The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
4
|
sequence length |
68
|
structure length |
55
|
Chain Sequence |
GAQVSTQKTGIHYTNINYYKDAASNSANRQDFTQDPGKFTEPVKDIMIKSLPALN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The Crystal Structure of a Coxsackievirus B3-RD Variant and a Refined 9-Angstrom Cryo-Electron Microscopy Reconstruction of the Virus Complexed with Decay-Accelerating Factor (DAF) Provide a New Footprint of DAF on the Virus Surface.
pubmed doi rcsb |
molecule tags |
Virus
|
molecule keywords |
coat protein 1
|
total genus |
4
|
structure length |
55
|
sequence length |
68
|
ec nomenclature | |
pdb deposition date | 2012-07-26 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
4 | PF02226 | Pico_P1A | Picornavirus coat protein (VP4) |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Few Secondary Structures | Irregular | Rhinovirus 14, subunit 4 | Picornavirus coat protein VP4 |
#chains in the Genus database with same CATH superfamily 1D4M 4; 1POV 0; 1RUE 4; 1NA1 D; 1EAH 4; 1VBE 4; 1AR9 4; 2RR1 4; 1HXS 4; 1VBC 4; 4RHV 4; 1RUH 4; 2RS5 4; 1HRV 4; 1RMU 4; 1HRI 4; 4Q4X 4; 1PO1 4; 1VBA 4; 2RMU 4; 1COV 4; 2R04 4; 1K5M D; 3J8F 4; 2RM2 4; 4Q4Y 4; 1H8T D; 1RHI 4; 2RS3 4; 1VRH 4; 1PIV 4; 1RUF 4; 1RUC 4; 1ASJ 4; 1PVC 4; 2HWB 4; 1PO2 4; 1VBB 4; 2RS1 4; 2PLV 4; 4GB3 4; 1EV1 4; 1RUD 4; 1RVF 4; 2R07 4; 1RUG 4; 1VBD 4; 2X5I D; 1BEV 4; 4PDW D; 1RUI 4; 1Z7S 4; 1AL2 4; 1OOP D; 4Q4V 4; 1AR7 4; 1RUJ 4; 2HWC 4; 1R08 4; 1MQT D; 1R09 4; 4Q4W 4; 1AR6 4; 3JBG 4; 3JD7 4; 1NCQ D; 1AR8 4; 2R06 4; #chains in the Genus database with same CATH topology 1D4M 4; 1AR9 4; 1VBC 4; 4RHV 4; 1RUH 4; 2RS5 4; 5C2T A; 1HRV 4; 1PO1 4; 1VBA 4; 3ABV A; 2WS3 A; 3J8F 4; 1KF6 A; 2RM2 4; 3AEC A; 4YSX A; 1H8T D; 3SFE A; 1RUF 4; 2WP9 A; 3AE1 A; 4GB3 4; 3SUC A; 4YTN A; 1NEN A; 2FBW A; 1Z7S 4; 2HWC 4; 2WU5 A; 1MQT D; 1R09 4; 3AE9 A; 4Q4W 4; 1AR6 4; 3JBG 4; 4YSY A; 2RR1 4; 1EAH 4; 1HXS 4; 3VR8 A; 1NEK A; 1HRI 4; 4YT0 A; 2WU2 A; 3FI7 A; 3AE5 A; 3AEF A; 2RMU 4; 3GQK A; 2R04 4; 3AEA A; 2WDR A; 3SFD A; 2WQY A; 3AE3 A; 1VRH 4; 3AED A; 3VR9 A; 1RUC 4; 3AEE A; 1VBB 4; 3AEG A; 4YSZ A; 4YXD A; 2PYL A; 3GQH A; 1RUD 4; 2R07 4; 1VBD 4; 4PDW D; 2PYJ A; 2H89 A; 2R7F A; 3P4S A; 3JD7 4; 1AR8 4; 2R06 4; 4YTM A; 2PW9 A; 2EX3 A; 1POV 0; 1RUE 4; 1NA1 D; 3VRB A; 1RMU 4; 4Q4X 4; 2H88 A; 1COV 4; 1K5M D; 3AE7 A; 2RS3 4; 2WDQ A; 1PIV 4; 1ASJ 4; 2HWB 4; 3AEB A; 2PLV 4; 3CIR A; 1EV1 4; 1RVF 4; 1YQ3 A; 2X5I D; 1RUG 4; 5C3J A; 1BEV 4; 1XHX A; 4KX6 A; 3P4R A; 1RUI 4; 1XHZ A; 1AL2 4; 2PY5 A; 1NCQ D; 4YTP A; 1VBE 4; 3AE6 A; 3P4P A; 3AE8 A; 1ZP0 A; 2ACZ A; 2PZS A; 1ZOY A; 3AE2 A; 4Q4Y 4; 1RHI 4; 3VRA A; 3AE4 A; 1KFY A; 1PVC 4; 1PO2 4; 2RS1 4; 3P4Q A; 1L0V A; 1XI1 A; 1OOP D; 4Q4V 4; 1AR7 4; 1RUJ 4; 2WDV A; 1R08 4; 1YQ4 A; 2B76 A; #chains in the Genus database with same CATH homology 1D4M 4; 1POV 0; 1RUE 4; 1NA1 D; 1EAH 4; 1VBE 4; 1AR9 4; 2RR1 4; 1HXS 4; 1VBC 4; 4RHV 4; 1RUH 4; 2RS5 4; 1HRV 4; 1RMU 4; 1HRI 4; 4Q4X 4; 1PO1 4; 1VBA 4; 2RMU 4; 1COV 4; 2R04 4; 1K5M D; 3J8F 4; 2RM2 4; 4Q4Y 4; 1H8T D; 1RHI 4; 2RS3 4; 1VRH 4; 1PIV 4; 1RUF 4; 1RUC 4; 1ASJ 4; 1PVC 4; 2HWB 4; 1PO2 4; 1VBB 4; 2RS1 4; 2PLV 4; 4GB3 4; 1EV1 4; 1RUD 4; 1RVF 4; 2R07 4; 1RUG 4; 1VBD 4; 2X5I D; 1BEV 4; 4PDW D; 1RUI 4; 1Z7S 4; 1AL2 4; 1OOP D; 4Q4V 4; 1AR7 4; 1RUJ 4; 2HWC 4; 1R08 4; 1MQT D; 1R09 4; 4Q4W 4; 1AR6 4; 3JBG 4; 3JD7 4; 1NCQ D; 1AR8 4; 2R06 4;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...