5JWPA 3SPJA 2OPSA 4E7LA 1KKDA 4FVMA 3ZETA 4CFCA 3DLGA 2JDIG 3HVRA 1Q6HA 4LF6O 3KKRA 1KMIZ 4B3RB 3TARA 1TA8A 2PI4A 2P06A 4H5NA 1YJ9N 4MDBA 3I33A 4AF1A 2IJIA 1M56C 3E2EA 1RDCA 2CTPA 2P4VA 3CMEV 5AG2A 1VSHA 1VQ6N 1OCCC 1EWQA 1SA0A 2QWLA 1IBMB 1PP9H 2PBDA 1P7GA 3QERA 3ZSRA 4DR3K 4ELUA 3AVMA 2F4VK 4HZ3A 3JD3A 3AVKA 3TETA 3T4DA 5KUKA 4H4MA 4Y1DA 2VG6A 4B1XB 4WFEA 4X88A 3DLKA 4ICGA 5IYBO 4KFMA 4KFBA 2NRHA 2DJVA 4LC9B 4DV0B 3PX4A 3JAWA 3BY6A 4CJ4A 1F23A 1QR9A 5JVGL 5FLXO 5LP6A 1AROP 3C6TA 3LWMA 1T3VA 1ATNA 4HNAA 2HHTA 3CB2A 1YTFB 1LW0A 3OMAB 1GLBG 1EM1A 1S6QA 3CCMV 3FZFA 1LAVA 3RGBA 1AILA 1VQPN 1VSFA 2R9IA 1SQGA 1NG9A 2WLLB 5HOOA 4DTSA 5J2NA 4X62O 1LWCA 2Z5UA 5CBHA 4YXWG 2NR5A 1K5QA 1GTOA 3AARA 3W7UA 2GUIA 3CRRA 4OLAA 2O57A 3DLLL 1RPOA 3PX6A 3WNGA 4A57A 3E83A 3P3PA 4X65O 3G6EV 4IJAA 3VEXA 4EP4A 3VQ7A 3L8BA 2KFNA 4AHUA 2C2AA 3STZC 1S5HC 1SESA 3BHPA 5DM6L 4EZ9A 4FWLA 1TVKA 1K8KA 1Y64A 3RRHA 2RMU4 5IYZB 4FZ0A 4RQFA 2RJZA 4BE2A 3KIOA 4PQUA 4IGGA 3SCXA 1GLJO 4UV9A 5KHIA 4U3JB 5CBGA 4JI4K 4DTPA 1QS4A 3CERA 1HLUA 4DQRA 1KLNA 1S5LZ 2FF3B 4V19S 1DLOA 2QR4A 1DKGD 2WU5A 4LFBO 4KHPB 3T2MA 4CGDA 1L3UA 4XDJA 5EC2C 1LAWA 3A5MC 4LH4A 1ZLZA 1B9FA 4W5RA 2OZSA 4DUYK 2W42A 2HVHA 3O4NA 4L87A 1FKOA 4MLEA 4YOUA 4DMNA 2IJKA 3ZHVA 4NXMK 4CJEA 4I9QA 1XMOK 3LSSA 2Q69A 2ZM6O 3AEEA 3LDPA 3EEQA 3ZEUB 1NVPB 2YJEA 4FWNA 5GINA 3CJBA 4QS8A 1G8MA 3TSUA 3SUQA 4NYKA 3VOVA 4WFBV 5JMVA 3F5WC 2P9UA 4EFHA 1HQEA 1KFSA 1KP2A 1WP8A 4JI5O 1OCOC 1NQTA 2YI8A 4LF5B 3R9PA 3L74H 1SL1A 4JLHA 1NK6A 2J4RA 3E66A 2G8UA 1YAGA 3DC5A 4JKGA 2B6AA 5GONB 1XNQK 1G4YB 2EJ7A 4X64K 2ZQMA 5GAGP 1IJJA 1SETA 3P30A 4FWSA 2KKWA 1Q86W 3DI6A 4NLCA 4RHV4 1ESVA 3QG5A 1AJPA 1SV5A 3V9WA 1L3TA 4BRHA 4HHTA 3OE7G 4DSIA 4DQSA 3PN1A 2GEMA 3MXMA 4GYCB 1OH8A 5B1OA 2JGDB 4TWKA 2F9WA 4BIOA 2DWEC 4W5TA 2PZSA 2NRZA 4M3RA 1K3EA 4F6RB 3AG3C 4YJ2A 4DR4B 2VQEK 3QBXA 2HLDG 1W0KG 1QQMA 4BDPA 3E8HA 3CC2V 2OYQA 5L3CA 1EO1A 4JI3B 1GOCA 4FJXA 1EAH4 1QE1A 3HPHA 1T7PA 3FB5C 2MK3A 1L5UA 2XNDG 4DF4A 1KC8O 2Q7EA 3C6HA 4E1JA 3T1HO 4ICLA 1CZ9A 2UXBO 1ASUA 1Z7S4 2K9PA 4NB4A 1JJ2M 2A3QA 4GKJK 5J2TB 5HFMA 3G80A 3MDQA 1YTUA 2P7TC 4Z1VA 1VQ7N 4Z4GA 4FVUA 2E6MA 3JALA 2F8SA 2EIJB 3SGIA 3BEHA 3HSTB 1N5YA 5EBWC 4KTZA 3NMUA 4U3FH 4O4LB 2EILC 1AR4A 3OTFA 2PAVA 4CIEA 4RW6A 1AP6A 2FSKA 3OYIA 2IM9A 2EULA 2ZE7A 3ZSZA 4DR6K 3O9SA 3CJCA 1N8RO 3FZMA 3FFQA 3MWTA 4ELVA 1OV9A 4WFAV 1IO2A 2GELA 4KRFA 4LFAO 1BISA 1R094 2HFEC 4HBNA 2ETNA 4GX5A 3QO7A 3RYCA 4JEPA 4KPYA 1H2KA 4N56A 2QKSA 1SL2A 2XASA 3UT5B 4X1KB 1RTJA 3VENA 3U6FA 1Q6IA 2FC0A 1LV5A 4FJIA 3P4SA 2YKMA 2XAJA 2OWOA 1Q81W 5EX5A 4I2PA 5EIBC 4JI6K 5IJ0A 1VSLA 4NKGB 3JYTA 3RVYA 3SFEA 1LW2A 2EHGA 4CZIA 1N34B 1VK0A 2ZNJA 5JH7B 4Q4V4 5AFUH 4DQIA 1X3NA 3AG1C 4JI8K 2D3OW 3OUSA 1KCFA 3TR8A 4K25A 3TTDA 3RMDA 1KECA 4X66O 4XDLA 4FFBB 3V1OA 1S6PA 3CC7V 1S76D 3MX2A 1MABG 4O4IB 3M5RA 5BRHA 4I5SA 1QZ6A 4FJ5A 1E4GT 3RMCA 1R084 2OPRA 3T1YK 3I8BA 4DR2O 5KQDA 4BRCA 1XUQA 1HNZO 4FJ8A 3AK2A 3CJ7A 4CFAA 3K57A 4H0VB 3MCAB 3DSQA 3VR9A 4TV9B 4FWQA 3IC7A 4UFZA 3U9ZA 3K0SA 4UB8Z 2UU9B 3AE6A 4FWOA 4K41A 4LFBB 2KSDA 3WNHA 4CVNE 2KFZA 2V1DA 1AR64 4H5RA 1N36K 2XHBA 4UCTA 4CJQA 3KK1A 1KF6A 4JKCA 1VSEA 4OGQB 4OKJA 2ZM6B 3QINA 4BVPA 3AE7A 2E3CA 4D6TH 1JVMA 1WSJA 2QWPA 5J1EA 2R064 4X20A 5CE3A 1RT6A 4CJRA 5H9CA 1CXZB 2B9ZA 3FE1A 1I5YA 1QQOA 3CM6A 1EZVH 2KHOA 4DF8A 4BR9A 4DU4A 5IWAB 2ZD9A 2UUBO 3N27A 5IY5B 5IYCO 3NF8A 3AEDA 3L9DA 3DRSA 3R65A 3OJUA 1WNSA 3IKMA 4KKOA 1N4CA 2Q7HA 4BRQA 1BIZA 2P9NA 2PGGA 2Q36A 3UKRA 3QFPA 3LWLA 2ZJPL 2HHVA 1R6TA 2AZ2A 3CPWM 5JICA 2P9PA 1RILA 4PHTX 3SAFA 2RS14 3U8XA 3CCRV 3QEWA 3RYIA 3RRGA 3VTIA 3BY5A 3SUCA 4BRLA 3VQPA 5KGWA 3VEZA 2IU3A 3AE9A 4JF3A 1O13A 3LNNA 4WF9L 1CZAN 2CH7A 2ZE5A 2EIKB 3JASB 5FPEA 3NE6A 3VGMA 3NAEA 3CFRA 3UKUA 5BR8B 5AQRA 4BVOA 1MZEA 3ZIAG 5LP6B 3AG2C 1COWG 3IGAC 1VBE4 4ASUG 3SJHA 4CGIA 4DG1A 2E2PA 4CK3A 4JK8A 5JCOA 4O2AB 3ZYYX 1HR0B 5H5NA 4PDVA 2OTJV 2Q6AA 1NH2B 3MN9A 4E7KA 1V54B 4B8AB 1XHXA 1NGAA 2XY7A 4KHNA 3LP2A 3B09A 2XTAA 5BY1A 4L3QA 2XO7A 1NK4A 4I50B 1IBLK 3BF3A 1XMQO 2GWJA 1O9HA 4I6MA 2DYSB 1RUG4 4M45A 3BF1A 4X8AA 1Y4MA 4JRQA 3T1HB 4CERA 3HP9A 1AI7A 2HG5C 1KQSM 4H0LB 4JYCA 1KUQA 5C93A 1NR7A 4HVJA 5EC1C 2PI5A 2BGGA 1GN3A 3ZJZA 5IJ9A 3HKCA 4AHTA 4CZHA 1RM1C 1HPMA 1VSDA 2YNIA 3S3NA 1NKBA 1AR84 4Q4X4 5AQLA 2GSMB 5KHKA 3G25A 3ID8A 3LDNA 2EWSA 1DEJA 3THYB 1Y76B 4I4TB 4TSXA 4MDAA 2WFBA 2CGNA 5LHHA 3AAQA 2YI1A 4Q6GA 1MA9B 3RVCA 1VBC4 1NJXA 3ASNB 3PV8A 1JR9A 5BXZA 3W7SA 1K7DA 3VF2A 1C6VA 1IBKK 3PO5A 3HKEA 5DM7L 3C7NA 1K92A 4O5FA 4B3MB 3T3FA 3AO3A 2QEXV 2YIBD 3QEPA 4DR3O 3B8AX 2F4VO 3JSLA 4J80A 4FJNA 2HR3A 2W0XA 3OBWA 2Q4PA 1TKXA 4CEOA 1YVWA 3A8TA 4J10A 4AQYK 1I3AA 4B9NA 1Z5VA 5JVDA 1VF6C 2QE7G 4DV4K 3CJ1A 4DW0A 4CI6A 1YI2N 1YUWA 4B9TA 4MVMA 1RBTA 3CCJV 3FB8C 2Y69C 1SZTA 1B92A 5CA1B 3H3OB 3VEVA 2BTOA 1YITN 1S72V 3EVKA 3ZMSA 5AQWA 4M41A 5KI6A 1BQ0A 1QSLA 3AA3A 3ML0A 4IT5A 4DV1K 2F8TA 2F93B 3ZRWA 1S1WA 4E7HA 2QTSA 1YIJV 4DLEA 1EWRA 1HNVA 1AJQA 2O8FA 1RSOB 1VQMV 4H5WA 1QVFM 3O4QA 4WQ5A 3BRCA 3NDKA 1LCUA 3KLIA 1H8TD 3VN5A 4CZFA 3D2EA 3Q7CA 4GT1A 3OAAG 4J9YB 1SERA 4CHQA 3OYLA 3WUHA 1W2BU 3VESA 4X66B 1HNWO 1WA8B 3AA4A 1JLFA 3CJAA 1YDXA 2NRXA 3E9PA 4MW3A 1BI4A 4FL9A 5KPZA 3MECA 1HKCA 1KFYA 2N04A 4MTOA 5AQPA 5AQXA 3RYFA 2KG7B 3I0RA 4CBXA 2WA3A 4A5UB 2WLJA 3B2EE 3OYHA 5AZIA 2BOBC 1VQNN 2AJQA 4TQDA 3WQUA 3NGIA 3CMAN 3K08A 1W0JG 2O8BA 2QWOA 3HTVA 1SQFA 1F21A 3HP6A 4FPPA 1XNRK 4DR1B 1ZX3A 4DR7O 1CZBA 3L0QA 3PSIA 2LW7A 4TUYB 2RPIA 3JATB 1X9WA 4YJ3A 4ISFA 2JK5C 2VWKA 4MTGA 3VQBA 4NXMO 5FPRA 3GWKC 4ISGA 5JJNB 3PIOL 1QBZA 3MMVA 3TI0A 4IZ9A 3VRBA 1EETA 1NGHA 1Q6UA 1XUPO 3CQYA 1RCHA 1BWFO 1QNMA 1PL0A 1Z5WA 2RDCA 2UUBB 1HJRA 3F9KA 3CXHF 4B08A 4UVBA 4LF8O 2ZF5O 5MLCQ 4FZYA 2VYPA 3K79A 3THXB 3OFNG 3PJSK 5EK0A 2XAFA 2R074 4JV5O 1TK5A 3VEYA 1BGXT 1NK0A 1VQ9N 4KHQA 4J2AA 2WU2A 2ETJA 4JI7K 3X2QC 1Q9YA 4X64O 3F73A 1FFXA 1HUXA 1NK9A 3CCQV 3WG7C 1NGFA 4A61A 1N32O 5A2QO 1X1PA 5IWAK 4BAYA 2ITMA 2R72A 3A5OC 1ASVA 3LP0A 5IDJA 4FWPA 3OJSA 3QIPA 4F9OA 2OA8A 4MVUA 1OCZB 2L35A 3A0IX 2RKIA 2YV0X 2KW4A 3OGIB 1EN5A 4B8CA 1QQNA 3D8CA 3K5NA 1VHXA 4QAGA 4O4HB 1U45A 4Q0BA 1GOBA 4PKHA 3SQ1A 1RUH4 3OHRA 5FDLA 1VSIA 2P9LB 4OVLA 3C3SA 3F5TA 5DEDA 5IJ0B 3OY9A 3CM5A 1BHAA 4NVPA 3STLC 4FO0A 4IFEA 3AVCA 2HVIA 1VSMA 3HM9A 5JLFA 3ABKC 1RUI4 1UA0A 3TAGA 4PI2A 3GL1A 2B5UA 1H8HG 3H1LH 1H2GA 4FZ1A 4XDKA 5BMVB 4QE7A 4PA7A 5F2VO 4YY3B 2UUAK 4DUZB 3C6AA 4IDKA 3ZHUA 1HR0K 5BRDA 3CCEV 2Z1GA 2NLJC 3VA3A 1S0VA 3ZX2A 1YJNN 4GMJB 2OTLN 2PF4E 4DFMA 3SPYA 1X9MA 4GKJO 1BSMA 1O1WA 2AW9A 3CWBH 5H2FZ 1YCIA 4DK0A 1FJGO 1VARA 2P5GA 1XOUA 1QVGU 4CH4A 3CC4V 5DK5A 4LWSB 4AHCA 4DV7B 3PUFA 4H44B 4CJ5A 4CEDA 1X4TA 4DQ8A 3I56V 4BQLA 1TAQA 2QK9A 4H0XB 4W5OA 4K0KK 1VF5B 1F51A 3BPZA 1VQ5V 3SUPA 4FJHA 2UXCB 1DF5A 4K8XA 5BN9A 1JLEA 4MS2A 1BO5O 3AE3A 4C8OA 3W3DA 1VQON 2HMPA 2UUCK 3VEOA 5ADXA 2YC0A 3OR6C 1HMVA 1P4RA 3RTVA 4FZZA 1VQKV 1NZ6A 3DXKB 3OUFA 5LXTA 4BG9A 4MVOA 5LMNO 3ZX0A 3V9SA 3H1KH 5KHJA 2RN9A 4CE9A 1NA1D 4ID1A 4C1NK 3OA9A 5AQSA 4PA6A 3VERA 1V55B 3CCLV 2P90A 4JI0B 1COV4 1JCEA 5GW7A 2EIMB 1U48A 4TV8A 3SMPA 3WEEA 3NR7A 2P9NB 2WLMA 3J7AU 4M7YA 4B9SA 2WDRA 5AQMA 4IOXA 3IS9A 3KLFA 2LO1A 4WFGA 2HJDA 1KBHA 3U10A 4JD2B 2PLV4 4E4EA 5BREA 1HNWB 3OYBA 3LM2A 2CUGA 3VPZA 3CJHB 1S9GA 1I5XA 1T44A 2OZMA 3KD5E 3UKMA 3ZMUA 4BRPA 3LNMB 4KHSA 4JYYA 3AG4B 3HKDB 4UVAA 2DYRB 1BUPA 3H08A 4UB6Z 2I5JA 4ZOLB 1R73A 3T1YO 1Q86O 4F4KA 4PWDA 3RMAA 4N5SA 3ZEDA 3ASOB 4B7EA 1GLLO 3S3XA 3Q4HA 4FYDA 3K0DA 1BL3A 2ITDC 5KX5B 1PNKA 4B9VA 5LGUA 5HRSA 5LHIA 3D7EO 5CHIA 3OTOK 2HHXA 3SFDA 1ZC6A 3SR2C 5E84A 2ODMA 1SQXH 4JKDA 3TJTA 1SS3A 4DO2A 2G8VA 4JYAO 1Y67A 1K5MD 2E76B 3FYIB 1KTQA 2OCEA 2R70A 3EZWA 4J8FA 4IO8A 4CH5A 3P83D 2VQFK 5LYJB 2FXUA 2YIAA 1B9DA 1WSIA 3FKSG 4PUOA 2W0FC 1D4M4 1CPYA 3KLEA 1C0GA 4I9LA 3J80N 3IFXA 3SJBC 4UXNA 3G71V 4GKKB 3HKCB 5ITZA 4HAMA 5J2UA 2Y4UA 2Z1HA 4OLBA 2JJ1G 1WP7A 2YSUB 3P32A 4BQZA 3ZRXA 4IHJA 4CF0A 4E1MA 2EBOA 2ILMA 4G1QA 3V1RA 3VETA 5ELZA 3SQ0A 2P9SA 3W7XA 4EB6A 4CHPA 1W0HA 1G1XB 1Y6XA 2E1YA 1H38A 1WSGA 1CXQA 4I0XB 4B3SB 1D2DA 2JWKA 3UE5A 2WPDG 4A5AA 3LDEA 1Q82W 1RGIA 2E1ZA 3I55V 1BZKA 4UCSA 2IC3A 3MN5A 1MQTD 1N32B 3VQYA 3PX0A 3KD1E 1R1BA 5B66Z 4RO2A 3THWB 2FSJA 4OO1J 3IG1A 1YQ4A 1BCCH 2LFSA 5M1QA 3D2FA 2N74A 1J95A 4P30A 4IL6Z 3P4PA 1OCRB 2HHHO 4AHVA 1BHLA 1ZBSA 3C6UA 3L73H 3ABLB 2G8IA 3CCSN 5EXWA 3H46O 2E5LK 1XQSC 1TAEA 2P9KA 1XHZA 1NS1A 1RDDA 1GM8A 5AQVA 3B8NA 3K58A 4H33A 3RN4A 4HTUA 1NU1H 3O8MA 3IJ4A 1AR1B 2UXDK 3E22B 3QEXA 1BE3H 3SYCA 3O9UA 1Q81O 1IBLO 3CD6V 2QWNA 4Z0UA 3CEIA 4DTNA 4UCVA 2FBYA 4DS4A 2CE4A 1ZL8B 4ABMA 1BI4B 4X1YB 1IKWA 5B3SB 1WSHA 2O4GA 3HK2A 1VQ4N 4EIAA 1DTQA 2BTQA 1NGGA 4GCZA 2M7WA 2QKKA 4L8RB 3AE4A 3AA5X 2VRZA 2QWRB 3BZKA 3SJQC 2QJ1A 3JARB 3TSPA 1N0NA 5B1AB 1FJGB 1NGDA 3CFOA 4WYBA 3O6WA 2M6YA 2NNUA 4DUZK 4JHDB 1RT3A 4N76A 4BWJA 4DV6O 1EN6A 3CMEN 1RT4A 4CIFA 1ZP0A 1IBKO 3VRAA 4L8JA 2YHAA 1VQ6V 5KA5A 2YKNA 5AQOA 1IDSA 4KB0A 1NJZA 4C8MA 4JRPA 5AJ3K 1BQNA 3KK2A 1JA8A 4IEEA 4CJKA 4Q4Y4 4Z4CA 3IC9A 1HKBA 2HOEA 2XRIA 3NF9A 4DRXB 3P3NA 4YOWA 4DV4O 1I94K 4OX9B 4HCCA 2YEVA 3ZMVA 4FK0A 4JI1K 2NN4A 3OGCC 3MAQA 2QM7A 3R3LA 1NR1A 4CHOA 5M1KA 5LMNB 3OW2U 2KQ2A 2DFEA 3EL2A 4JS5A 2P9IB 4CEFA 3LZJA 3C95A 1AP5A 4EFBA 3I5DA 4DV1O 1S3JA 4LFCB 3LUTB 1ASWA 3LALA 3THVA 4DV2O 4KV8A 2E20A 1RP3B 1V9PA 4PDRA 1H1VA 1M56B 3KLGA 3CCVN 4GV9A 5KLVH 3CP1A 5A2QN 1VQPV 1ZWIC 1KYOF 3MXJA 4QS9A 5C2TA 3OYCA 2D0PA 4JNEA 5KAIZ 5GAEP 4F2RA 1UWBA 1KVCA 4B3OA 3T4ZA 2EJRA 4NLBA 3AK3A 4LF7B 2A40A 1QCEA 2O8CB 2OIGA 1K5SA 1JJOA 5LMUK 4KHWA 2YHYA 2GUZB 3OYDA 3ZMZA 1ATSA 2IJHA 1YTAA 3L3UA 1PNMA 4O55A 2WS3A 5J2MA 4Q5VA 2HEPA 4MT8A 3M6GA 4IFYA 3KG2A 1X9JA 1XNRO 3TXSA 4NXNK 1KB9F 2YXLA 1EX4A 1Y66A 2X6BA 3AV9A 4IG3A 4YTNA 1E4FT 5L3GA 3AGKA 4WCEL 1POV0 4CZJA 4ZI7B 1XEQA 2YIDA 3HXMA 3SZ2A 4I7ZB 2PUSA 2E8AA 3AA2A 2HSTA 2EINC 3O9TA 3SPHA 5C8YB 1TYQA 2Q8VA 1M57C 4M3ZA 4FK4A 5HLFA 4MW8A 2ZNIA 2EX3A 1NT2B 3K9KA 2F95B 1FS0G 1VAZA 1C0UA 2WAMA 2FLOA 3BCCH 3OEEG 4LF9O 1JLBA 2RN2A 4DTUA 5HL7L 4B3TK 4LF4K 3M99B 3N2KB 3FZLA 1J5EK 3D3IA 1L8DA 1HRI4 4K42A 4GKKK 3ISNC 2AHZA 4Y1CA 4JI7O 2QKBA 1NBMG 2EZPA 3H1IH 3MEEA 3E8GA 4ZIBA 1JLQA 1YEWA 5FNVA 3QLHA 3HBTA 3VQVA 1GRJA 4LCUC 3HJFA 4CZMA 4E7IA 1HYSA 1HNXB 5LBQA 4FLTA 2QTDA 1C1AA 2HHHB 3CS5A 4DV5K 3MWPA 3TGUH 4O8KA 4IDHA 2XY6A 3HZ6A 4OPJA 5LL6Y 3O5BA 3NH2A 2Y0IA 3V4IA 3LSQA 3OVNA 3GOIA 4YOYA 1VF6A 2Z0AA 2WP9A 2LSNA 3NCIA 3UCSC 3KJVA 2EIJC 2GBOA 5EYPB 2V52B 3ENHA 4PL7A 4DV3O 3QIOA 5K1PA 4TT3G 2QA4V 1ZBFA 4BR7A 3V9UA 4YHHB 3ZT2A 3VEWA 4QE9A 3ZN0A 4FM2A 1YXBA 1TL1A 1W97L 3IAYA 3M8QA 4CHYA 3JD4A 1HYVA 4M3UA 1ZTEA 4ID5A 3OMIB 4DR5K 2IJJA 1OCOB 3IRXA 4LF6B 1DK1A 3FB6C 4Y0WA 4BRKA 4JKFA 4QJFB 3SYZA 5B5EZ 2UUAO 3EO3A 1Y74B 2QSAA 3RYHB 1FYJA 4FK5C 3LL3A 4BROA 3CRAA 5CBFA 2Q97A 4EHTA 3SYQA 2P51A 1ATRA 4J2DA 1E79G 3KHYA 1S3XA 3ZSOA 4CGJA 4JKEA 1U2VA 4JKHA 3DXRA 1DGKN 1WSEA 2RF2A 3N2GA 5D5PA 2NRTA 1RT1A 3VQEA 3PIPL 4JZ2A 3RBZA 3M1FA 2G38A 3KK7A 3WXMB 3GQHA 4DV6B 4B3RK 1ZSPA 4Z4EA 3O80A 1SQQH 3RW0A 2D2CB 4JN4A 4BC3A 1RTDA 1WBDA 5AQFA 2BANA 2D1KA 4ELTA 1PD3A 1BT8A 4JI2O 5B8HA 3ZSXA 4K0KO 2V51B 4O8UA 1IBMK 3QF7A 1K34A 4CBWA 3PLAA 4IXCA 3EE8A 1IKYA 4KO0A 3A5NC 1NJIW 3NFAA 1H2NA 3FI7A 1EZJA 4CD1A 4BW5A 2IAJA 3HPGA 3K06A 3KWIA 3S3MA 1LUVA 1NLVA 4BC4A 2YHBA 2E6LA 1XQ8A 4G28B 4JTDB 4MTXA 1BHBA 4ZHQB 4DV0K 4DTRA 5AQHA 4A59A 4X62B 2V7YA 4JAAA 1JLGA 4ZBMA 5L3DA 4DV2B 5J9PC 1GK9A 5EZYB 3FAVB 3D0PA 3PY8A 5CA0B 5JQGB 3O1BA 3HRGA 4JASA 4O2BB 2ASOA 2X6SA 4X65B 2F9TA 1NMDA 4DCHA 2HHUA 2FBXA 2AXTZ 3L4IA 4DU1A 4G9ZA 5AZJB 1RDAA 3OBYA 3FB7C 3UB5A 4QPKA 1F7YA 4U7NA 2EILB 4GNIA 2WWWA 1QLEB 3NH1A 4PDLA 5LA6B 3CQ8A 4O4JB 1J9AA 1PM9A 1FKPA 5SZTA 4O0IA 2VS0A 5EVZA 4YDUA 2EZOA 1SL0A 3OMNB 2BH1A 1D9DA 1I0HA 1ROPA 1KD1W 3J8F4 4O0JA 1X3MA 5DN6G 5CB4A 4LR3A 3U4LA 4DQPA 4H5TA 2WDVA 2WLIB 1TGOA 4QPJA 4B1WB 1L0LH 2Q0OC 5LOVA 1C1CA 1MWKA 4CEZA 1NK5A 1N33O 4WFNL 2HMIA 4H0OA 4B1ZA 4RW7A 3OTOO 5C42A 1EN4A 1GOAA 3U3GA 1BIUA 1EFRG 3DYAA 1VBD4 4LH6A 3E8FA 3CCUV 5FPMA 4E7JA 2ZGYA 1IG8A 4PV1B 3L2VA 2QWNB 3ZETB 2KKZA 3M8PA 3G4SN 3L2WA 1O9GA 2VQFO 1AJNA 1XC3A 1Q90D 5AQNA 2QWMA 4WFBL 4N41A 4KHPK 2P5OA 1ZBUA 4PD4F 3D45A 1FD9A 4BRIA 4JTCB 2FTKA 4BREA 3TPQA 1S77D 4JI5B 1NGIA 2VG7A 1XILA 1DT9A 1SA0B 3RSEA 2B76A 1LWEA 3AE2A 2HHSA 3TAPA 1JFFA 2NZTA 1IXBA 1RVF4 1FAFA 1KQSU 2JEXA 1TUBA 1NWKA 1RT2A 2AHYA 3UIQA 4F8RA 3K3WA 3BABA 4BR5A 4JS4A 4Q20A 3SAGA 4FWRA 1NOZA 4DFPA 4U7OA 4UVCA 4CS3A 2CGOA 3AE8A 4YXDA 3FD9A 4FM0A 2HW3A 3WXJA 4CZLA 3O3FA 3JAWB 1THZA 4LF5K 2V7ZA 2IBZH 1TAUA 1PV0A
chains in the Genus database with same CATH topology
3ZT4A 1KLMA 2E4LA 2PW9A 1U49A 4HNAB 4DQQA 4KI4A 4FXDA 3WB0A 4I55A 1SKSA 2F1MA 1ZYQA 3LAMA 4DV3B 5FPOA 3TAMA 4DSEA 4CJTA 1DGSA 2UXBB 1RBVA 3JSMA 5HRRA 1TVKB 4WBNA 3TABA 1TV6A 2FBTA 1NKCA 3V9XA 1CXUA 1VSJA 1VF7A 3OYKA 4CEEA 4B9UA 5HROA 5SWMA 2PY5A 4O4GA 3OYAA 1B04A 4LFAB 3VQQA 1N6QA 4X1IA 4NCBA 3T1AA 4EP5A 5CZ2A 3KK3A 3L3VA 2XY8A 2HHQA 4KHYA 3BA9A 4IIJA 5KMGA 3P5JA 1WAFA 2YNGA 4CEAA 2Q3SA 4FJ7A 4CF8A 4DWIA 3ZSVA 3M8SA 3HL8A 1M4UA 3JAKA 1EKEA 2WOMA 1ITGA 3RR8A 1QHTA 2Z1JA 3KLHA 4DR2B 3ULDA 3ITHA 1HNZB 3AVFA 1J5OA 4FLWA 4CC5A 1YT3A 5E41A 1EP4A 3OYJA 1ZBLA 2D0AA 1HNIA 4YJ2B 3SQ4A 3HO1A 4CEBA 1U04A 4O44A 1N33B 3E01A 4LH7A 3QO9A 4RW8A 3BAAA 4DFKA 3V81A 2QM4A 2IOCA 3JALB 4CJLA 2CAZC 4CF2A 4FLYA 4M3YA 3LANA 1CLQA 4LSNA 2QXFA 1BCMA 4DTJA 4LD0A 3DOKA 2ZCEA 1JXEA 3RYCB 1HW7A 3TWHA 5KHGA 3CHXA 3EZ5A 2ATQA 3ASMA 2BE2A 1XMQB 2DFHA 4DTOA 5IYZA 2JVDA 3O3HA 4U3JA 4CGGA 1HQUA 1BQMA 1P49A 4DSKA 2F66C 4I2QA 3KTQA 1U47A 5KHHA 4DR3B 2VWJA 2F4VB 1C0TA 3CYMA 3OYEA 1TVRA 4CJUA 3L2QA 1UAXA 3AVGA 3EYZA 4HUFA 4X20B 5GONA 5T7BA 3QNOA 3VQ8A 2P1JA 2YI9A 4MFBA 3ZSYA 3CG7A 3SPZA 5C25A 1KSPA 4CJWA 3RYIB 5JS1A 3LP1A 4EFEA 1TKZA 3PO4A 5EIBD 3AO5A 3DLHA 4F6RA 4OGCA 4M42A 2HB5A 4JI4B 3K5MA 3SJAC 5HRPA 3SUNA 4CJVA 4DR7B 2Q7GA 2ZINA 1RNHA 3TAQA 4DUYB 2DTUA 4NXMB 4DK1A 2IS3A 1UA1A 1S1VA 4O4LA 2VG5A 4E89A 4OGEA 5IJ9B 3BGRA 4LF8B 4C8KA 4N47A 4JV5B 5EU7A 3HKEB 1HYZA 4FW1A 2XY5A 1XNQB 4X64B 4DSJA 5JS2A 4FJ9A 5C24A 3UT5A 4X1KA 3ZCMA 4I7FA 4H8KA 5JVDB 4TOIA 2NUBA 5K14A 2G8KA 1T05A 5JH7A 3B6PA 3ETQA 2Q0AA 3NH0A 1R0AA 4CGHA 4FFBA 4O4IA 3V1QA 4IG0A 2VQEB 1S9EA 4ZTJA 4KTQA 1JMKC 3DRRA 3G10A 4HCBA 1TKTA 4TV9A 1C1BA 4BDYA 3UQ8A 3SV3A 3HKBA 3FFIA 1IG9A 3OYMA 2O4IA 3RYFB 1IKXA 4C8LA 4GKJB 4UCUA 1KFDA 3VQ6A 3AO4A 4M3WA 1RBSA 4TQFA 1WLJA 4OPKA 4H4OA 1H2SB 3RFRA 3ZT1A 4J2BA 4DR6B 4YJ3B 3K2PA 5K1XA 4CJFA 2ZIMA 4PI0A 4FJJA 1WPBA 1VSKA 1M5IA 4CHZA 4OKEA 2R7FA 4JI6B 3JSNA 3JASA 4J2EA 1XWLA 4RG8A 3HVTA 4FJLA 1FFXB 4JI8B 4O2AA 3BA8A 4W5QA 1NOYA 3AO1A 3VQWA 3T1YB 4DSFA 5JJJB 1M93A 3V6DA 4PHZA 3U3YA 4I50A 2X6NA 3HPOA 4IFVA 4JYAB 1SUQA 1N36B 4KI6A 3V9ZA 4FCYA 4NCAA 4I4TA 4CJ3A 3VQ4A 4CCHA 3DLRA 3ZT3A 4KHUA 4M3TA 3C94A 1RT7A 2B5JA 3LZIA 4RW4A 3THOA 1L3VA 1KVBA 4CS2A 2YNFA 1ZBHA 5CA1A 3DMJA 4CF9A 3SUOA 1RSOA 4CH6A 4CF1A 5J2QA 5LXTB 4FLZA 1WAJA 1NJYA 1Y97A 4B9MA 2OPQA 1W9HA 4M3XA 4TV8B 2HNZA 1RT5A 1NK7A 3DRPA 1IBLB 1RTIA 4KREA 2IGIA 3O3GA 5CY4A 1JLCA 4UQGA 3LAKA 1YVUA 2HHWA 3VQ5A 3NF6A 4TUYA 3TANA 2IDOA 3JATA 4IBNA 1IBKB 3MEDA 1QQCA 1I7FA 2JS5A 1C0MA 2G8WA 4AQYB 4MQ3A 4FW2A 1WN7A 4DV4B 3OYNA 4DTMA 3AO2A 5ITZB 1KU9A 5J2UB 1RBRA 4Z4FA 2D0CA 4C8NA 4NYNA 4DV1B 4IHJB 4NYFA 2Y1IA 3QNNA 4DSLA 4EB6B 3I0SA 4CFDA 4GW6A 3NHGA 2B4JA 4ZTFA 4O4HA 4DU3A 1QSYA 3S3OA 4UCOA 1RTHA 2FBVA 5BMVA 4D7TA 5DMRA 3OYFA 2G8FA 1JL1A 4CECA 1XNRB 3EY1A 2RQ6A 3TAEA 1U4BA 3NGZA 4FJKA 3HKBB 1EXQA 4QCLA 2BTQB 5LP6C 1A5VA 2DFFA 1UOCA 4LF9B 1SKVA 3LDSA 4GVMA 4BE1A 4LY7A 4F2SA 1S1XA 3SV4A 3LP3A 4CK1A 4WE1A 4JI7B 1JL2A 5I3UA 4F3TA 4CGFA 2X74A 3AVLA 2OPPA 2PYJA 2BDPA 5JJEB 4W5NA 3AVHA 1HRHA 3BDPA 1NJWA 4FJGA 4CIGA 5FRMA 3HKDA 4KB1A 4ZOLA 1Z26A 5CYQA 1T8EA 2UUAB 3NBPA 5KX5A 3ALYA 4E19A 3L2UA 3AVAA 1WSFA 3OS1A 1I39A 2X78A 2YNHA 5J2PA 4CC6A 1G6UA 5LYJA 4Z4HA 2ITGA 4FK2A 4DTXA 5HBMA 2JGUA 3SNNA 3QETA 3SI6A 3VQDA 4NCGA 1DTTA 4GLXA 4JI2B 4K0KB 1G15A 5FROA 3ICXA 4B3OA 1REVA 3ZSQA 4CFBA 4E1NA 2UUCB 1TK0A 3ZSWA 4FZXC 1FXXA 2F96A 4F3OA 3LPTA 3DLEA 3K5LA 4YNQA 4FM1A 1JXBA 5CZ1A 2PTMA 3DM2A 4R5PA 5FNVB 2KZMA 1IH7A 2R7YA 4LNUA 4QOZB 1K6YA 3WNFA 3E22A 2JLEA 4AH9A 5D3GA 3I8DA 4BE0A 4CH3A 4X1YA 1A5WA 3OTOB 4AILC 1JLAA 4RW9A 1TL3A 3CSXA 4Z4IA 3JARA 1S1TA 3VQCA 2VQFB 3VQ9A 1SKWA 3ZT0A 1ZAUA 1NK8A 4PY5A 1KRPA 2KZZA 4UCRA 4XIUA 3N2GB 1XI1A 1BCOA 1Q3EA 2D5RA 4DRXA 3KKSA 4FLVA 3HYFA 5D5QA 3OS0A 2YIBA 3CFPA 1VRUA 1Z25A 2E5LB 3A2FA 4ZHRA 1VRTA 4E3SA 3QEVA 1MU2A 3M7MX 4BWAA 4CJSA 2ZQBA 2UXDB 4FLXA 1J54A 5HP1A 3DOLA 2A1SA 1NKEA 2R9AA 1RBUA 3G0ZA 3AVJA 1QTMA 3P1GA 4BDZA 4CHNA 4YFUA 3AVNA 3WB1A 3K5OA 4DS5A 5CYMA 3QESA 2ZD1A 5CB4B 4DFJA 3K59A 4ZI7A 5LOVB 1HPZA 2ZIOA 5KRSA 3WB2A 4DLGA 5C8YA 1T03A 3OYGA 1KVAA 4BW9A 4E0DA 2Y1JA 3RR7A 4CJPA 3N2KA 4OKKA 1I94B 3L2RA 4JI1B 3VQAA 1Q43A 3U11A 5JCOC 1JFFB 4FLUA 1TUBB 3RWRD 4IKFA 2HNDA 3VA0A 3RMBA 1JKHA 3S9HA 3B6OA 5HRNA 4AHRA 3T19A 3OS2A 5EYPA 4PA1A 3MEGA 4EZ6A 1QSSA 4I55B 3LPUA 4LH5A 1TK8A 1ZBIA 5LMUB 1Q8IA 1J53A 4OJRA 2PYLA 4BACA 2ZE2A 3SJJA 5J2TA 3SQ2A 3RYHA 4CEQA 3AVIA 2V4DA 1S1UA 1IKVA 1XMOB 1T5EA 2P22C 3RWUA 4NXNB 1L3SA 1Q5OA 3TAFA 3SJCC 4WBNB 1X9SA 3NF7A 1RDBA 3MXIA 3NGYA 4CESA 2D0BA 5FRNA 1D9FA 2KTQA 2WONA 4KL1A 4B3TB 4LF4B 1J5EB 1TKDA 4KTWA 1A5XA 4HUGA 2GV9A 4O5BA 3VQXA 3QTCA 4ZHQA 2HNYA 4X1IB 4D7SA 1SKRA 1FK9A 3AVBA 1D8YA 2G8HA 5EZYA 3QEIA 5CA0A 5JQGA 4CS4A 4DV5B 3M8RA 4O2BA 3WNEA 4IIJB 5KMGB 4AHSA 4EEQA 2GBZA 1XC9A 1LWFA 2A1RA 1D5AA 2Z1IA 1S5JA 5LA6A 4K8ZA 4O4JA 3JAKB 4CK2A 3ZS8C 3U0ZA 2DY4A 4FJMA 4DR5B 4HUEA 3DLBA 5KGXA 4LNUB 4BWMA 4LSLA 4B9LA 3HT3A 2OPSA 4E7LA 4FVMA 4CFCA 3HVRA 3DLGA 3KKRA 1KMIZ 4B3RB 3TARA 1TA8A 1RDCA 1VSHA 1SA0A 1IBMB 3QERA 4ELUA 3ZSRA 3AVMA 3AVKA 4H4MA 4Y1DA 2VG6A 3DLKA 4KFBA 4DV0B 3PX4A 3JAWA 4CJ4A 5LP6A 3C6TA 3LWMA 2HHTA 4HNAA 3CB2A 1LW0A 1S6QA 1LAVA 3RGBA 1VSFA 1SQGA 4DTSA 5J2NA 1LWCA 2GUIA 4OLAA 3PX6A 3WNGA 2KFNA 4EP4A 3L8BA 3VQ7A 4AHUA 3BHPA 4EZ9A 1TVKA 3RRHA 5IYZB 2RJZA 4BE2A 3KIOA 4PQUA 3SCXA 5KHIA 4U3JB 4DTPA 1QS4A 4DQRA 1KLNA 1DLOA 4KHPB 4CGDA 1L3UA 4KAZA 1LAWA 4LH4A 1B9FA 4W5RA 2OZSA 2W42A 2HVHA 3O4NA 1FKOA 4DMNA 4CJEA 4I9QA 3SUQA 1HQEA 1KFSA 2YI8A 4LF5B 1SL1A 2G8UA 4JLHA 1NK6A 2B6AA 5GONB 2KKWA 3DI6A 3QG5A 1SV5A 3V9WA 1L3TA 4HHTA 4DSIA 4DQSA 3PN1A 3MXMA 4GYCB 4W5TA 2PZSA 4M3RA 4F6RB 4YJ2A 4DR4B 4BDPA 2OYQA 4JI3B 1GOCA 4FJXA 1QE1A 3HPHA 1T7PA 1L5UA 4DF4A 2Q7EA 4ICLA 1CZ9A 1ASUA 5J2TB 1YTUA 4Z4GA 2E6MA 3JALA 2F8SA 3SGIA 3HSTB 1N5YA 4KTZA 4O4LB 3OTFA 4CIEA 4RW6A 3OYIA 2IM9A 3ZSZA 3FFQA 4ELVA 1IO2A 4KRFA 1BISA 4HBNA 3RYCA 4KPYA 4N56A 1SL2A 3UT5B 4X1KB 1RTJA 3U6FA 2FC0A 1LV5A 4FJIA 2YKMA 2OWOA 4I2PA 5EIBC 5IJ0A 1VSLA 3JYTA 1LW2A 2EHGA 1N34B 1VK0A 2ZNJA 5JH7B 4DQIA 1KCFA 3TR8A 3RMDA 3V1OA 4FFBB 1S6PA 4O4IB 4FJ5A 3RMCA 2OPRA 4FJ8A 4CFAA 3K57A 3DSQA 4TV9B 4UFZA 2UU9B 4LFBB 3WNHA 2KFZA 2XHBA 4UCTA 4CJQA 3KK1A 1VSEA 4OKJA 2ZM6B 2E3CA 1WSJA 5J1EA 4X20A 1RT6A 4CJRA 3CM6A 4DF8A 4DU4A 5IWAB 3NF8A 3DRSA 3OJUA 1WNSA 4KKOA 2Q7HA 1BIZA 2PGGA 3LWLA 2HHVA 3QEWA 3RYIA 3RRGA 3VQPA 5KGWA 3LNNA 3JASB 3NAEA 3CFRA 3NE6A 5BR8B 5LP6B 4CGIA 4DG1A 4CK3A 5JCOA 4O2AB 1HR0B 4E7KA 4B8AB 1XHXA 2XY7A 4KHNA 3LP2A 1NK4A 2XO7A 4I50B 1O9HA 4M45A 4JRQA 3T1HB 4CERA 3HP9A 4HVJA 2BGGA 5IJ9A 4AHTA 3HKCA 1VSDA 2YNIA 3S3NA 1NKBA 5KHKA 4I4TB 4TSXA 4Q6GA 1NJXA