The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
68
|
structure length |
62
|
Chain Sequence |
GAQVSSQKVGAHENSSTINYTTINYYKDSASNAASKQDYSQDPSKFTEPLKDVLIKTAPALN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Virus
|
source organism |
Poliovirus type 3 (strains p3/leon/37 and p3/leon 12a[1]b)
|
publication title |
Binding of the antiviral drug WIN51711 to the sabin strain of type 3 poliovirus: structural comparison with drug binding in rhinovirus 14.
pubmed doi rcsb |
molecule keywords |
POLIOVIRUS TYPE 3 (SUBUNIT VP1)
|
total genus |
4
|
structure length |
62
|
sequence length |
68
|
ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
pdb deposition date | 1995-02-02 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
4 | PF02226 | Pico_P1A | Picornavirus coat protein (VP4) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | Picornavirus coat protein VP4 |
#chains in the Genus database with same CATH superfamily 1VBD 4; 2HWC 4; 2RS1 4; 1RVF 4; 1PO1 4; 1R09 4; 1MQT D; 1PO2 4; 1RUF 4; 1EAH 4; 1AR6 4; 2R04 4; 3J8F 4; 2RR1 4; 1BEV 4; 1HRV 4; 1RUC 4; 1H8T D; 3JD7 4; 1ASJ 4; 1HRI 4; 1NCQ D; 2PLV 4; 3JBG 4; 2HWB 4; 1R08 4; 1AL2 4; 2RMU 4; 2X5I D; 2RM2 4; 1D4M 4; 1VBE 4; 4GB3 4; 1AR9 4; 4PDW D; 2R06 4; 4Q4V 4; 1VBA 4; 1RUJ 4; 4RHV 4; 2R07 4; 1AR7 4; 1OOP D; 1EV1 4; 1RMU 4; 1RUH 4; 1K5M D; 1COV 4; 1PVC 4; 1HXS 4; 1RUE 4; 1RUI 4; 1RUG 4; 4Q4W 4; 1PIV 4; 1VRH 4; 1POV 0; 1AR8 4; 1VBB 4; 1RHI 4; 1VBC 4; 2RS3 4; 2RS5 4; 1NA1 D; 4Q4Y 4; 1Z7S 4; 4Q4X 4; 1RUD 4; #chains in the Genus database with same CATH topology 2HWC 4; 2PW9 A; 2RS1 4; 1RVF 4; 4YXD A; 2R04 4; 1XHZ A; 2RR1 4; 1XHX A; 3JD7 4; 3SUC A; 2PLV 4; 3CIR A; 1L0V A; 3VRA A; 3GQH A; 2RMU 4; 4GB3 4; 2R06 4; 1NEK A; 1RUJ 4; 3GQK A; 4YSX A; 2ACZ A; 3FI7 A; 1EV1 4; 1RUI 4; 2WP9 A; 4Q4W 4; 1PIV 4; 1VBB 4; 3P4P A; 4Q4Y 4; 3AE9 A; 3AED A; 1R09 4; 2WU2 A; 1RUF 4; 1HRV 4; 3AEG A; 1HRI 4; 1NCQ D; 2HWB 4; 1NEN A; 3VR9 A; 1YQ3 A; 4YTN A; 1VBE 4; 3P4S A; 4Q4V 4; 1VBA 4; 3AE3 A; 2R07 4; 3AE2 A; 1RMU 4; 3AE5 A; 1COV 4; 1PVC 4; 2WQY A; 1ZP0 A; 2RS3 4; 4YSY A; 1NA1 D; 1VBD 4; 1MQT D; 2R7F A; 2PYJ A; 5C2T A; 1AR6 4; 3J8F 4; 3AEC A; 1RUC 4; 3AEE A; 3JBG 4; 3SFD A; 2WDV A; 1AL2 4; 2X5I D; 2RM2 4; 1XI1 A; 4PDW D; 1AR9 4; 2PYL A; 3SFE A; 2FBW A; 2WS3 A; 2PZS A; 4KX6 A; 1OOP D; 2WDR A; 1RUH 4; 1HXS 4; 1RUE 4; 3AE6 A; 3VR8 A; 1VRH 4; 3AE4 A; 1VBC 4; 3AE7 A; 3AEB A; 4YTP A; 1Z7S 4; 1RUD 4; 2WU5 A; 1PO1 4; 1PO2 4; 4YTM A; 1KFY A; 1EAH 4; 1ZOY A; 3AE8 A; 1BEV 4; 4YSZ A; 1YQ4 A; 3AEF A; 1H8T D; 5C3J A; 3AE1 A; 2WDQ A; 1ASJ 4; 3P4Q A; 2PY5 A; 1R08 4; 2H89 A; 3P4R A; 3ABV A; 3AEA A; 1D4M 4; 4RHV 4; 2B76 A; 1AR7 4; 3VRB A; 1K5M D; 2EX3 A; 1RUG 4; 1POV 0; 1AR8 4; 2RS5 4; 1RHI 4; 2H88 A; 1KF6 A; 4YT0 A; 4Q4X 4; #chains in the Genus database with same CATH homology 1VBD 4; 2HWC 4; 2RS1 4; 1RVF 4; 1PO1 4; 1R09 4; 1MQT D; 1PO2 4; 1RUF 4; 1EAH 4; 1AR6 4; 2R04 4; 3J8F 4; 2RR1 4; 1BEV 4; 1HRV 4; 1RUC 4; 1H8T D; 3JD7 4; 1ASJ 4; 1HRI 4; 1NCQ D; 2PLV 4; 3JBG 4; 2HWB 4; 1R08 4; 1AL2 4; 2RMU 4; 2X5I D; 2RM2 4; 1D4M 4; 1VBE 4; 4GB3 4; 1AR9 4; 4PDW D; 2R06 4; 4Q4V 4; 1VBA 4; 1RUJ 4; 4RHV 4; 2R07 4; 1AR7 4; 1OOP D; 1EV1 4; 1RMU 4; 1RUH 4; 1K5M D; 1COV 4; 1PVC 4; 1HXS 4; 1RUE 4; 1RUI 4; 1RUG 4; 4Q4W 4; 1PIV 4; 1VRH 4; 1POV 0; 1AR8 4; 1VBB 4; 1RHI 4; 1VBC 4; 2RS3 4; 2RS5 4; 1NA1 D; 4Q4Y 4; 1Z7S 4; 4Q4X 4; 1RUD 4;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...