2RS54

Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
40
structure length
40
Chain Sequence
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords HUMAN RHINOVIRUS 14 COAT PROTEIN (SUBUNIT VP1)
publication title Structural analysis of antiviral agents that interact with the capsid of human rhinoviruses.
pubmed doi rcsb
source organism Human rhinovirus 14
total genus 2
structure length 40
sequence length 40
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 1988-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
4 PF02226 Pico_P1A Picornavirus coat protein (VP4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
4.10.80.10 Few Secondary Structures Irregular Rhinovirus 14, subunit 4 Picornavirus coat protein VP4 2rs5400
1AR84 1POV0 1RHI4 2RS54 2RM24 1VBD4 1RUF4 1AR64 1HXS4 1VBE4 2HWC4 1COV4 2X5ID 1D4M4 1EV14 2R074 2RMU4 1PO24 4RHV4 3JD74 1RUE4 1K5MD 4Q4W4 1PO14 1NCQD 2RR14 3JBG4 1BEV4 1R084 1H8TD 1VBB4 2PLV4 1VBA4 1RUG4 4PDWD 3J8F4 1AR74 1PVC4 2HWB4 1HRI4 1EAH4 1RUI4 1RUD4 1OOPD 4GB34 4Q4Y4 1VBC4 2RS14 1RUH4 1PIV4 1MQTD 1AR94 1RMU4 1HRV4 2R044 1VRH4 4Q4V4 2RS34 4Q4X4 1NA1D 2R064 1RVF4 1ASJ4 1AL24 1RUJ4 1R094 1Z7S4 1RUC4
chains in the Genus database with same CATH superfamily
1AR84 1ZP0A 3SUCA 4YTPA 2X5ID 1HXS4 2PW9A 3AE8A 5C3JA 1L0VA 1RUE4 1K5MD 3VRAA 2PYLA 3JBG4 1BEV4 1XI1A 1RUG4 2WU5A 1RUI4 1EAH4 1OOPD 4Q4Y4 4YTNA 1VBC4 1RUH4 4YSZA 5C2TA 2R044 3ABVA 2RS34 2R064 1RUJ4 4Q4X4 3AEGA 2RS54 1VBD4 1AR64 1VBE4 1COV4 4YXDA 4RHV4 3VR9A 3JD74 2PY5A 2WS3A 3CIRA 2RR14 3AE1A 4KX6A 1H8TD 1KFYA 1VBA4 4PDWD 1AR74 3P4QA 1RUD4 1KF6A 2RS14 2WP9A 1AR94 1YQ4A 4Q4V4 3AE3A 1RVF4 1AL24 2H88A 1Z7S4 1POV0 1ZOYA 1XHZA 2PZSA 2RM24 1RUF4 1NEKA 3AEBA 1D4M4 1EV14 2H89A 2R074 3AEDA 3AEFA 3P4PA 1PO24 2WDQA 1XHXA 1PO14 3AE2A 3VR8A 2B76A 1VBB4 3AE9A 1PVC4 3AEEA 3VRBA 1HRI4 2WQYA 2WDRA 1YQ3A 3AECA 4YT0A 1PIV4 1MQTD 1RMU4 2PYJA 1HRV4 1VRH4 4YSXA 1ASJ4 1R094 2WDVA 3GQKA 4YSYA 1RHI4 2ACZA 2HWC4 4YTMA 1NENA 3P4RA 3P4SA 3AE7A 2FBWA 2RMU4 3AE5A 3AEAA 4Q4W4 1NCQD 3GQHA 1R084 2WU2A 2PLV4 3SFDA 3J8F4 2HWB4 3FI7A 4GB34 2EX3A 2R7FA 3AE6A 1NA1D 3SFEA 3AE4A 1RUC4
chains in the Genus database with same CATH topology
1AR84 1POV0 1RHI4 2RS54 2RM24 1VBD4 1RUF4 1AR64 1HXS4 1VBE4 2HWC4 1COV4 2X5ID 1D4M4 1EV14 2R074 2RMU4 1PO24 4RHV4 3JD74 1RUE4 1K5MD 4Q4W4 1PO14 1NCQD 2RR14 3JBG4 1BEV4 1R084 1H8TD 1VBB4 2PLV4 1VBA4 1RUG4 4PDWD 3J8F4 1AR74 1PVC4 2HWB4 1HRI4 1EAH4 1RUI4 1RUD4 1OOPD 4GB34 4Q4Y4 1VBC4 2RS14 1RUH4 1PIV4 1MQTD 1AR94 1RMU4 1HRV4 2R044 1VRH4 4Q4V4 2RS34 4Q4X4 1NA1D 2R064 1RVF4 1ASJ4 1AL24 1RUJ4 1R094 1Z7S4 1RUC4
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AR8 4;  1POV 0;  1RHI 4;  2RS5 4;  2RM2 4;  1VBD 4;  1RUF 4;  1AR6 4;  1HXS 4;  1VBE 4;  2HWC 4;  1COV 4;  2X5I D;  1D4M 4;  1EV1 4;  2R07 4;  2RMU 4;  1PO2 4;  4RHV 4;  3JD7 4;  1RUE 4;  1K5M D;  4Q4W 4;  1PO1 4;  1NCQ D;  2RR1 4;  3JBG 4;  1BEV 4;  1R08 4;  1H8T D;  1VBB 4;  2PLV 4;  1VBA 4;  1RUG 4;  4PDW D;  3J8F 4;  1AR7 4;  1PVC 4;  2HWB 4;  1HRI 4;  1EAH 4;  1RUI 4;  1RUD 4;  1OOP D;  4GB3 4;  4Q4Y 4;  1VBC 4;  2RS1 4;  1RUH 4;  1PIV 4;  1MQT D;  1AR9 4;  1RMU 4;  1HRV 4;  2R04 4;  1VRH 4;  4Q4V 4;  2RS3 4;  4Q4X 4;  1NA1 D;  2R06 4;  1RVF 4;  1ASJ 4;  1AL2 4;  1RUJ 4;  1R09 4;  1Z7S 4;  1RUC 4; 
#chains in the Genus database with same CATH topology
 1AR8 4;  1ZP0 A;  3SUC A;  4YTP A;  2X5I D;  1HXS 4;  2PW9 A;  3AE8 A;  5C3J A;  1L0V A;  1RUE 4;  1K5M D;  3VRA A;  2PYL A;  3JBG 4;  1BEV 4;  1XI1 A;  1RUG 4;  2WU5 A;  1RUI 4;  1EAH 4;  1OOP D;  4Q4Y 4;  4YTN A;  1VBC 4;  1RUH 4;  4YSZ A;  5C2T A;  2R04 4;  3ABV A;  2RS3 4;  2R06 4;  1RUJ 4;  4Q4X 4;  3AEG A;  2RS5 4;  1VBD 4;  1AR6 4;  1VBE 4;  1COV 4;  4YXD A;  4RHV 4;  3VR9 A;  3JD7 4;  2PY5 A;  2WS3 A;  3CIR A;  2RR1 4;  3AE1 A;  4KX6 A;  1H8T D;  1KFY A;  1VBA 4;  4PDW D;  1AR7 4;  3P4Q A;  1RUD 4;  1KF6 A;  2RS1 4;  2WP9 A;  1AR9 4;  1YQ4 A;  4Q4V 4;  3AE3 A;  1RVF 4;  1AL2 4;  2H88 A;  1Z7S 4;  1POV 0;  1ZOY A;  1XHZ A;  2PZS A;  2RM2 4;  1RUF 4;  1NEK A;  3AEB A;  1D4M 4;  1EV1 4;  2H89 A;  2R07 4;  3AED A;  3AEF A;  3P4P A;  1PO2 4;  2WDQ A;  1XHX A;  1PO1 4;  3AE2 A;  3VR8 A;  2B76 A;  1VBB 4;  3AE9 A;  1PVC 4;  3AEE A;  3VRB A;  1HRI 4;  2WQY A;  2WDR A;  1YQ3 A;  3AEC A;  4YT0 A;  1PIV 4;  1MQT D;  1RMU 4;  2PYJ A;  1HRV 4;  1VRH 4;  4YSX A;  1ASJ 4;  1R09 4;  2WDV A;  3GQK A;  4YSY A;  1RHI 4;  2ACZ A;  2HWC 4;  4YTM A;  1NEN A;  3P4R A;  3P4S A;  3AE7 A;  2FBW A;  2RMU 4;  3AE5 A;  3AEA A;  4Q4W 4;  1NCQ D;  3GQH A;  1R08 4;  2WU2 A;  2PLV 4;  3SFD A;  3J8F 4;  2HWB 4;  3FI7 A;  4GB3 4;  2EX3 A;  2R7F A;  3AE6 A;  1NA1 D;  3SFE A;  3AE4 A;  1RUC 4; 
#chains in the Genus database with same CATH homology
 1AR8 4;  1POV 0;  1RHI 4;  2RS5 4;  2RM2 4;  1VBD 4;  1RUF 4;  1AR6 4;  1HXS 4;  1VBE 4;  2HWC 4;  1COV 4;  2X5I D;  1D4M 4;  1EV1 4;  2R07 4;  2RMU 4;  1PO2 4;  4RHV 4;  3JD7 4;  1RUE 4;  1K5M D;  4Q4W 4;  1PO1 4;  1NCQ D;  2RR1 4;  3JBG 4;  1BEV 4;  1R08 4;  1H8T D;  1VBB 4;  2PLV 4;  1VBA 4;  1RUG 4;  4PDW D;  3J8F 4;  1AR7 4;  1PVC 4;  2HWB 4;  1HRI 4;  1EAH 4;  1RUI 4;  1RUD 4;  1OOP D;  4GB3 4;  4Q4Y 4;  1VBC 4;  2RS1 4;  1RUH 4;  1PIV 4;  1MQT D;  1AR9 4;  1RMU 4;  1HRV 4;  2R04 4;  1VRH 4;  4Q4V 4;  2RS3 4;  4Q4X 4;  1NA1 D;  2R06 4;  1RVF 4;  1ASJ 4;  1AL2 4;  1RUJ 4;  1R09 4;  1Z7S 4;  1RUC 4; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...