2RS54

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
molecule tags Virus
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rs5400
1RHI4 1Z7S4 1RUE4 2RM24 1ASJ4 1HRV4 1AL24 4Q4Y4 4PDWD 1PVC4 1POV0 1RUF4 1H8TD 2HWC4 1VRH4 1PO14 2HWB4 2RS14 1RVF4 1RUI4 4Q4V4 1VBC4 1HRI4 3JBG4 2X5ID 1AR94 1NA1D 2R074 4Q4X4 1VBD4 2R064 1R084 1RUD4 1RUJ4 1RUH4 3JD74 4GB34 2RS34 1RUC4 1R094 1RMU4 1COV4 3J8F4 1MQTD 1PO24 2RS54 1AR74 1OOPD 1HXS4 1AR64 2PLV4 2R044 1PIV4 2RMU4 1K5MD 1D4M4 1NCQD 1AR84 1EAH4 1BEV4 1VBA4 1VBE4 4RHV4 1EV14 4Q4W4 2RR14 1RUG4 1VBB4
chains in the Genus database with same CATH superfamily
1NENA 3VRAA 1RUE4 2H88A 1XHZA 1ASJ4 1PVC4 1RUF4 2HWC4 1VRH4 1RUI4 2PYLA 3AEEA 1HRI4 2H89A 1YQ3A 1NA1D 3VRBA 3P4PA 1R084 4GB34 3AEAA 2PZSA 2WU2A 5C3JA 4YSXA 3AEFA 2RMU4 4YTNA 1NCQD 2WS3A 4RHV4 1EV14 4Q4W4 2RR14 1Z7S4 4KX6A 3AE5A 3AEGA 4PDWD 1H8TD 1KF6A 3P4QA 3SFEA 1VBC4 1AR94 4Q4X4 2R7FA 3SUCA 1RUJ4 2ACZA 2B76A 1COV4 3J8F4 3SFDA 1MQTD 1PO24 1AR74 1AR64 2PLV4 1PIV4 1D4M4 1VBA4 3CIRA 3AE2A 2WDQA 3AEDA 2WDRA 3FI7A 2HWB4 3P4SA 1KFYA 4YSZA 1PO14 3P4RA 1RVF4 3GQKA 3AECA 4Q4V4 2X5ID 2WQYA 2R074 1XI1A 3ABVA 5C2TA 1VBD4 2R064 4YSYA 1RUD4 3VR9A 3GQHA 2RS34 1RUC4 2EX3A 1R094 2PW9A 4YT0A 2WP9A 2WDVA 3AE1A 2RS54 1NEKA 2R044 1EAH4 4YTPA 1RUG4 1RHI4 1YQ4A 2RM24 1ZP0A 1AL24 4Q4Y4 1HRV4 1POV0 3AEBA 2RS14 3AE7A 3AE3A 2PY5A 3JBG4 3AE8A 2FBWA 1XHXA 1L0VA 1RUH4 3JD74 3AE6A 1RMU4 2WU5A 3AE9A 3AE4A 1OOPD 1HXS4 1ZOYA 2PYJA 4YXDA 1K5MD 1VBE4 1AR84 1BEV4 3VR8A 4YTMA 1VBB4
chains in the Genus database with same CATH topology
1RHI4 1Z7S4 1RUE4 2RM24 1ASJ4 1HRV4 1AL24 4Q4Y4 4PDWD 1PVC4 1POV0 1RUF4 1H8TD 2HWC4 1VRH4 1PO14 2HWB4 2RS14 1RVF4 1RUI4 4Q4V4 1VBC4 1HRI4 3JBG4 2X5ID 1AR94 1NA1D 2R074 4Q4X4 1VBD4 2R064 1R084 1RUD4 1RUJ4 1RUH4 3JD74 4GB34 2RS34 1RUC4 1R094 1RMU4 1COV4 3J8F4 1MQTD 1PO24 2RS54 1AR74 1OOPD 1HXS4 1AR64 2PLV4 2R044 1PIV4 2RMU4 1K5MD 1D4M4 1NCQD 1AR84 1EAH4 1BEV4 1VBA4 1VBE4 4RHV4 1EV14 4Q4W4 2RR14 1RUG4 1VBB4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHI 4;  1Z7S 4;  1RUE 4;  2RM2 4;  1ASJ 4;  1HRV 4;  1AL2 4;  4Q4Y 4;  4PDW D;  1PVC 4;  1POV 0;  1RUF 4;  1H8T D;  2HWC 4;  1VRH 4;  1PO1 4;  2HWB 4;  2RS1 4;  1RVF 4;  1RUI 4;  4Q4V 4;  1VBC 4;  1HRI 4;  3JBG 4;  2X5I D;  1AR9 4;  1NA1 D;  2R07 4;  4Q4X 4;  1VBD 4;  2R06 4;  1R08 4;  1RUD 4;  1RUJ 4;  1RUH 4;  3JD7 4;  4GB3 4;  2RS3 4;  1RUC 4;  1R09 4;  1RMU 4;  1COV 4;  3J8F 4;  1MQT D;  1PO2 4;  2RS5 4;  1AR7 4;  1OOP D;  1HXS 4;  1AR6 4;  2PLV 4;  2R04 4;  1PIV 4;  2RMU 4;  1K5M D;  1D4M 4;  1NCQ D;  1AR8 4;  1EAH 4;  1BEV 4;  1VBA 4;  1VBE 4;  4RHV 4;  1EV1 4;  4Q4W 4;  2RR1 4;  1RUG 4;  1VBB 4; 
#chains in the Genus database with same CATH topology
 1NEN A;  3VRA A;  1RUE 4;  2H88 A;  1XHZ A;  1ASJ 4;  1PVC 4;  1RUF 4;  2HWC 4;  1VRH 4;  1RUI 4;  2PYL A;  3AEE A;  1HRI 4;  2H89 A;  1YQ3 A;  1NA1 D;  3VRB A;  3P4P A;  1R08 4;  4GB3 4;  3AEA A;  2PZS A;  2WU2 A;  5C3J A;  4YSX A;  3AEF A;  2RMU 4;  4YTN A;  1NCQ D;  2WS3 A;  4RHV 4;  1EV1 4;  4Q4W 4;  2RR1 4;  1Z7S 4;  4KX6 A;  3AE5 A;  3AEG A;  4PDW D;  1H8T D;  1KF6 A;  3P4Q A;  3SFE A;  1VBC 4;  1AR9 4;  4Q4X 4;  2R7F A;  3SUC A;  1RUJ 4;  2ACZ A;  2B76 A;  1COV 4;  3J8F 4;  3SFD A;  1MQT D;  1PO2 4;  1AR7 4;  1AR6 4;  2PLV 4;  1PIV 4;  1D4M 4;  1VBA 4;  3CIR A;  3AE2 A;  2WDQ A;  3AED A;  2WDR A;  3FI7 A;  2HWB 4;  3P4S A;  1KFY A;  4YSZ A;  1PO1 4;  3P4R A;  1RVF 4;  3GQK A;  3AEC A;  4Q4V 4;  2X5I D;  2WQY A;  2R07 4;  1XI1 A;  3ABV A;  5C2T A;  1VBD 4;  2R06 4;  4YSY A;  1RUD 4;  3VR9 A;  3GQH A;  2RS3 4;  1RUC 4;  2EX3 A;  1R09 4;  2PW9 A;  4YT0 A;  2WP9 A;  2WDV A;  3AE1 A;  2RS5 4;  1NEK A;  2R04 4;  1EAH 4;  4YTP A;  1RUG 4;  1RHI 4;  1YQ4 A;  2RM2 4;  1ZP0 A;  1AL2 4;  4Q4Y 4;  1HRV 4;  1POV 0;  3AEB A;  2RS1 4;  3AE7 A;  3AE3 A;  2PY5 A;  3JBG 4;  3AE8 A;  2FBW A;  1XHX A;  1L0V A;  1RUH 4;  3JD7 4;  3AE6 A;  1RMU 4;  2WU5 A;  3AE9 A;  3AE4 A;  1OOP D;  1HXS 4;  1ZOY A;  2PYJ A;  4YXD A;  1K5M D;  1VBE 4;  1AR8 4;  1BEV 4;  3VR8 A;  4YTM A;  1VBB 4; 
#chains in the Genus database with same CATH homology
 1RHI 4;  1Z7S 4;  1RUE 4;  2RM2 4;  1ASJ 4;  1HRV 4;  1AL2 4;  4Q4Y 4;  4PDW D;  1PVC 4;  1POV 0;  1RUF 4;  1H8T D;  2HWC 4;  1VRH 4;  1PO1 4;  2HWB 4;  2RS1 4;  1RVF 4;  1RUI 4;  4Q4V 4;  1VBC 4;  1HRI 4;  3JBG 4;  2X5I D;  1AR9 4;  1NA1 D;  2R07 4;  4Q4X 4;  1VBD 4;  2R06 4;  1R08 4;  1RUD 4;  1RUJ 4;  1RUH 4;  3JD7 4;  4GB3 4;  2RS3 4;  1RUC 4;  1R09 4;  1RMU 4;  1COV 4;  3J8F 4;  1MQT D;  1PO2 4;  2RS5 4;  1AR7 4;  1OOP D;  1HXS 4;  1AR6 4;  2PLV 4;  2R04 4;  1PIV 4;  2RMU 4;  1K5M D;  1D4M 4;  1NCQ D;  1AR8 4;  1EAH 4;  1BEV 4;  1VBA 4;  1VBE 4;  4RHV 4;  1EV1 4;  4Q4W 4;  2RR1 4;  1RUG 4;  1VBB 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...