1I5SA

Crystal structure of the kif1a motor domain complexed with mg-adp
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
349
structure length
330
Chain Sequence
b'ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERAKGTRLKEGANINKSLTTLGKVISALAEMDIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN-LIKE PROTEIN KIF1A
publication title Switch-based mechanism of kinesin motors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 104
structure length 330
sequence length 349
ec nomenclature
pdb deposition date 2001-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1i5sA00
2FL2A 3DC4A 4PJLA 4UBFA 2Y65A 3WPNA 3CJOA 1I5SA 1BR1A 4PFPA 1SDMA 3DCBA 3KARA 2ZFLA 1D1BA 2NCDA 1MNEA 2VASA 4A51A 1VOMA 1V8JA 4HNAK 3B6VA 3KINA 5LT4A 1MMGA 2V26A 1II6A 3ZFCA 3X2TA 1VFZA 1GOJA 5LT1A 4PK4A 4H1GA 1KK7A 1BR4A 2X7DA 1T5CA 4BXNA 1D0ZA 3LREA 4A28A 1CZ7A 2GRYA 4ZCAA 1F9VA 1F9UA 2VB6A 1RY6A 4E7SA 2ZFIA 4BBGA 1V8KA 4A1ZA 4BN2A 3K3BA 4Y05A 2FKYA 4A50A 3NWNA 4ZHIA 1VFWA 2IEHA 1N6MA 2WOGA 4LNUK 2HEHA 2XT3A 2Y5WA 4ETPA 2Q2YA 2VVGA 2OWMA 2Q2ZA 3KENA 3B6UA 5LT2A 1VFXA 3GBJA 4PJJA 1F9WA 3K5EA 5GSZA 1BR2A 1FMVA 1F9TA 5LT0A 1D1CA 3L1CA 3ZFDA 2XAEA 1G8XA 1MMNA 3L9HA 3PXNA 1FMWA 2FMEA 2ZFJA 3T0QA 1MMDA 1D0YA 1MKJA 3BFNA 2GM1A 3H4SA 4A14A 2X51A 3ZCWA 4PFOA 4ANJA 1BG2A 1Q0BA 2UYMA 1VFVA 2FL6A 1D1AA 3WRDA 2MYSA 1D0XA 4AS7A 4E7ZA 5LT3A 4FRZA 2G1QA 1LVKA 1X88A 2UYIA 4GKRA 5HLEA 4AP0A 1YRSA 3U06A 1I6IA 1MMAA 2ZFKA 4DBQA 3COBA 4B7BA 2X2RA 1LKXA 2KINA 2X7EA 3CNZA 2ZFMA 3HQDA 4PJMA 4A5YA 2X7CA 4DBRA 4PJNA 2PG2A
chains in the Genus database with same CATH superfamily
2FL2A 3DC4A 4PJLA 4UBFA 2Y65A 3WPNA 3CJOA 1I5SA 1BR1A 4PFPA 1SDMA 3DCBA 3KARA 2ZFLA 1D1BA 2NCDA 1MNEA 2VASA 4A51A 1VOMA 1V8JA 4HNAK 3B6VA 3KINA 5LT4A 1MMGA 2V26A 1II6A 3ZFCA 3X2TA 1VFZA 1GOJA 5LT1A 4PK4A 4H1GA 1KK7A 1BR4A 2X7DA 1T5CA 4BXNA 1D0ZA 3LREA 4A28A 1CZ7A 2GRYA 4ZCAA 1F9VA 1F9UA 2VB6A 1RY6A 4GKQA 4E7SA 2ZFIA 4BBGA 1V8KA 4A1ZA 4BN2A 3K3BA 4Y05A 2FKYA 4A50A 3NWNA 4ZHIA 1VFWA 2IEHA 1N6MA 2WOGA 4LNUK 2HEHA 2XT3A 2Y5WA 4ETPA 2Q2YA 2VVGA 2OWMA 2Q2ZA 3KENA 3B6UA 5LT2A 1VFXA 3GBJA 4PJJA 1F9WA 3K5EA 5GSZA 1BR2A 1FMVA 1F9TA 5LT0A 4GKPA 1D1CA 3L1CA 3ZFDA 2XAEA 1G8XA 1MMNA 3L9HA 3PXNA 1FMWA 2FMEA 2ZFJA 3T0QA 1MMDA 1D0YA 1MKJA 3BFNA 2GM1A 3H4SA 4A14A 2X51A 3ZCWA 4PFOA 4ANJA 1BG2A 1Q0BA 2UYMA 1VFVA 2FL6A 1D1AA 3WRDA 4ETPB 2MYSA 1D0XA 4AS7A 4E7ZA 5LT3A 4FRZA 2G1QA 1LVKA 1X88A 2UYIA 4GKRA 5HLEA 4AP0A 1YRSA 3U06A 1I6IA 1MMAA 2ZFKA 4DBQA 3COBA 4B7BA 2X2RA 1LKXA 2KINA 2X7EA 3CNZA 2ZFMA 3HQDA 4PJMA 4A5YA 2X7CA 4DBRA 2O0AA 4PJNA 2PG2A
chains in the Genus database with same CATH topology
2FL2A 3DC4A 4PJLA 4UBFA 2Y65A 3WPNA 3CJOA 1I5SA 1BR1A 4PFPA 1SDMA 3DCBA 3KARA 2ZFLA 1D1BA 2NCDA 1MNEA 2VASA 4A51A 1VOMA 1V8JA 4HNAK 3B6VA 3KINA 5LT4A 1MMGA 2V26A 1II6A 3ZFCA 3X2TA 1VFZA 1GOJA 5LT1A 4PK4A 4H1GA 1KK7A 1BR4A 2X7DA 1T5CA 4BXNA 1D0ZA 3LREA 4A28A 1CZ7A 2GRYA 4ZCAA 1F9VA 1F9UA 2VB6A 1RY6A 4E7SA 2ZFIA 4BBGA 1V8KA 4A1ZA 4BN2A 3K3BA 4Y05A 2FKYA 4A50A 3NWNA 4ZHIA 1VFWA 2IEHA 1N6MA 2WOGA 4LNUK 2HEHA 2XT3A 2Y5WA 4ETPA 2Q2YA 2VVGA 2OWMA 2Q2ZA 3KENA 3B6UA 5LT2A 1VFXA 3GBJA 4PJJA 1F9WA 3K5EA 5GSZA 1BR2A 1FMVA 1F9TA 5LT0A 1D1CA 3L1CA 3ZFDA 2XAEA 1G8XA 1MMNA 3L9HA 3PXNA 1FMWA 2FMEA 2ZFJA 3T0QA 1MMDA 1D0YA 1MKJA 3BFNA 2GM1A 3H4SA 4A14A 2X51A 3ZCWA 4PFOA 4ANJA 1BG2A 1Q0BA 2UYMA 1VFVA 2FL6A 1D1AA 3WRDA 2MYSA 1D0XA 4AS7A 4E7ZA 5LT3A 4FRZA 2G1QA 1LVKA 1X88A 2UYIA 4GKRA 5HLEA 4AP0A 1YRSA 3U06A 1I6IA 1MMAA 2ZFKA 4DBQA 3COBA 4B7BA 2X2RA 1LKXA 2KINA 2X7EA 3CNZA 2ZFMA 3HQDA 4PJMA 4A5YA 2X7CA 4DBRA 4PJNA 2PG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FL2 A;  3DC4 A;  4PJL A;  4UBF A;  2Y65 A;  3WPN A;  3CJO A;  1I5S A;  1BR1 A;  4PFP A;  1SDM A;  3DCB A;  3KAR A;  2ZFL A;  1D1B A;  2NCD A;  1MNE A;  2VAS A;  4A51 A;  1VOM A;  1V8J A;  4HNA K;  3B6V A;  3KIN A;  5LT4 A;  1MMG A;  2V26 A;  1II6 A;  3ZFC A;  3X2T A;  1VFZ A;  1GOJ A;  5LT1 A;  4PK4 A;  4H1G A;  1KK7 A;  1BR4 A;  2X7D A;  1T5C A;  4BXN A;  1D0Z A;  3LRE A;  4A28 A;  1CZ7 A;  2GRY A;  4ZCA A;  1F9V A;  1F9U A;  2VB6 A;  1RY6 A;  4E7S A;  2ZFI A;  4BBG A;  1V8K A;  4A1Z A;  4BN2 A;  3K3B A;  4Y05 A;  2FKY A;  4A50 A;  3NWN A;  4ZHI A;  1VFW A;  2IEH A;  1N6M A;  2WOG A;  4LNU K;  2HEH A;  2XT3 A;  2Y5W A;  4ETP A;  2Q2Y A;  2VVG A;  2OWM A;  2Q2Z A;  3KEN A;  3B6U A;  5LT2 A;  1VFX A;  3GBJ A;  4PJJ A;  1F9W A;  3K5E A;  5GSZ A;  1BR2 A;  1FMV A;  1F9T A;  5LT0 A;  1D1C A;  3L1C A;  3ZFD A;  2XAE A;  1G8X A;  1MMN A;  3L9H A;  3PXN A;  1FMW A;  2FME A;  2ZFJ A;  3T0Q A;  1MMD A;  1D0Y A;  1MKJ A;  3BFN A;  2GM1 A;  3H4S A;  4A14 A;  2X51 A;  3ZCW A;  4PFO A;  4ANJ A;  1BG2 A;  1Q0B A;  2UYM A;  1VFV A;  2FL6 A;  1D1A A;  3WRD A;  2MYS A;  1D0X A;  4AS7 A;  4E7Z A;  5LT3 A;  4FRZ A;  2G1Q A;  1LVK A;  1X88 A;  2UYI A;  4GKR A;  5HLE A;  4AP0 A;  1YRS A;  3U06 A;  1I6I A;  1MMA A;  2ZFK A;  4DBQ A;  3COB A;  4B7B A;  2X2R A;  1LKX A;  2KIN A;  2X7E A;  3CNZ A;  2ZFM A;  3HQD A;  4PJM A;  4A5Y A;  2X7C A;  4DBR A;  4PJN A;  2PG2 A; 
#chains in the Genus database with same CATH topology
 2FL2 A;  3DC4 A;  4PJL A;  4UBF A;  2Y65 A;  3WPN A;  3CJO A;  1I5S A;  1BR1 A;  4PFP A;  1SDM A;  3DCB A;  3KAR A;  2ZFL A;  1D1B A;  2NCD A;  1MNE A;  2VAS A;  4A51 A;  1VOM A;  1V8J A;  4HNA K;  3B6V A;  3KIN A;  5LT4 A;  1MMG A;  2V26 A;  1II6 A;  3ZFC A;  3X2T A;  1VFZ A;  1GOJ A;  5LT1 A;  4PK4 A;  4H1G A;  1KK7 A;  1BR4 A;  2X7D A;  1T5C A;  4BXN A;  1D0Z A;  3LRE A;  4A28 A;  1CZ7 A;  2GRY A;  4ZCA A;  1F9V A;  1F9U A;  2VB6 A;  1RY6 A;  4GKQ A;  4E7S A;  2ZFI A;  4BBG A;  1V8K A;  4A1Z A;  4BN2 A;  3K3B A;  4Y05 A;  2FKY A;  4A50 A;  3NWN A;  4ZHI A;  1VFW A;  2IEH A;  1N6M A;  2WOG A;  4LNU K;  2HEH A;  2XT3 A;  2Y5W A;  4ETP A;  2Q2Y A;  2VVG A;  2OWM A;  2Q2Z A;  3KEN A;  3B6U A;  5LT2 A;  1VFX A;  3GBJ A;  4PJJ A;  1F9W A;  3K5E A;  5GSZ A;  1BR2 A;  1FMV A;  1F9T A;  5LT0 A;  4GKP A;  1D1C A;  3L1C A;  3ZFD A;  2XAE A;  1G8X A;  1MMN A;  3L9H A;  3PXN A;  1FMW A;  2FME A;  2ZFJ A;  3T0Q A;  1MMD A;  1D0Y A;  1MKJ A;  3BFN A;  2GM1 A;  3H4S A;  4A14 A;  2X51 A;  3ZCW A;  4PFO A;  4ANJ A;  1BG2 A;  1Q0B A;  2UYM A;  1VFV A;  2FL6 A;  1D1A A;  3WRD A;  4ETP B;  2MYS A;  1D0X A;  4AS7 A;  4E7Z A;  5LT3 A;  4FRZ A;  2G1Q A;  1LVK A;  1X88 A;  2UYI A;  4GKR A;  5HLE A;  4AP0 A;  1YRS A;  3U06 A;  1I6I A;  1MMA A;  2ZFK A;  4DBQ A;  3COB A;  4B7B A;  2X2R A;  1LKX A;  2KIN A;  2X7E A;  3CNZ A;  2ZFM A;  3HQD A;  4PJM A;  4A5Y A;  2X7C A;  4DBR A;  2O0A A;  4PJN A;  2PG2 A; 
#chains in the Genus database with same CATH homology
 2FL2 A;  3DC4 A;  4PJL A;  4UBF A;  2Y65 A;  3WPN A;  3CJO A;  1I5S A;  1BR1 A;  4PFP A;  1SDM A;  3DCB A;  3KAR A;  2ZFL A;  1D1B A;  2NCD A;  1MNE A;  2VAS A;  4A51 A;  1VOM A;  1V8J A;  4HNA K;  3B6V A;  3KIN A;  5LT4 A;  1MMG A;  2V26 A;  1II6 A;  3ZFC A;  3X2T A;  1VFZ A;  1GOJ A;  5LT1 A;  4PK4 A;  4H1G A;  1KK7 A;  1BR4 A;  2X7D A;  1T5C A;  4BXN A;  1D0Z A;  3LRE A;  4A28 A;  1CZ7 A;  2GRY A;  4ZCA A;  1F9V A;  1F9U A;  2VB6 A;  1RY6 A;  4E7S A;  2ZFI A;  4BBG A;  1V8K A;  4A1Z A;  4BN2 A;  3K3B A;  4Y05 A;  2FKY A;  4A50 A;  3NWN A;  4ZHI A;  1VFW A;  2IEH A;  1N6M A;  2WOG A;  4LNU K;  2HEH A;  2XT3 A;  2Y5W A;  4ETP A;  2Q2Y A;  2VVG A;  2OWM A;  2Q2Z A;  3KEN A;  3B6U A;  5LT2 A;  1VFX A;  3GBJ A;  4PJJ A;  1F9W A;  3K5E A;  5GSZ A;  1BR2 A;  1FMV A;  1F9T A;  5LT0 A;  1D1C A;  3L1C A;  3ZFD A;  2XAE A;  1G8X A;  1MMN A;  3L9H A;  3PXN A;  1FMW A;  2FME A;  2ZFJ A;  3T0Q A;  1MMD A;  1D0Y A;  1MKJ A;  3BFN A;  2GM1 A;  3H4S A;  4A14 A;  2X51 A;  3ZCW A;  4PFO A;  4ANJ A;  1BG2 A;  1Q0B A;  2UYM A;  1VFV A;  2FL6 A;  1D1A A;  3WRD A;  2MYS A;  1D0X A;  4AS7 A;  4E7Z A;  5LT3 A;  4FRZ A;  2G1Q A;  1LVK A;  1X88 A;  2UYI A;  4GKR A;  5HLE A;  4AP0 A;  1YRS A;  3U06 A;  1I6I A;  1MMA A;  2ZFK A;  4DBQ A;  3COB A;  4B7B A;  2X2R A;  1LKX A;  2KIN A;  2X7E A;  3CNZ A;  2ZFM A;  3HQD A;  4PJM A;  4A5Y A;  2X7C A;  4DBR A;  4PJN A;  2PG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...