1I5SA

Crystal structure of the kif1a motor domain complexed with mg-adp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
330
Chain Sequence
ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERAKGTRLKEGANINKSLTTLGKVISALAEMDIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN-LIKE PROTEIN KIF1A
publication title Switch-based mechanism of kinesin motors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 104
structure length 330
sequence length 349
ec nomenclature
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1i5sA00
4E7ZA 2Y65A 4ANJA 1D1AA 4A1ZA 4FRZA 5LT4A 2FMEA 4PFPA 1D1BA 1V8JA 4DBRA 3COBA 4BN2A 2X2RA 1VOMA 1MMNA 3CNZA 2XT3A 3L1CA 3LREA 2MYSA 3U06A 4UBFA 4E7SA 4ZCAA 1D0YA 2FKYA 2KINA 3KENA 1II6A 1D0XA 1FMWA 3NWNA 4PJJA 1MKJA 2XAEA 3H4SA 4LNUK 5LT2A 2ZFLA 1F9TA 1BG2A 2UYIA 1VFXA 1F9VA 1VFZA 5LT3A 2X7DA 3X2TA 1F9UA 4H1GA 4PJNA 3ZFDA 1MNEA 2NCDA 2VB6A 3KARA 2VVGA 1D1CA 5LT0A 1MMAA 1VFVA 1YRSA 1V8KA 2WOGA 1KK7A 1G8XA 1BR2A 3B6VA 1FMVA 2HEHA 2Y5WA 4BBGA 1VFWA 3ZCWA 2ZFMA 4A5YA 2FL2A 4A51A 3DCBA 1N6MA 1BR1A 1D0ZA 4B7BA 3WRDA 4ETPA 3DC4A 5GSZA 3B6UA 2VASA 1F9WA 1MMDA 1X88A 2Q2YA 4Y05A 5HLEA 2OWMA 2X51A 2V26A 2IEHA 3GBJA 4HNAK 1LVKA 4ZHIA 3BFNA 1I5SA 1Q0BA 2GRYA 2ZFJA 4GKRA 2G1QA 4BXNA 4AP0A 2PG2A 2X7EA 4A14A 3WPNA 2GM1A 4PJMA 4PFOA 1T5CA 1RY6A 2ZFKA 2FL6A 1BR4A 5LT1A 1I6IA 1LKXA 3CJOA 2X7CA 1CZ7A 1MMGA 4PJLA 4PK4A 2UYMA 3ZFCA 4AS7A 1GOJA 4DBQA 1SDMA 3KINA 3T0QA 2ZFIA 4A28A 2Q2ZA 3L9HA 3HQDA 3K5EA 4A50A 3PXNA 3K3BA
chains in the Genus database with same CATH superfamily
4E7ZA 2Y65A 4ANJA 1D1AA 4A1ZA 4FRZA 5LT4A 2FMEA 4PFPA 1D1BA 1V8JA 4DBRA 3COBA 4BN2A 2X2RA 1VOMA 1MMNA 3CNZA 2XT3A 3L1CA 3LREA 2MYSA 3U06A 4UBFA 4E7SA 4ZCAA 1D0YA 2FKYA 2KINA 3KENA 1II6A 1D0XA 1FMWA 3NWNA 4PJJA 1MKJA 2XAEA 3H4SA 4LNUK 5LT2A 2ZFLA 1F9TA 1BG2A 2UYIA 1VFXA 1F9VA 1VFZA 5LT3A 2X7DA 3X2TA 1F9UA 4H1GA 4PJNA 3ZFDA 1MNEA 2NCDA 2VB6A 3KARA 2VVGA 1D1CA 5LT0A 1MMAA 1VFVA 1YRSA 1V8KA 2WOGA 1KK7A 1G8XA 1BR2A 3B6VA 1FMVA 4GKPA 2HEHA 2Y5WA 4BBGA 1VFWA 3ZCWA 2ZFMA 4A5YA 2FL2A 4A51A 3DCBA 1N6MA 1BR1A 1D0ZA 4B7BA 3WRDA 4ETPA 3DC4A 5GSZA 3B6UA 2VASA 1F9WA 1MMDA 1X88A 2Q2YA 4Y05A 5HLEA 4ETPB 2OWMA 2X51A 2V26A 2IEHA 3GBJA 4HNAK 1LVKA 4ZHIA 3BFNA 1I5SA 1Q0BA 2GRYA 2O0AA 2ZFJA 4GKRA 2G1QA 4BXNA 4GKQA 4AP0A 2PG2A 2X7EA 4A14A 3WPNA 2GM1A 4PJMA 4PFOA 1T5CA 1RY6A 2ZFKA 2FL6A 1BR4A 5LT1A 1I6IA 1LKXA 3CJOA 2X7CA 1CZ7A 1MMGA 4PJLA 4PK4A 2UYMA 3ZFCA 4AS7A 1GOJA 4DBQA 1SDMA 3KINA 3T0QA 2ZFIA 4A28A 2Q2ZA 3L9HA 3HQDA 3K5EA 4A50A 3PXNA 3K3BA
chains in the Genus database with same CATH topology
4E7ZA 2Y65A 4ANJA 1D1AA 4A1ZA 4FRZA 5LT4A 2FMEA 4PFPA 1D1BA 1V8JA 4DBRA 3COBA 4BN2A 2X2RA 1VOMA 1MMNA 3CNZA 2XT3A 3L1CA 3LREA 2MYSA 3U06A 4UBFA 4E7SA 4ZCAA 1D0YA 2FKYA 2KINA 3KENA 1II6A 1D0XA 1FMWA 3NWNA 4PJJA 1MKJA 2XAEA 3H4SA 4LNUK 5LT2A 2ZFLA 1F9TA 1BG2A 2UYIA 1VFXA 1F9VA 1VFZA 5LT3A 2X7DA 3X2TA 1F9UA 4H1GA 4PJNA 3ZFDA 1MNEA 2NCDA 2VB6A 3KARA 2VVGA 1D1CA 5LT0A 1MMAA 1VFVA 1YRSA 1V8KA 2WOGA 1KK7A 1G8XA 1BR2A 3B6VA 1FMVA 2HEHA 2Y5WA 4BBGA 1VFWA 3ZCWA 2ZFMA 4A5YA 2FL2A 4A51A 3DCBA 1N6MA 1BR1A 1D0ZA 4B7BA 3WRDA 4ETPA 3DC4A 5GSZA 3B6UA 2VASA 1F9WA 1MMDA 1X88A 2Q2YA 4Y05A 5HLEA 2OWMA 2X51A 2V26A 2IEHA 3GBJA 4HNAK 1LVKA 4ZHIA 3BFNA 1I5SA 1Q0BA 2GRYA 2ZFJA 4GKRA 2G1QA 4BXNA 4AP0A 2PG2A 2X7EA 4A14A 3WPNA 2GM1A 4PJMA 4PFOA 1T5CA 1RY6A 2ZFKA 2FL6A 1BR4A 5LT1A 1I6IA 1LKXA 3CJOA 2X7CA 1CZ7A 1MMGA 4PJLA 4PK4A 2UYMA 3ZFCA 4AS7A 1GOJA 4DBQA 1SDMA 3KINA 3T0QA 2ZFIA 4A28A 2Q2ZA 3L9HA 3HQDA 3K5EA 4A50A 3PXNA 3K3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E7Z A;  2Y65 A;  4ANJ A;  1D1A A;  4A1Z A;  4FRZ A;  5LT4 A;  2FME A;  4PFP A;  1D1B A;  1V8J A;  4DBR A;  3COB A;  4BN2 A;  2X2R A;  1VOM A;  1MMN A;  3CNZ A;  2XT3 A;  3L1C A;  3LRE A;  2MYS A;  3U06 A;  4UBF A;  4E7S A;  4ZCA A;  1D0Y A;  2FKY A;  2KIN A;  3KEN A;  1II6 A;  1D0X A;  1FMW A;  3NWN A;  4PJJ A;  1MKJ A;  2XAE A;  3H4S A;  4LNU K;  5LT2 A;  2ZFL A;  1F9T A;  1BG2 A;  2UYI A;  1VFX A;  1F9V A;  1VFZ A;  5LT3 A;  2X7D A;  3X2T A;  1F9U A;  4H1G A;  4PJN A;  3ZFD A;  1MNE A;  2NCD A;  2VB6 A;  3KAR A;  2VVG A;  1D1C A;  5LT0 A;  1MMA A;  1VFV A;  1YRS A;  1V8K A;  2WOG A;  1KK7 A;  1G8X A;  1BR2 A;  3B6V A;  1FMV A;  2HEH A;  2Y5W A;  4BBG A;  1VFW A;  3ZCW A;  2ZFM A;  4A5Y A;  2FL2 A;  4A51 A;  3DCB A;  1N6M A;  1BR1 A;  1D0Z A;  4B7B A;  3WRD A;  4ETP A;  3DC4 A;  5GSZ A;  3B6U A;  2VAS A;  1F9W A;  1MMD A;  1X88 A;  2Q2Y A;  4Y05 A;  5HLE A;  2OWM A;  2X51 A;  2V26 A;  2IEH A;  3GBJ A;  4HNA K;  1LVK A;  4ZHI A;  3BFN A;  1I5S A;  1Q0B A;  2GRY A;  2ZFJ A;  4GKR A;  2G1Q A;  4BXN A;  4AP0 A;  2PG2 A;  2X7E A;  4A14 A;  3WPN A;  2GM1 A;  4PJM A;  4PFO A;  1T5C A;  1RY6 A;  2ZFK A;  2FL6 A;  1BR4 A;  5LT1 A;  1I6I A;  1LKX A;  3CJO A;  2X7C A;  1CZ7 A;  1MMG A;  4PJL A;  4PK4 A;  2UYM A;  3ZFC A;  4AS7 A;  1GOJ A;  4DBQ A;  1SDM A;  3KIN A;  3T0Q A;  2ZFI A;  4A28 A;  2Q2Z A;  3L9H A;  3HQD A;  3K5E A;  4A50 A;  3PXN A;  3K3B A; 
#chains in the Genus database with same CATH topology
 4E7Z A;  2Y65 A;  4ANJ A;  1D1A A;  4A1Z A;  4FRZ A;  5LT4 A;  2FME A;  4PFP A;  1D1B A;  1V8J A;  4DBR A;  3COB A;  4BN2 A;  2X2R A;  1VOM A;  1MMN A;  3CNZ A;  2XT3 A;  3L1C A;  3LRE A;  2MYS A;  3U06 A;  4UBF A;  4E7S A;  4ZCA A;  1D0Y A;  2FKY A;  2KIN A;  3KEN A;  1II6 A;  1D0X A;  1FMW A;  3NWN A;  4PJJ A;  1MKJ A;  2XAE A;  3H4S A;  4LNU K;  5LT2 A;  2ZFL A;  1F9T A;  1BG2 A;  2UYI A;  1VFX A;  1F9V A;  1VFZ A;  5LT3 A;  2X7D A;  3X2T A;  1F9U A;  4H1G A;  4PJN A;  3ZFD A;  1MNE A;  2NCD A;  2VB6 A;  3KAR A;  2VVG A;  1D1C A;  5LT0 A;  1MMA A;  1VFV A;  1YRS A;  1V8K A;  2WOG A;  1KK7 A;  1G8X A;  1BR2 A;  3B6V A;  1FMV A;  4GKP A;  2HEH A;  2Y5W A;  4BBG A;  1VFW A;  3ZCW A;  2ZFM A;  4A5Y A;  2FL2 A;  4A51 A;  3DCB A;  1N6M A;  1BR1 A;  1D0Z A;  4B7B A;  3WRD A;  4ETP A;  3DC4 A;  5GSZ A;  3B6U A;  2VAS A;  1F9W A;  1MMD A;  1X88 A;  2Q2Y A;  4Y05 A;  5HLE A;  4ETP B;  2OWM A;  2X51 A;  2V26 A;  2IEH A;  3GBJ A;  4HNA K;  1LVK A;  4ZHI A;  3BFN A;  1I5S A;  1Q0B A;  2GRY A;  2O0A A;  2ZFJ A;  4GKR A;  2G1Q A;  4BXN A;  4GKQ A;  4AP0 A;  2PG2 A;  2X7E A;  4A14 A;  3WPN A;  2GM1 A;  4PJM A;  4PFO A;  1T5C A;  1RY6 A;  2ZFK A;  2FL6 A;  1BR4 A;  5LT1 A;  1I6I A;  1LKX A;  3CJO A;  2X7C A;  1CZ7 A;  1MMG A;  4PJL A;  4PK4 A;  2UYM A;  3ZFC A;  4AS7 A;  1GOJ A;  4DBQ A;  1SDM A;  3KIN A;  3T0Q A;  2ZFI A;  4A28 A;  2Q2Z A;  3L9H A;  3HQD A;  3K5E A;  4A50 A;  3PXN A;  3K3B A; 
#chains in the Genus database with same CATH homology
 4E7Z A;  2Y65 A;  4ANJ A;  1D1A A;  4A1Z A;  4FRZ A;  5LT4 A;  2FME A;  4PFP A;  1D1B A;  1V8J A;  4DBR A;  3COB A;  4BN2 A;  2X2R A;  1VOM A;  1MMN A;  3CNZ A;  2XT3 A;  3L1C A;  3LRE A;  2MYS A;  3U06 A;  4UBF A;  4E7S A;  4ZCA A;  1D0Y A;  2FKY A;  2KIN A;  3KEN A;  1II6 A;  1D0X A;  1FMW A;  3NWN A;  4PJJ A;  1MKJ A;  2XAE A;  3H4S A;  4LNU K;  5LT2 A;  2ZFL A;  1F9T A;  1BG2 A;  2UYI A;  1VFX A;  1F9V A;  1VFZ A;  5LT3 A;  2X7D A;  3X2T A;  1F9U A;  4H1G A;  4PJN A;  3ZFD A;  1MNE A;  2NCD A;  2VB6 A;  3KAR A;  2VVG A;  1D1C A;  5LT0 A;  1MMA A;  1VFV A;  1YRS A;  1V8K A;  2WOG A;  1KK7 A;  1G8X A;  1BR2 A;  3B6V A;  1FMV A;  2HEH A;  2Y5W A;  4BBG A;  1VFW A;  3ZCW A;  2ZFM A;  4A5Y A;  2FL2 A;  4A51 A;  3DCB A;  1N6M A;  1BR1 A;  1D0Z A;  4B7B A;  3WRD A;  4ETP A;  3DC4 A;  5GSZ A;  3B6U A;  2VAS A;  1F9W A;  1MMD A;  1X88 A;  2Q2Y A;  4Y05 A;  5HLE A;  2OWM A;  2X51 A;  2V26 A;  2IEH A;  3GBJ A;  4HNA K;  1LVK A;  4ZHI A;  3BFN A;  1I5S A;  1Q0B A;  2GRY A;  2ZFJ A;  4GKR A;  2G1Q A;  4BXN A;  4AP0 A;  2PG2 A;  2X7E A;  4A14 A;  3WPN A;  2GM1 A;  4PJM A;  4PFO A;  1T5C A;  1RY6 A;  2ZFK A;  2FL6 A;  1BR4 A;  5LT1 A;  1I6I A;  1LKX A;  3CJO A;  2X7C A;  1CZ7 A;  1MMG A;  4PJL A;  4PK4 A;  2UYM A;  3ZFC A;  4AS7 A;  1GOJ A;  4DBQ A;  1SDM A;  3KIN A;  3T0Q A;  2ZFI A;  4A28 A;  2Q2Z A;  3L9H A;  3HQD A;  3K5E A;  4A50 A;  3PXN A;  3K3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...