The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
6
|
sequence length |
68
|
structure length |
68
|
Chain Sequence |
GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFAQDPSKFTEPIKDVLIKTAPTLN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure of poliovirus type 2 Lansing complexed with antiviral agent SCH48973: comparison of the structural and biological properties of three poliovirus serotypes.
pubmed doi rcsb |
| molecule keywords |
POLIOVIRUS TYPE 2 COAT PROTEINS VP1 TO VP4
|
| molecule tags |
Virus
|
| source organism |
Human poliovirus 2
|
| total genus |
6
|
| structure length |
68
|
| sequence length |
68
|
| ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
| pdb deposition date | 1997-07-22 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| 4 | PF02226 | Pico_P1A | Picornavirus coat protein (VP4) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | Picornavirus coat protein VP4 |
#chains in the Genus database with same CATH superfamily 1K5M D; 1RUD 4; 2X5I D; 1PIV 4; 1BEV 4; 1POV 0; 1AR6 4; 1EAH 4; 1PO2 4; 1RUI 4; 1OOP D; 1RUG 4; 1VBB 4; 1VRH 4; 1Z7S 4; 2PLV 4; 1AL2 4; 1R08 4; 2R07 4; 4Q4Y 4; 4RHV 4; 1NCQ D; 1RUC 4; 1RHI 4; 1NA1 D; 1RUF 4; 2RS5 4; 1ASJ 4; 1HRV 4; 1VBA 4; 2RMU 4; 3JD7 4; 1AR8 4; 1VBD 4; 1EV1 4; 1PVC 4; 1D4M 4; 2R06 4; 2RS1 4; 4Q4V 4; 2HWB 4; 1H8T D; 1RVF 4; 1COV 4; 1VBE 4; 2R04 4; 1MQT D; 2RS3 4; 1RUJ 4; 2RM2 4; 1PO1 4; 1RUE 4; 4Q4W 4; 4Q4X 4; 3J8F 4; 1AR9 4; 1HRI 4; 1HXS 4; 2RR1 4; 2HWC 4; 4PDW D; 1R09 4; 1VBC 4; 1RUH 4; 1RMU 4; 4GB3 4; 3JBG 4; 1AR7 4; #chains in the Genus database with same CATH topology 1RUD 4; 4YSY A; 1AR6 4; 1RUI 4; 1VRH 4; 1KF6 A; 4YTM A; 3AEG A; 3P4R A; 3AEB A; 3SFD A; 3VR9 A; 1RHI 4; 1HRV 4; 3JD7 4; 3ABV A; 3GQK A; 1H8T D; 2PW9 A; 5C3J A; 1NEN A; 2WDV A; 3J8F 4; 2HWC 4; 4PDW D; 2PZS A; 4YTP A; 3AEF A; 1R09 4; 1VBC 4; 1RMU 4; 4GB3 4; 3AE6 A; 3AE4 A; 2PY5 A; 3AE8 A; 2FBW A; 2R7F A; 1YQ3 A; 1OOP D; 1RUG 4; 3AEE A; 3FI7 A; 4Q4Y 4; 4RHV 4; 1RUC 4; 4YT0 A; 2RS5 4; 1ASJ 4; 2B76 A; 2EX3 A; 2HWB 4; 1VBE 4; 2R04 4; 3GQH A; 1MQT D; 2H88 A; 1HXS 4; 3AED A; 3CIR A; 1RUH 4; 3AE5 A; 4YSZ A; 4KX6 A; 2X5I D; 2WP9 A; 1VBB 4; 1Z7S 4; 2WU5 A; 3VRA A; 4YXD A; 2PLV 4; 1AL2 4; 1R08 4; 2H89 A; 2R07 4; 2WS3 A; 3AE3 A; 1NEK A; 1NA1 D; 2WDQ A; 2WQY A; 1AR8 4; 1VBD 4; 1EV1 4; 1PVC 4; 1D4M 4; 2R06 4; 2RS1 4; 4Q4V 4; 2RS3 4; 1ZP0 A; 1RUJ 4; 1PO1 4; 1RUE 4; 1ZOY A; 3AE2 A; 1KFY A; 3SUC A; 3VRB A; 4YTN A; 3VR8 A; 1AR7 4; 3JBG 4; 3AEC A; 1K5M D; 2WU2 A; 1PIV 4; 1BEV 4; 1POV 0; 1XHX A; 3SFE A; 1PO2 4; 1EAH 4; 5C2T A; 1NCQ D; 1RUF 4; 3AE1 A; 3P4P A; 1XHZ A; 1VBA 4; 2RMU 4; 3P4S A; 1YQ4 A; 1XI1 A; 2WDR A; 1RVF 4; 1COV 4; 2ACZ A; 2RM2 4; 3P4Q A; 3AE7 A; 4Q4W 4; 4Q4X 4; 3AEA A; 1AR9 4; 1HRI 4; 2RR1 4; 2PYJ A; 3AE9 A; 1L0V A; 2PYL A; 4YSX A; #chains in the Genus database with same CATH homology 1K5M D; 1RUD 4; 2X5I D; 1PIV 4; 1BEV 4; 1POV 0; 1AR6 4; 1EAH 4; 1PO2 4; 1RUI 4; 1OOP D; 1RUG 4; 1VBB 4; 1VRH 4; 1Z7S 4; 2PLV 4; 1AL2 4; 1R08 4; 2R07 4; 4Q4Y 4; 4RHV 4; 1NCQ D; 1RUC 4; 1RHI 4; 1NA1 D; 1RUF 4; 2RS5 4; 1ASJ 4; 1HRV 4; 1VBA 4; 2RMU 4; 3JD7 4; 1AR8 4; 1VBD 4; 1EV1 4; 1PVC 4; 1D4M 4; 2R06 4; 2RS1 4; 4Q4V 4; 2HWB 4; 1H8T D; 1RVF 4; 1COV 4; 1VBE 4; 2R04 4; 1MQT D; 2RS3 4; 1RUJ 4; 2RM2 4; 1PO1 4; 1RUE 4; 4Q4W 4; 4Q4X 4; 3J8F 4; 1AR9 4; 1HRI 4; 1HXS 4; 2RR1 4; 2HWC 4; 4PDW D; 1R09 4; 1VBC 4; 1RUH 4; 1RMU 4; 4GB3 4; 3JBG 4; 1AR7 4;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...