The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
2
|
sequence length |
40
|
structure length |
40
|
Chain Sequence |
INYYKDAASTSSAGQSLSMDPSKFTEPVKDLMLKGAPALN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Synthesis and activity of piperazine-containing antirhinoviral agents and crystal structure of SDZ 880-061 bound to human rhinovirus 14.
pubmed doi rcsb |
molecule tags |
Virus
|
source organism |
Human rhinovirus 14
|
molecule keywords |
RHINOVIRUS 14
|
total genus |
2
|
structure length |
40
|
sequence length |
40
|
ec nomenclature |
ec
2.7.7.48: RNA-directed RNA polymerase. |
pdb deposition date | 1996-02-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
4 | PF02226 | Pico_P1A | Picornavirus coat protein (VP4) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | Picornavirus coat protein VP4 |
#chains in the Genus database with same CATH superfamily 1HXS 4; 2R07 4; 2X5I D; 4GB3 4; 1AR6 4; 1K5M D; 1AR8 4; 1NCQ D; 4Q4V 4; 1RUH 4; 1RMU 4; 1VBC 4; 1R08 4; 1VBA 4; 1PIV 4; 1VBB 4; 1BEV 4; 1R09 4; 4Q4X 4; 2RS1 4; 1AL2 4; 1EV1 4; 1AR7 4; 1PO2 4; 1RUD 4; 1RHI 4; 3J8F 4; 2RS5 4; 1OOP D; 2HWB 4; 1RUE 4; 1COV 4; 1PVC 4; 1RUF 4; 1MQT D; 1RUI 4; 2PLV 4; 2R06 4; 4Q4W 4; 1PO1 4; 1HRV 4; 1D4M 4; 2RR1 4; 3JBG 4; 2HWC 4; 4Q4Y 4; 1ASJ 4; 1AR9 4; 1RUG 4; 1RVF 4; 1Z7S 4; 2RM2 4; 4PDW D; 2RMU 4; 1VBE 4; 2R04 4; 2RS3 4; 4RHV 4; 1RUC 4; 1H8T D; 1HRI 4; 1VRH 4; 1NA1 D; 1RUJ 4; 1EAH 4; 3JD7 4; 1POV 0; 1VBD 4; #chains in the Genus database with same CATH topology 1HXS 4; 1K5M D; 1AR8 4; 4Q4V 4; 2WDQ A; 2ACZ A; 4YSX A; 2PYL A; 4YT0 A; 3AE9 A; 2PW9 A; 1OOP D; 1RUE 4; 4YSY A; 1RUF 4; 3AEG A; 3JBG 4; 2HWC 4; 1RUG 4; 3AEB A; 4KX6 A; 2R7F A; 2R04 4; 3CIR A; 3GQK A; 1RUC 4; 1XI1 A; 3SUC A; 3FI7 A; 3AEE A; 1AR6 4; 3AE4 A; 1NCQ D; 1RUH 4; 1RMU 4; 1VBC 4; 3AE6 A; 1VBA 4; 5C2T A; 2WU5 A; 3VRB A; 1PO2 4; 1RUD 4; 1RHI 4; 2RS5 4; 2H89 A; 2HWB 4; 2B76 A; 2WDV A; 3SFE A; 1COV 4; 1RUI 4; 2PLV 4; 1KFY A; 2RR1 4; 3AED A; 1L0V A; 3VR9 A; 3AE7 A; 3AE1 A; 4RHV 4; 3AE2 A; 1ZP0 A; 2H88 A; 2PY5 A; 1H8T D; 1VRH 4; 1ZOY A; 1NA1 D; 3P4Q A; 3JD7 4; 1POV 0; 4YXD A; 2R07 4; 2EX3 A; 1NEN A; 1R08 4; 2FBW A; 3AEC A; 1AL2 4; 1XHZ A; 3AE8 A; 4YSZ A; 3J8F 4; 2WU2 A; 3P4S A; 1PVC 4; 4Q4W 4; 2R06 4; 1HRV 4; 4Q4Y 4; 1KF6 A; 1ASJ 4; 1AR9 4; 1RVF 4; 1Z7S 4; 2RM2 4; 2WS3 A; 3VRA A; 3ABV A; 1VBE 4; 1RUJ 4; 1EAH 4; 2X5I D; 1XHX A; 4GB3 4; 3P4P A; 2PYJ A; 2WP9 A; 3AEF A; 5C3J A; 1PIV 4; 1VBB 4; 1YQ4 A; 1BEV 4; 1YQ3 A; 1R09 4; 4YTM A; 4Q4X 4; 2RS1 4; 3AEA A; 2PZS A; 1EV1 4; 1AR7 4; 3GQH A; 4YTP A; 3AE3 A; 2WQY A; 1MQT D; 3VR8 A; 1PO1 4; 1D4M 4; 1NEK A; 3AE5 A; 3P4R A; 3SFD A; 4YTN A; 4PDW D; 2WDR A; 2RMU 4; 2RS3 4; 1HRI 4; 1VBD 4; #chains in the Genus database with same CATH homology 1HXS 4; 2R07 4; 2X5I D; 4GB3 4; 1AR6 4; 1K5M D; 1AR8 4; 1NCQ D; 4Q4V 4; 1RUH 4; 1RMU 4; 1VBC 4; 1R08 4; 1VBA 4; 1PIV 4; 1VBB 4; 1BEV 4; 1R09 4; 4Q4X 4; 2RS1 4; 1AL2 4; 1EV1 4; 1AR7 4; 1PO2 4; 1RUD 4; 1RHI 4; 3J8F 4; 2RS5 4; 1OOP D; 2HWB 4; 1RUE 4; 1COV 4; 1PVC 4; 1RUF 4; 1MQT D; 1RUI 4; 2PLV 4; 2R06 4; 4Q4W 4; 1PO1 4; 1HRV 4; 1D4M 4; 2RR1 4; 3JBG 4; 2HWC 4; 4Q4Y 4; 1ASJ 4; 1AR9 4; 1RUG 4; 1RVF 4; 1Z7S 4; 2RM2 4; 4PDW D; 2RMU 4; 1VBE 4; 2R04 4; 2RS3 4; 4RHV 4; 1RUC 4; 1H8T D; 1HRI 4; 1VRH 4; 1NA1 D; 1RUJ 4; 1EAH 4; 3JD7 4; 1POV 0; 1VBD 4;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...