2ZFMA

Crystal structure of the kif1a motor domain after mg release
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
355
structure length
328
Chain Sequence
ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERANINKSLTTLGKVISALAEMDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 103
structure length 328
sequence length 355
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfmA00
2VB6A 4ZCAA 1LKXA 4B7BA 1BR1A 2FL2A 2FMEA 3GBJA 3K5EA 3BFNA 1F9UA 3H4SA 1V8KA 2IEHA 3X2TA 1VOMA 4E7SA 1BR4A 3B6UA 4BBGA 1Q0BA 1II6A 4FRZA 4A5YA 1D1CA 3B6VA 1GOJA 4AP0A 1N6MA 2X7EA 4PJMA 4PFPA 2XAEA 2VVGA 2ZFJA 2HEHA 1D0XA 2FKYA 4BXNA 5LT0A 2VASA 1FMVA 1F9WA 1MMNA 1MMAA 4AS7A 3CJOA 1F9VA 4LNUK 1D1AA 2X51A 3WRDA 4A50A 1VFVA 1CZ7A 4PJJA 1D0YA 3ZCWA 4BN2A 3KARA 1V8JA 2X7DA 2OWMA 2ZFLA 3KENA 4DBRA 2V26A 1SDMA 4ZHIA 4ETPA 4PJNA 2GRYA 3DCBA 4A14A 3PXNA 3L1CA 1D1BA 5LT1A 2Q2ZA 5LT3A 1BG2A 4PJLA 1I6IA 5HLEA 4H1GA 3ZFDA 5LT4A 2WOGA 1MMDA 5LT2A 1FMWA 1BR2A 3U06A 1VFZA 2UYMA 4DBQA 4ANJA 3ZFCA 1I5SA 3L9HA 4GKRA 4A28A 1MNEA 1G8XA 2Y65A 2ZFKA 1VFXA 2KINA 2Q2YA 2FL6A 4UBFA 3HQDA 1T5CA 1F9TA 1LVKA 1VFWA 2X2RA 2X7CA 3WPNA 1RY6A 3KINA 3K3BA 2ZFMA 4E7ZA 1KK7A 4PK4A 3CNZA 1X88A 3NWNA 3T0QA 4HNAK 2PG2A 2ZFIA 3COBA 3DC4A 3LREA 4Y05A 1MKJA 2GM1A 2UYIA 2MYSA 1MMGA 4PFOA 2XT3A 4A51A 2Y5WA 2G1QA 5GSZA 1YRSA 4A1ZA 1D0ZA 2NCDA
chains in the Genus database with same CATH superfamily
2VB6A 4ZCAA 1LKXA 4B7BA 1BR1A 2FL2A 2FMEA 3GBJA 3K5EA 3BFNA 1F9UA 3H4SA 1V8KA 2IEHA 3X2TA 1VOMA 4E7SA 1BR4A 3B6UA 4BBGA 1Q0BA 1II6A 4FRZA 4A5YA 1D1CA 4GKQA 3B6VA 1GOJA 4AP0A 1N6MA 2X7EA 4PJMA 4PFPA 2XAEA 2VVGA 2ZFJA 2HEHA 1D0XA 2FKYA 4BXNA 5LT0A 2VASA 1FMVA 1F9WA 1MMNA 1MMAA 4AS7A 3CJOA 1F9VA 4LNUK 1D1AA 2X51A 3WRDA 4A50A 1VFVA 1CZ7A 4PJJA 1D0YA 3ZCWA 4BN2A 3KARA 1V8JA 2X7DA 2OWMA 2ZFLA 3KENA 4DBRA 2V26A 1SDMA 4ZHIA 4ETPA 4PJNA 2GRYA 3DCBA 4A14A 3PXNA 3L1CA 1D1BA 5LT1A 2Q2ZA 5LT3A 1BG2A 4PJLA 1I6IA 5HLEA 4H1GA 3ZFDA 5LT4A 2WOGA 1MMDA 5LT2A 1FMWA 1BR2A 3U06A 1VFZA 2UYMA 4DBQA 4ANJA 3ZFCA 1I5SA 3L9HA 4GKRA 4A28A 1MNEA 1G8XA 2Y65A 2ZFKA 4ETPB 1VFXA 2KINA 2Q2YA 4GKPA 2FL6A 4UBFA 3HQDA 1T5CA 1F9TA 1LVKA 1VFWA 2X2RA 2X7CA 3WPNA 1RY6A 3KINA 3K3BA 2ZFMA 4E7ZA 1KK7A 4PK4A 3CNZA 1X88A 3NWNA 3T0QA 4HNAK 2PG2A 2ZFIA 3COBA 3DC4A 3LREA 4Y05A 1MKJA 2GM1A 2UYIA 2MYSA 1MMGA 4PFOA 2XT3A 4A51A 2Y5WA 2O0AA 2G1QA 5GSZA 1YRSA 4A1ZA 1D0ZA 2NCDA
chains in the Genus database with same CATH topology
2VB6A 4ZCAA 1LKXA 4B7BA 1BR1A 2FL2A 2FMEA 3GBJA 3K5EA 3BFNA 1F9UA 3H4SA 1V8KA 2IEHA 3X2TA 1VOMA 4E7SA 1BR4A 3B6UA 4BBGA 1Q0BA 1II6A 4FRZA 4A5YA 1D1CA 3B6VA 1GOJA 4AP0A 1N6MA 2X7EA 4PJMA 4PFPA 2XAEA 2VVGA 2ZFJA 2HEHA 1D0XA 2FKYA 4BXNA 5LT0A 2VASA 1FMVA 1F9WA 1MMNA 1MMAA 4AS7A 3CJOA 1F9VA 4LNUK 1D1AA 2X51A 3WRDA 4A50A 1VFVA 1CZ7A 4PJJA 1D0YA 3ZCWA 4BN2A 3KARA 1V8JA 2X7DA 2OWMA 2ZFLA 3KENA 4DBRA 2V26A 1SDMA 4ZHIA 4ETPA 4PJNA 2GRYA 3DCBA 4A14A 3PXNA 3L1CA 1D1BA 5LT1A 2Q2ZA 5LT3A 1BG2A 4PJLA 1I6IA 5HLEA 4H1GA 3ZFDA 5LT4A 2WOGA 1MMDA 5LT2A 1FMWA 1BR2A 3U06A 1VFZA 2UYMA 4DBQA 4ANJA 3ZFCA 1I5SA 3L9HA 4GKRA 4A28A 1MNEA 1G8XA 2Y65A 2ZFKA 1VFXA 2KINA 2Q2YA 2FL6A 4UBFA 3HQDA 1T5CA 1F9TA 1LVKA 1VFWA 2X2RA 2X7CA 3WPNA 1RY6A 3KINA 3K3BA 2ZFMA 4E7ZA 1KK7A 4PK4A 3CNZA 1X88A 3NWNA 3T0QA 4HNAK 2PG2A 2ZFIA 3COBA 3DC4A 3LREA 4Y05A 1MKJA 2GM1A 2UYIA 2MYSA 1MMGA 4PFOA 2XT3A 4A51A 2Y5WA 2G1QA 5GSZA 1YRSA 4A1ZA 1D0ZA 2NCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VB6 A;  4ZCA A;  1LKX A;  4B7B A;  1BR1 A;  2FL2 A;  2FME A;  3GBJ A;  3K5E A;  3BFN A;  1F9U A;  3H4S A;  1V8K A;  2IEH A;  3X2T A;  1VOM A;  4E7S A;  1BR4 A;  3B6U A;  4BBG A;  1Q0B A;  1II6 A;  4FRZ A;  4A5Y A;  1D1C A;  3B6V A;  1GOJ A;  4AP0 A;  1N6M A;  2X7E A;  4PJM A;  4PFP A;  2XAE A;  2VVG A;  2ZFJ A;  2HEH A;  1D0X A;  2FKY A;  4BXN A;  5LT0 A;  2VAS A;  1FMV A;  1F9W A;  1MMN A;  1MMA A;  4AS7 A;  3CJO A;  1F9V A;  4LNU K;  1D1A A;  2X51 A;  3WRD A;  4A50 A;  1VFV A;  1CZ7 A;  4PJJ A;  1D0Y A;  3ZCW A;  4BN2 A;  3KAR A;  1V8J A;  2X7D A;  2OWM A;  2ZFL A;  3KEN A;  4DBR A;  2V26 A;  1SDM A;  4ZHI A;  4ETP A;  4PJN A;  2GRY A;  3DCB A;  4A14 A;  3PXN A;  3L1C A;  1D1B A;  5LT1 A;  2Q2Z A;  5LT3 A;  1BG2 A;  4PJL A;  1I6I A;  5HLE A;  4H1G A;  3ZFD A;  5LT4 A;  2WOG A;  1MMD A;  5LT2 A;  1FMW A;  1BR2 A;  3U06 A;  1VFZ A;  2UYM A;  4DBQ A;  4ANJ A;  3ZFC A;  1I5S A;  3L9H A;  4GKR A;  4A28 A;  1MNE A;  1G8X A;  2Y65 A;  2ZFK A;  1VFX A;  2KIN A;  2Q2Y A;  2FL6 A;  4UBF A;  3HQD A;  1T5C A;  1F9T A;  1LVK A;  1VFW A;  2X2R A;  2X7C A;  3WPN A;  1RY6 A;  3KIN A;  3K3B A;  2ZFM A;  4E7Z A;  1KK7 A;  4PK4 A;  3CNZ A;  1X88 A;  3NWN A;  3T0Q A;  4HNA K;  2PG2 A;  2ZFI A;  3COB A;  3DC4 A;  3LRE A;  4Y05 A;  1MKJ A;  2GM1 A;  2UYI A;  2MYS A;  1MMG A;  4PFO A;  2XT3 A;  4A51 A;  2Y5W A;  2G1Q A;  5GSZ A;  1YRS A;  4A1Z A;  1D0Z A;  2NCD A; 
#chains in the Genus database with same CATH topology
 2VB6 A;  4ZCA A;  1LKX A;  4B7B A;  1BR1 A;  2FL2 A;  2FME A;  3GBJ A;  3K5E A;  3BFN A;  1F9U A;  3H4S A;  1V8K A;  2IEH A;  3X2T A;  1VOM A;  4E7S A;  1BR4 A;  3B6U A;  4BBG A;  1Q0B A;  1II6 A;  4FRZ A;  4A5Y A;  1D1C A;  4GKQ A;  3B6V A;  1GOJ A;  4AP0 A;  1N6M A;  2X7E A;  4PJM A;  4PFP A;  2XAE A;  2VVG A;  2ZFJ A;  2HEH A;  1D0X A;  2FKY A;  4BXN A;  5LT0 A;  2VAS A;  1FMV A;  1F9W A;  1MMN A;  1MMA A;  4AS7 A;  3CJO A;  1F9V A;  4LNU K;  1D1A A;  2X51 A;  3WRD A;  4A50 A;  1VFV A;  1CZ7 A;  4PJJ A;  1D0Y A;  3ZCW A;  4BN2 A;  3KAR A;  1V8J A;  2X7D A;  2OWM A;  2ZFL A;  3KEN A;  4DBR A;  2V26 A;  1SDM A;  4ZHI A;  4ETP A;  4PJN A;  2GRY A;  3DCB A;  4A14 A;  3PXN A;  3L1C A;  1D1B A;  5LT1 A;  2Q2Z A;  5LT3 A;  1BG2 A;  4PJL A;  1I6I A;  5HLE A;  4H1G A;  3ZFD A;  5LT4 A;  2WOG A;  1MMD A;  5LT2 A;  1FMW A;  1BR2 A;  3U06 A;  1VFZ A;  2UYM A;  4DBQ A;  4ANJ A;  3ZFC A;  1I5S A;  3L9H A;  4GKR A;  4A28 A;  1MNE A;  1G8X A;  2Y65 A;  2ZFK A;  4ETP B;  1VFX A;  2KIN A;  2Q2Y A;  4GKP A;  2FL6 A;  4UBF A;  3HQD A;  1T5C A;  1F9T A;  1LVK A;  1VFW A;  2X2R A;  2X7C A;  3WPN A;  1RY6 A;  3KIN A;  3K3B A;  2ZFM A;  4E7Z A;  1KK7 A;  4PK4 A;  3CNZ A;  1X88 A;  3NWN A;  3T0Q A;  4HNA K;  2PG2 A;  2ZFI A;  3COB A;  3DC4 A;  3LRE A;  4Y05 A;  1MKJ A;  2GM1 A;  2UYI A;  2MYS A;  1MMG A;  4PFO A;  2XT3 A;  4A51 A;  2Y5W A;  2O0A A;  2G1Q A;  5GSZ A;  1YRS A;  4A1Z A;  1D0Z A;  2NCD A; 
#chains in the Genus database with same CATH homology
 2VB6 A;  4ZCA A;  1LKX A;  4B7B A;  1BR1 A;  2FL2 A;  2FME A;  3GBJ A;  3K5E A;  3BFN A;  1F9U A;  3H4S A;  1V8K A;  2IEH A;  3X2T A;  1VOM A;  4E7S A;  1BR4 A;  3B6U A;  4BBG A;  1Q0B A;  1II6 A;  4FRZ A;  4A5Y A;  1D1C A;  3B6V A;  1GOJ A;  4AP0 A;  1N6M A;  2X7E A;  4PJM A;  4PFP A;  2XAE A;  2VVG A;  2ZFJ A;  2HEH A;  1D0X A;  2FKY A;  4BXN A;  5LT0 A;  2VAS A;  1FMV A;  1F9W A;  1MMN A;  1MMA A;  4AS7 A;  3CJO A;  1F9V A;  4LNU K;  1D1A A;  2X51 A;  3WRD A;  4A50 A;  1VFV A;  1CZ7 A;  4PJJ A;  1D0Y A;  3ZCW A;  4BN2 A;  3KAR A;  1V8J A;  2X7D A;  2OWM A;  2ZFL A;  3KEN A;  4DBR A;  2V26 A;  1SDM A;  4ZHI A;  4ETP A;  4PJN A;  2GRY A;  3DCB A;  4A14 A;  3PXN A;  3L1C A;  1D1B A;  5LT1 A;  2Q2Z A;  5LT3 A;  1BG2 A;  4PJL A;  1I6I A;  5HLE A;  4H1G A;  3ZFD A;  5LT4 A;  2WOG A;  1MMD A;  5LT2 A;  1FMW A;  1BR2 A;  3U06 A;  1VFZ A;  2UYM A;  4DBQ A;  4ANJ A;  3ZFC A;  1I5S A;  3L9H A;  4GKR A;  4A28 A;  1MNE A;  1G8X A;  2Y65 A;  2ZFK A;  1VFX A;  2KIN A;  2Q2Y A;  2FL6 A;  4UBF A;  3HQD A;  1T5C A;  1F9T A;  1LVK A;  1VFW A;  2X2R A;  2X7C A;  3WPN A;  1RY6 A;  3KIN A;  3K3B A;  2ZFM A;  4E7Z A;  1KK7 A;  4PK4 A;  3CNZ A;  1X88 A;  3NWN A;  3T0Q A;  4HNA K;  2PG2 A;  2ZFI A;  3COB A;  3DC4 A;  3LRE A;  4Y05 A;  1MKJ A;  2GM1 A;  2UYI A;  2MYS A;  1MMG A;  4PFO A;  2XT3 A;  4A51 A;  2Y5W A;  2G1Q A;  5GSZ A;  1YRS A;  4A1Z A;  1D0Z A;  2NCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...