The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
1
|
sequence length |
68
|
structure length |
60
|
Chain Sequence |
GAQVSTQKTGAHESIIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMVKSLPALN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Determination of the Structure of a Decay Accelerating Factor-Binding Clinical Isolate of Echovirus 11 Allows Mapping of Mutants with Altered Receptor Requirements for Infection
pubmed doi rcsb |
| molecule keywords |
ECHOVIRUS 11 COAT PROTEIN VP1
|
| molecule tags |
Virus
|
| total genus |
1
|
| structure length |
60
|
| sequence length |
68
|
| ec nomenclature | |
| pdb deposition date | 2001-02-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| D | PF02226 | Pico_P1A | Picornavirus coat protein (VP4) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | Picornavirus coat protein VP4 |
#chains in the Genus database with same CATH superfamily 1EAH 4; 1RVF 4; 1RUE 4; 2X5I D; 1R08 4; 4RHV 4; 1HRV 4; 1RUJ 4; 1AR7 4; 4GB3 4; 2RM2 4; 1RMU 4; 2RS5 4; 1D4M 4; 2R06 4; 1MQT D; 3J8F 4; 1PO1 4; 1HRI 4; 1VBA 4; 2RR1 4; 1VBC 4; 1AR9 4; 1POV 0; 1VBE 4; 1VBD 4; 3JBG 4; 1EV1 4; 2PLV 4; 2R04 4; 4PDW D; 4Q4Y 4; 2HWC 4; 1NCQ D; 1RUG 4; 1H8T D; 4Q4W 4; 1AL2 4; 1RUI 4; 1PVC 4; 2R07 4; 1RHI 4; 1R09 4; 2RMU 4; 3JD7 4; 4Q4X 4; 1AR8 4; 1AR6 4; 1RUC 4; 1OOP D; 1ASJ 4; 1PO2 4; 1COV 4; 4Q4V 4; 1RUF 4; 1VBB 4; 2RS1 4; 2HWB 4; 1RUH 4; 1Z7S 4; 1PIV 4; 2RS3 4; 1HXS 4; 1NA1 D; 1VRH 4; 1RUD 4; 1BEV 4; 1K5M D; #chains in the Genus database with same CATH topology 1NEN A; 3AED A; 5C3J A; 2B76 A; 3AEF A; 1NEK A; 2WQY A; 1RUJ 4; 3AEG A; 3VRA A; 4YTP A; 2RS5 4; 4YTM A; 2RR1 4; 4YSZ A; 1VBE 4; 1VBD 4; 2PYJ A; 4Q4W 4; 3SFD A; 3JD7 4; 1R09 4; 2WP9 A; 2WS3 A; 1PO2 4; 1COV 4; 1YQ3 A; 3AE5 A; 3AEA A; 1ZOY A; 2ACZ A; 1PIV 4; 2H89 A; 2R7F A; 1NA1 D; 2PW9 A; 3VR8 A; 1RUD 4; 3P4R A; 1BEV 4; 1EAH 4; 1RUE 4; 4YSY A; 3GQK A; 1KFY A; 2R06 4; 1MQT D; 3P4P A; 1VBA 4; 1VBC 4; 3AEE A; 3JBG 4; 1EV1 4; 1RUG 4; 1H8T D; 1AL2 4; 1RUI 4; 1PVC 4; 1RHI 4; 1XHX A; 1OOP D; 3CIR A; 1ZP0 A; 2FBW A; 1HXS 4; 1VRH 4; 1RUH 4; 2WU5 A; 1RVF 4; 2X5I D; 2PYL A; 1XI1 A; 5C2T A; 3P4Q A; 1RMU 4; 1D4M 4; 2WU2 A; 3J8F 4; 3SFE A; 1AR9 4; 4YXD A; 4Q4Y 4; 2R04 4; 1XHZ A; 4YTN A; 2R07 4; 2RMU 4; 1YQ4 A; 1RUC 4; 3AE9 A; 1ASJ 4; 4Q4V 4; 3AE6 A; 1VBB 4; 3VRB A; 2HWB 4; 3VR9 A; 3AE8 A; 3ABV A; 4KX6 A; 3AEC A; 1R08 4; 4RHV 4; 4YSX A; 3GQH A; 1HRV 4; 1AR7 4; 4GB3 4; 4YT0 A; 2WDQ A; 1PO1 4; 3P4S A; 1HRI 4; 3AE4 A; 1POV 0; 2H88 A; 4PDW D; 2PLV 4; 2WDV A; 2EX3 A; 2HWC 4; 1KF6 A; 1NCQ D; 3AE7 A; 3SUC A; 1L0V A; 2PY5 A; 4Q4X 4; 2WDR A; 1AR8 4; 2PZS A; 1AR6 4; 3AE3 A; 3AE1 A; 3FI7 A; 1RUF 4; 2RS1 4; 3AE2 A; 1Z7S 4; 2RS3 4; 3AEB A; 2RM2 4; 1K5M D; #chains in the Genus database with same CATH homology 1EAH 4; 1RVF 4; 1RUE 4; 2X5I D; 1R08 4; 4RHV 4; 1HRV 4; 1RUJ 4; 1AR7 4; 4GB3 4; 2RM2 4; 1RMU 4; 2RS5 4; 1D4M 4; 2R06 4; 1MQT D; 3J8F 4; 1PO1 4; 1HRI 4; 1VBA 4; 2RR1 4; 1VBC 4; 1AR9 4; 1POV 0; 1VBE 4; 1VBD 4; 3JBG 4; 1EV1 4; 2PLV 4; 2R04 4; 4PDW D; 4Q4Y 4; 2HWC 4; 1NCQ D; 1RUG 4; 1H8T D; 4Q4W 4; 1AL2 4; 1RUI 4; 1PVC 4; 2R07 4; 1RHI 4; 1R09 4; 2RMU 4; 3JD7 4; 4Q4X 4; 1AR8 4; 1AR6 4; 1RUC 4; 1OOP D; 1ASJ 4; 1PO2 4; 1COV 4; 4Q4V 4; 1RUF 4; 1VBB 4; 2RS1 4; 2HWB 4; 1RUH 4; 1Z7S 4; 1PIV 4; 2RS3 4; 1HXS 4; 1NA1 D; 1VRH 4; 1RUD 4; 1BEV 4; 1K5M D;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
