1AR74

P1/mahoney poliovirus, double mutant p1095s + h2142y
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
molecule tags Virus
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ar7400
1ASJ4 1D4M4 1VBE4 2RR14 2RMU4 1RUJ4 1RUI4 1AR94 2HWB4 2PLV4 2R064 1AR84 2X5ID 1K5MD 2R074 4Q4W4 2RS54 3J8F4 1HRI4 1H8TD 1HRV4 1RHI4 1RUF4 3JD74 2HWC4 1R094 1VRH4 4Q4X4 1PO14 1VBB4 1RUD4 1RVF4 1R084 3JBG4 1MQTD 4PDWD 4Q4Y4 1OOPD 1BEV4 1Z7S4 4GB34 1NA1D 1RUH4 1RUG4 4RHV4 1AR74 1NCQD 1RMU4 1AL24 1VBA4 2RS14 1AR64 1POV0 1VBC4 1HXS4 1RUE4 2R044 4Q4V4 1VBD4 1EAH4 1PO24 1COV4 1RUC4 1PVC4 2RM24 1EV14 1PIV4 2RS34
chains in the Genus database with same CATH superfamily
1VBE4 2RR14 1L0VA 3ABVA 5C2TA 2HWB4 2X5ID 2H89A 2B76A 2RS54 3VR8A 1NENA 3AE4A 3P4SA 2WU2A 1RUD4 4YTPA 1BEV4 4GB34 3SUCA 1RMU4 2WDVA 3AECA 3AE9A 3AE1A 2WU5A 1YQ3A 1D4M4 1RUI4 1AR94 2R064 3P4QA 2R074 4YXDA 1HRI4 2EX3A 1HRV4 5C3JA 2PYLA 3AEFA 2WQYA 3GQKA 3AE3A 1R094 1VBB4 1RVF4 3JBG4 3AEEA 2R7FA 1RUH4 1YQ4A 3AE8A 1AR74 1NCQD 3VRBA 2FBWA 1VBC4 2PYJA 3VR9A 1EAH4 1PO24 1PIV4 2RS34 3AEBA 2WS3A 4YSXA 2RMU4 1RUJ4 1ZOYA 3AE2A 1AR84 4Q4W4 3AE5A 2H88A 1H8TD 1RHI4 3CIRA 3JD74 2HWC4 4Q4X4 1VRH4 4YTNA 1MQTD 1XI1A 1EV14 1Z7S4 2PZSA 2ACZA 3SFEA 4KX6A 1VBA4 1RUE4 1KF6A 4Q4V4 1XHXA 1VBD4 3AEDA 2RM24 4YSZA 1KFYA 1PVC4 2WP9A 1ASJ4 3AEGA 3AE7A 3AE6A 2PLV4 1K5MD 3VRAA 3GQHA 3J8F4 2WDQA 4YTMA 3P4RA 1RUF4 3P4PA 1PO14 1R084 4PDWD 2PW9A 1XHZA 4Q4Y4 1OOPD 2WDRA 4YT0A 4YSYA 1NA1D 1RUG4 4RHV4 1AL24 2RS14 3FI7A 1AR64 3AEAA 1POV0 1HXS4 2R044 3SFDA 1ZP0A 1RUC4 2PY5A 1COV4 1NEKA
chains in the Genus database with same CATH topology
1ASJ4 1D4M4 1VBE4 2RR14 2RMU4 1RUJ4 1RUI4 1AR94 2HWB4 2PLV4 2R064 1AR84 2X5ID 1K5MD 2R074 4Q4W4 2RS54 3J8F4 1HRI4 1H8TD 1HRV4 1RHI4 1RUF4 3JD74 2HWC4 1R094 1VRH4 4Q4X4 1PO14 1VBB4 1RUD4 1RVF4 1R084 3JBG4 1MQTD 4PDWD 4Q4Y4 1OOPD 1BEV4 1Z7S4 4GB34 1NA1D 1RUH4 1RUG4 4RHV4 1AR74 1NCQD 1RMU4 1AL24 1VBA4 2RS14 1AR64 1POV0 1VBC4 1HXS4 1RUE4 2R044 4Q4V4 1VBD4 1EAH4 1PO24 1COV4 1RUC4 1PVC4 2RM24 1EV14 1PIV4 2RS34
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ASJ 4;  1D4M 4;  1VBE 4;  2RR1 4;  2RMU 4;  1RUJ 4;  1RUI 4;  1AR9 4;  2HWB 4;  2PLV 4;  2R06 4;  1AR8 4;  2X5I D;  1K5M D;  2R07 4;  4Q4W 4;  2RS5 4;  3J8F 4;  1HRI 4;  1H8T D;  1HRV 4;  1RHI 4;  1RUF 4;  3JD7 4;  2HWC 4;  1R09 4;  1VRH 4;  4Q4X 4;  1PO1 4;  1VBB 4;  1RUD 4;  1RVF 4;  1R08 4;  3JBG 4;  1MQT D;  4PDW D;  4Q4Y 4;  1OOP D;  1BEV 4;  1Z7S 4;  4GB3 4;  1NA1 D;  1RUH 4;  1RUG 4;  4RHV 4;  1AR7 4;  1NCQ D;  1RMU 4;  1AL2 4;  1VBA 4;  2RS1 4;  1AR6 4;  1POV 0;  1VBC 4;  1HXS 4;  1RUE 4;  2R04 4;  4Q4V 4;  1VBD 4;  1EAH 4;  1PO2 4;  1COV 4;  1RUC 4;  1PVC 4;  2RM2 4;  1EV1 4;  1PIV 4;  2RS3 4; 
#chains in the Genus database with same CATH topology
 1VBE 4;  2RR1 4;  1L0V A;  3ABV A;  5C2T A;  2HWB 4;  2X5I D;  2H89 A;  2B76 A;  2RS5 4;  3VR8 A;  1NEN A;  3AE4 A;  3P4S A;  2WU2 A;  1RUD 4;  4YTP A;  1BEV 4;  4GB3 4;  3SUC A;  1RMU 4;  2WDV A;  3AEC A;  3AE9 A;  3AE1 A;  2WU5 A;  1YQ3 A;  1D4M 4;  1RUI 4;  1AR9 4;  2R06 4;  3P4Q A;  2R07 4;  4YXD A;  1HRI 4;  2EX3 A;  1HRV 4;  5C3J A;  2PYL A;  3AEF A;  2WQY A;  3GQK A;  3AE3 A;  1R09 4;  1VBB 4;  1RVF 4;  3JBG 4;  3AEE A;  2R7F A;  1RUH 4;  1YQ4 A;  3AE8 A;  1AR7 4;  1NCQ D;  3VRB A;  2FBW A;  1VBC 4;  2PYJ A;  3VR9 A;  1EAH 4;  1PO2 4;  1PIV 4;  2RS3 4;  3AEB A;  2WS3 A;  4YSX A;  2RMU 4;  1RUJ 4;  1ZOY A;  3AE2 A;  1AR8 4;  4Q4W 4;  3AE5 A;  2H88 A;  1H8T D;  1RHI 4;  3CIR A;  3JD7 4;  2HWC 4;  4Q4X 4;  1VRH 4;  4YTN A;  1MQT D;  1XI1 A;  1EV1 4;  1Z7S 4;  2PZS A;  2ACZ A;  3SFE A;  4KX6 A;  1VBA 4;  1RUE 4;  1KF6 A;  4Q4V 4;  1XHX A;  1VBD 4;  3AED A;  2RM2 4;  4YSZ A;  1KFY A;  1PVC 4;  2WP9 A;  1ASJ 4;  3AEG A;  3AE7 A;  3AE6 A;  2PLV 4;  1K5M D;  3VRA A;  3GQH A;  3J8F 4;  2WDQ A;  4YTM A;  3P4R A;  1RUF 4;  3P4P A;  1PO1 4;  1R08 4;  4PDW D;  2PW9 A;  1XHZ A;  4Q4Y 4;  1OOP D;  2WDR A;  4YT0 A;  4YSY A;  1NA1 D;  1RUG 4;  4RHV 4;  1AL2 4;  2RS1 4;  3FI7 A;  1AR6 4;  3AEA A;  1POV 0;  1HXS 4;  2R04 4;  3SFD A;  1ZP0 A;  1RUC 4;  2PY5 A;  1COV 4;  1NEK A; 
#chains in the Genus database with same CATH homology
 1ASJ 4;  1D4M 4;  1VBE 4;  2RR1 4;  2RMU 4;  1RUJ 4;  1RUI 4;  1AR9 4;  2HWB 4;  2PLV 4;  2R06 4;  1AR8 4;  2X5I D;  1K5M D;  2R07 4;  4Q4W 4;  2RS5 4;  3J8F 4;  1HRI 4;  1H8T D;  1HRV 4;  1RHI 4;  1RUF 4;  3JD7 4;  2HWC 4;  1R09 4;  1VRH 4;  4Q4X 4;  1PO1 4;  1VBB 4;  1RUD 4;  1RVF 4;  1R08 4;  3JBG 4;  1MQT D;  4PDW D;  4Q4Y 4;  1OOP D;  1BEV 4;  1Z7S 4;  4GB3 4;  1NA1 D;  1RUH 4;  1RUG 4;  4RHV 4;  1AR7 4;  1NCQ D;  1RMU 4;  1AL2 4;  1VBA 4;  2RS1 4;  1AR6 4;  1POV 0;  1VBC 4;  1HXS 4;  1RUE 4;  2R04 4;  4Q4V 4;  1VBD 4;  1EAH 4;  1PO2 4;  1COV 4;  1RUC 4;  1PVC 4;  2RM2 4;  1EV1 4;  1PIV 4;  2RS3 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...