1AR74

P1/mahoney poliovirus, double mutant p1095s + h2142y
Total Genus 3
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
3
sequence length
68
structure length
60
Chain Sequence
GAQVSSQKVGAHESTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords P1/MAHONEY POLIOVIRUS
publication title Structural studies of poliovirus mutants that overcome receptor defects.
pubmed doi rcsb
source organism Human poliovirus 1
total genus 3
structure length 60
sequence length 68
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1997-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 1ar7400
1PVC4 1AR64 1RUH4 1AR94 1BEV4 1RUD4 1VBA4 1R084 1RUG4 4Q4V4 1AL24 1RUE4 1PO24 1PO14 1OOPD 1H8TD 1EV14 1VRH4 2R064 1EAH4 1ASJ4 1RHI4 2RR14 2RS14 2RS54 1VBD4 2HWC4 1K5MD 4Q4Y4 2RS34 1Z7S4 3J8F4 1HXS4 1RUI4 1HRV4 1VBE4 2R044 1AR74 2RMU4 4Q4X4 1VBC4 3JD74 4Q4W4 4PDWD 1R094 1RUC4 1POV0 2HWB4 1NCQD 1RVF4 1COV4 1MQTD 1HRI4 1NA1D 2RM24 1RUF4 1D4M4 1RUJ4 2X5ID 1PIV4 4GB34 1AR84 1RMU4 3JBG4 2PLV4 2R074 4RHV4 1VBB4
chains in the Genus database with same CATH superfamily
1BEV4 3GQKA 1VBA4 1YQ3A 4Q4V4 3AEBA 4YSYA 1OOPD 1H8TD 1VRH4 2H89A 3GQHA 1K5MD 1Z7S4 2WS3A 1NEKA 4Q4W4 1R094 4YSXA 1XHXA 1RVF4 1COV4 1MQTD 1XI1A 1RUF4 2PW9A 1RUJ4 2X5ID 3AE2A 3AECA 2PZSA 3AE6A 1NENA 2PLV4 2R074 4YXDA 1VBB4 1AR64 1RUH4 2WQYA 4YTNA 3AEDA 2B76A 1RUG4 1KFYA 1AL24 3SUCA 1EV14 2RS54 2WU5A 2PYJA 2WU2A 1VBD4 2HWC4 4Q4Y4 1ZP0A 3AE1A 1HRV4 4PDWD 2WP9A 1HRI4 2EX3A 1PIV4 4GB34 1AR84 3SFEA 3VR8A 1L0VA 3ABVA 4RHV4 1KF6A 1YQ4A 1PVC4 2WDRA 3P4SA 3AE8A 1RUD4 1RUE4 1PO14 2WDQA 3AE7A 2RR14 1EAH4 3CIRA 3P4RA 5C3JA 1RUI4 3AEEA 1VBE4 2ACZA 1VBC4 2HWB4 2WDVA 1NCQD 1NA1D 4YT0A 2R7FA 2RM24 3SFDA 3AEGA 1RMU4 3AE9A 2H88A 3VRAA 3VR9A 3AE3A 3P4QA 1AR94 4KX6A 3AE5A 1R084 3AE4A 1PO24 2R064 2RS14 1ASJ4 1RHI4 4YTMA 2PY5A 3VRBA 2RS34 3J8F4 1HXS4 2R044 1AR74 2RMU4 4Q4X4 3AEFA 3FI7A 3JD74 4YTPA 1RUC4 1POV0 2FBWA 1ZOYA 1D4M4 2PYLA 5C2TA 3AEAA 4YSZA 1XHZA 3JBG4 3P4PA
chains in the Genus database with same CATH topology
1PVC4 1AR64 1RUH4 1AR94 1BEV4 1RUD4 1VBA4 1R084 1RUG4 4Q4V4 1AL24 1RUE4 1PO24 1PO14 1OOPD 1H8TD 1EV14 1VRH4 2R064 1EAH4 1ASJ4 1RHI4 2RR14 2RS14 2RS54 1VBD4 2HWC4 1K5MD 4Q4Y4 2RS34 1Z7S4 3J8F4 1HXS4 1RUI4 1HRV4 1VBE4 2R044 1AR74 2RMU4 4Q4X4 1VBC4 3JD74 4Q4W4 4PDWD 1R094 1RUC4 1POV0 2HWB4 1NCQD 1RVF4 1COV4 1MQTD 1HRI4 1NA1D 2RM24 1RUF4 1D4M4 1RUJ4 2X5ID 1PIV4 4GB34 1AR84 1RMU4 3JBG4 2PLV4 2R074 4RHV4 1VBB4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVC 4;  1AR6 4;  1RUH 4;  1AR9 4;  1BEV 4;  1RUD 4;  1VBA 4;  1R08 4;  1RUG 4;  4Q4V 4;  1AL2 4;  1RUE 4;  1PO2 4;  1PO1 4;  1OOP D;  1H8T D;  1EV1 4;  1VRH 4;  2R06 4;  1EAH 4;  1ASJ 4;  1RHI 4;  2RR1 4;  2RS1 4;  2RS5 4;  1VBD 4;  2HWC 4;  1K5M D;  4Q4Y 4;  2RS3 4;  1Z7S 4;  3J8F 4;  1HXS 4;  1RUI 4;  1HRV 4;  1VBE 4;  2R04 4;  1AR7 4;  2RMU 4;  4Q4X 4;  1VBC 4;  3JD7 4;  4Q4W 4;  4PDW D;  1R09 4;  1RUC 4;  1POV 0;  2HWB 4;  1NCQ D;  1RVF 4;  1COV 4;  1MQT D;  1HRI 4;  1NA1 D;  2RM2 4;  1RUF 4;  1D4M 4;  1RUJ 4;  2X5I D;  1PIV 4;  4GB3 4;  1AR8 4;  1RMU 4;  3JBG 4;  2PLV 4;  2R07 4;  4RHV 4;  1VBB 4; 
#chains in the Genus database with same CATH topology
 1BEV 4;  3GQK A;  1VBA 4;  1YQ3 A;  4Q4V 4;  3AEB A;  4YSY A;  1OOP D;  1H8T D;  1VRH 4;  2H89 A;  3GQH A;  1K5M D;  1Z7S 4;  2WS3 A;  1NEK A;  4Q4W 4;  1R09 4;  4YSX A;  1XHX A;  1RVF 4;  1COV 4;  1MQT D;  1XI1 A;  1RUF 4;  2PW9 A;  1RUJ 4;  2X5I D;  3AE2 A;  3AEC A;  2PZS A;  3AE6 A;  1NEN A;  2PLV 4;  2R07 4;  4YXD A;  1VBB 4;  1AR6 4;  1RUH 4;  2WQY A;  4YTN A;  3AED A;  2B76 A;  1RUG 4;  1KFY A;  1AL2 4;  3SUC A;  1EV1 4;  2RS5 4;  2WU5 A;  2PYJ A;  2WU2 A;  1VBD 4;  2HWC 4;  4Q4Y 4;  1ZP0 A;  3AE1 A;  1HRV 4;  4PDW D;  2WP9 A;  1HRI 4;  2EX3 A;  1PIV 4;  4GB3 4;  1AR8 4;  3SFE A;  3VR8 A;  1L0V A;  3ABV A;  4RHV 4;  1KF6 A;  1YQ4 A;  1PVC 4;  2WDR A;  3P4S A;  3AE8 A;  1RUD 4;  1RUE 4;  1PO1 4;  2WDQ A;  3AE7 A;  2RR1 4;  1EAH 4;  3CIR A;  3P4R A;  5C3J A;  1RUI 4;  3AEE A;  1VBE 4;  2ACZ A;  1VBC 4;  2HWB 4;  2WDV A;  1NCQ D;  1NA1 D;  4YT0 A;  2R7F A;  2RM2 4;  3SFD A;  3AEG A;  1RMU 4;  3AE9 A;  2H88 A;  3VRA A;  3VR9 A;  3AE3 A;  3P4Q A;  1AR9 4;  4KX6 A;  3AE5 A;  1R08 4;  3AE4 A;  1PO2 4;  2R06 4;  2RS1 4;  1ASJ 4;  1RHI 4;  4YTM A;  2PY5 A;  3VRB A;  2RS3 4;  3J8F 4;  1HXS 4;  2R04 4;  1AR7 4;  2RMU 4;  4Q4X 4;  3AEF A;  3FI7 A;  3JD7 4;  4YTP A;  1RUC 4;  1POV 0;  2FBW A;  1ZOY A;  1D4M 4;  2PYL A;  5C2T A;  3AEA A;  4YSZ A;  1XHZ A;  3JBG 4;  3P4P A; 
#chains in the Genus database with same CATH homology
 1PVC 4;  1AR6 4;  1RUH 4;  1AR9 4;  1BEV 4;  1RUD 4;  1VBA 4;  1R08 4;  1RUG 4;  4Q4V 4;  1AL2 4;  1RUE 4;  1PO2 4;  1PO1 4;  1OOP D;  1H8T D;  1EV1 4;  1VRH 4;  2R06 4;  1EAH 4;  1ASJ 4;  1RHI 4;  2RR1 4;  2RS1 4;  2RS5 4;  1VBD 4;  2HWC 4;  1K5M D;  4Q4Y 4;  2RS3 4;  1Z7S 4;  3J8F 4;  1HXS 4;  1RUI 4;  1HRV 4;  1VBE 4;  2R04 4;  1AR7 4;  2RMU 4;  4Q4X 4;  1VBC 4;  3JD7 4;  4Q4W 4;  4PDW D;  1R09 4;  1RUC 4;  1POV 0;  2HWB 4;  1NCQ D;  1RVF 4;  1COV 4;  1MQT D;  1HRI 4;  1NA1 D;  2RM2 4;  1RUF 4;  1D4M 4;  1RUJ 4;  2X5I D;  1PIV 4;  4GB3 4;  1AR8 4;  1RMU 4;  3JBG 4;  2PLV 4;  2R07 4;  4RHV 4;  1VBB 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...