2ZFMA

Crystal structure of the kif1a motor domain after mg release
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
355
structure length
328
Chain Sequence
b'ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERANINKSLTTLGKVISALAEMDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 103
structure length 328
sequence length 355
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfmA00
1VFZA 2GRYA 2ZFKA 2GM1A 4AP0A 4DBQA 3NWNA 4PFPA 1D1CA 1VFXA 3B6VA 2Q2ZA 3LREA 3ZCWA 1I6IA 1FMVA 3L9HA 5LT3A 2X51A 3DC4A 3KARA 4Y05A 1D0YA 1KK7A 1MMNA 1BG2A 2UYMA 3WPNA 2FL2A 2X2RA 4BBGA 5GSZA 4A28A 1MMDA 3COBA 1BR2A 1VOMA 2ZFMA 2Y65A 1D0XA 4E7SA 2VB6A 4PK4A 3T0QA 2VVGA 1MMAA 5LT2A 2ZFJA 1F9VA 2G1QA 1BR1A 2XT3A 4FRZA 3ZFCA 4B7BA 1D1BA 1F9WA 1GOJA 4PJMA 4ANJA 4ETPA 5LT4A 1Q0BA 3GBJA 3ZFDA 3B6UA 4A1ZA 2HEHA 4PJNA 2UYIA 4DBRA 1LKXA 1D1AA 1MMGA 1VFWA 2MYSA 1VFVA 3U06A 2NCDA 2XAEA 2ZFLA 4HNAK 3DCBA 3H4SA 1YRSA 1CZ7A 2FL6A 4ZCAA 3BFNA 4BXNA 4A14A 2IEHA 1X88A 2PG2A 3CJOA 3K3BA 5LT1A 1V8KA 1D0ZA 4ZHIA 1F9UA 1BR4A 4A51A 3K5EA 2Q2YA 5HLEA 2ZFIA 4H1GA 2Y5WA 4PJLA 2FKYA 3KENA 4LNUK 4PFOA 4GKRA 5LT0A 2WOGA 1II6A 1V8JA 3PXNA 2X7EA 2OWMA 2VASA 3L1CA 3CNZA 4E7ZA 1RY6A 2FMEA 2KINA 1MNEA 1N6MA 1LVKA 3WRDA 4AS7A 1FMWA 4UBFA 2V26A 1T5CA 3KINA 3X2TA 4A50A 1MKJA 1SDMA 2X7CA 2X7DA 4PJJA 3HQDA 4A5YA 1G8XA 4BN2A 1I5SA 1F9TA
chains in the Genus database with same CATH superfamily
1VFZA 2GRYA 2ZFKA 2GM1A 4AP0A 4DBQA 3NWNA 4PFPA 1D1CA 1VFXA 3B6VA 2Q2ZA 3LREA 3ZCWA 1I6IA 1FMVA 3L9HA 5LT3A 2X51A 3DC4A 3KARA 4Y05A 1D0YA 1KK7A 1MMNA 1BG2A 2UYMA 3WPNA 2FL2A 2X2RA 4BBGA 5GSZA 4A28A 1MMDA 3COBA 1BR2A 1VOMA 2ZFMA 2Y65A 1D0XA 4E7SA 2VB6A 4PK4A 3T0QA 2VVGA 1MMAA 5LT2A 2ZFJA 1F9VA 2G1QA 1BR1A 2XT3A 4FRZA 3ZFCA 4B7BA 1D1BA 1F9WA 1GOJA 4PJMA 4ANJA 4ETPA 5LT4A 1Q0BA 3GBJA 2O0AA 3B6UA 3ZFDA 2HEHA 4A1ZA 4PJNA 2UYIA 4DBRA 1LKXA 1D1AA 1MMGA 1VFWA 2MYSA 1VFVA 3U06A 2NCDA 2XAEA 2ZFLA 4HNAK 3DCBA 3H4SA 1YRSA 1CZ7A 2FL6A 4ZCAA 3BFNA 4BXNA 4A14A 2IEHA 1X88A 2PG2A 3CJOA 3K3BA 5LT1A 1V8KA 1D0ZA 4ZHIA 4GKQA 1F9UA 1BR4A 4A51A 3K5EA 2Q2YA 4ETPB 5HLEA 2ZFIA 4H1GA 2Y5WA 4PJLA 2FKYA 3KENA 4LNUK 4PFOA 4GKRA 5LT0A 2WOGA 1II6A 1V8JA 3PXNA 2X7EA 2OWMA 2VASA 3L1CA 3CNZA 4E7ZA 1RY6A 2FMEA 2KINA 1MNEA 1N6MA 1LVKA 3WRDA 4AS7A 1FMWA 4UBFA 2V26A 1T5CA 3KINA 3X2TA 4A50A 1MKJA 1SDMA 2X7CA 4GKPA 2X7DA 4PJJA 3HQDA 4A5YA 1G8XA 4BN2A 1I5SA 1F9TA
chains in the Genus database with same CATH topology
1VFZA 2GRYA 2ZFKA 2GM1A 4AP0A 4DBQA 3NWNA 4PFPA 1D1CA 1VFXA 3B6VA 2Q2ZA 3LREA 3ZCWA 1I6IA 1FMVA 3L9HA 5LT3A 2X51A 3DC4A 3KARA 4Y05A 1D0YA 1KK7A 1MMNA 1BG2A 2UYMA 3WPNA 2FL2A 2X2RA 4BBGA 5GSZA 4A28A 1MMDA 3COBA 1BR2A 1VOMA 2ZFMA 2Y65A 1D0XA 4E7SA 2VB6A 4PK4A 3T0QA 2VVGA 1MMAA 5LT2A 2ZFJA 1F9VA 2G1QA 1BR1A 2XT3A 4FRZA 3ZFCA 4B7BA 1D1BA 1F9WA 1GOJA 4PJMA 4ANJA 4ETPA 5LT4A 1Q0BA 3GBJA 3ZFDA 3B6UA 4A1ZA 2HEHA 4PJNA 2UYIA 4DBRA 1LKXA 1D1AA 1MMGA 1VFWA 2MYSA 1VFVA 3U06A 2NCDA 2XAEA 2ZFLA 4HNAK 3DCBA 3H4SA 1YRSA 1CZ7A 2FL6A 4ZCAA 3BFNA 4BXNA 4A14A 2IEHA 1X88A 2PG2A 3CJOA 3K3BA 5LT1A 1V8KA 1D0ZA 4ZHIA 1F9UA 1BR4A 4A51A 3K5EA 2Q2YA 5HLEA 2ZFIA 4H1GA 2Y5WA 4PJLA 2FKYA 3KENA 4LNUK 4PFOA 4GKRA 5LT0A 2WOGA 1II6A 1V8JA 3PXNA 2X7EA 2OWMA 2VASA 3L1CA 3CNZA 4E7ZA 1RY6A 2FMEA 2KINA 1MNEA 1N6MA 1LVKA 3WRDA 4AS7A 1FMWA 4UBFA 2V26A 1T5CA 3KINA 3X2TA 4A50A 1MKJA 1SDMA 2X7CA 2X7DA 4PJJA 3HQDA 4A5YA 1G8XA 4BN2A 1I5SA 1F9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VFZ A;  2GRY A;  2ZFK A;  2GM1 A;  4AP0 A;  4DBQ A;  3NWN A;  4PFP A;  1D1C A;  1VFX A;  3B6V A;  2Q2Z A;  3LRE A;  3ZCW A;  1I6I A;  1FMV A;  3L9H A;  5LT3 A;  2X51 A;  3DC4 A;  3KAR A;  4Y05 A;  1D0Y A;  1KK7 A;  1MMN A;  1BG2 A;  2UYM A;  3WPN A;  2FL2 A;  2X2R A;  4BBG A;  5GSZ A;  4A28 A;  1MMD A;  3COB A;  1BR2 A;  1VOM A;  2ZFM A;  2Y65 A;  1D0X A;  4E7S A;  2VB6 A;  4PK4 A;  3T0Q A;  2VVG A;  1MMA A;  5LT2 A;  2ZFJ A;  1F9V A;  2G1Q A;  1BR1 A;  2XT3 A;  4FRZ A;  3ZFC A;  4B7B A;  1D1B A;  1F9W A;  1GOJ A;  4PJM A;  4ANJ A;  4ETP A;  5LT4 A;  1Q0B A;  3GBJ A;  3ZFD A;  3B6U A;  4A1Z A;  2HEH A;  4PJN A;  2UYI A;  4DBR A;  1LKX A;  1D1A A;  1MMG A;  1VFW A;  2MYS A;  1VFV A;  3U06 A;  2NCD A;  2XAE A;  2ZFL A;  4HNA K;  3DCB A;  3H4S A;  1YRS A;  1CZ7 A;  2FL6 A;  4ZCA A;  3BFN A;  4BXN A;  4A14 A;  2IEH A;  1X88 A;  2PG2 A;  3CJO A;  3K3B A;  5LT1 A;  1V8K A;  1D0Z A;  4ZHI A;  1F9U A;  1BR4 A;  4A51 A;  3K5E A;  2Q2Y A;  5HLE A;  2ZFI A;  4H1G A;  2Y5W A;  4PJL A;  2FKY A;  3KEN A;  4LNU K;  4PFO A;  4GKR A;  5LT0 A;  2WOG A;  1II6 A;  1V8J A;  3PXN A;  2X7E A;  2OWM A;  2VAS A;  3L1C A;  3CNZ A;  4E7Z A;  1RY6 A;  2FME A;  2KIN A;  1MNE A;  1N6M A;  1LVK A;  3WRD A;  4AS7 A;  1FMW A;  4UBF A;  2V26 A;  1T5C A;  3KIN A;  3X2T A;  4A50 A;  1MKJ A;  1SDM A;  2X7C A;  2X7D A;  4PJJ A;  3HQD A;  4A5Y A;  1G8X A;  4BN2 A;  1I5S A;  1F9T A; 
#chains in the Genus database with same CATH topology
 1VFZ A;  2GRY A;  2ZFK A;  2GM1 A;  4AP0 A;  4DBQ A;  3NWN A;  4PFP A;  1D1C A;  1VFX A;  3B6V A;  2Q2Z A;  3LRE A;  3ZCW A;  1I6I A;  1FMV A;  3L9H A;  5LT3 A;  2X51 A;  3DC4 A;  3KAR A;  4Y05 A;  1D0Y A;  1KK7 A;  1MMN A;  1BG2 A;  2UYM A;  3WPN A;  2FL2 A;  2X2R A;  4BBG A;  5GSZ A;  4A28 A;  1MMD A;  3COB A;  1BR2 A;  1VOM A;  2ZFM A;  2Y65 A;  1D0X A;  4E7S A;  2VB6 A;  4PK4 A;  3T0Q A;  2VVG A;  1MMA A;  5LT2 A;  2ZFJ A;  1F9V A;  2G1Q A;  1BR1 A;  2XT3 A;  4FRZ A;  3ZFC A;  4B7B A;  1D1B A;  1F9W A;  1GOJ A;  4PJM A;  4ANJ A;  4ETP A;  5LT4 A;  1Q0B A;  3GBJ A;  2O0A A;  3B6U A;  3ZFD A;  2HEH A;  4A1Z A;  4PJN A;  2UYI A;  4DBR A;  1LKX A;  1D1A A;  1MMG A;  1VFW A;  2MYS A;  1VFV A;  3U06 A;  2NCD A;  2XAE A;  2ZFL A;  4HNA K;  3DCB A;  3H4S A;  1YRS A;  1CZ7 A;  2FL6 A;  4ZCA A;  3BFN A;  4BXN A;  4A14 A;  2IEH A;  1X88 A;  2PG2 A;  3CJO A;  3K3B A;  5LT1 A;  1V8K A;  1D0Z A;  4ZHI A;  4GKQ A;  1F9U A;  1BR4 A;  4A51 A;  3K5E A;  2Q2Y A;  4ETP B;  5HLE A;  2ZFI A;  4H1G A;  2Y5W A;  4PJL A;  2FKY A;  3KEN A;  4LNU K;  4PFO A;  4GKR A;  5LT0 A;  2WOG A;  1II6 A;  1V8J A;  3PXN A;  2X7E A;  2OWM A;  2VAS A;  3L1C A;  3CNZ A;  4E7Z A;  1RY6 A;  2FME A;  2KIN A;  1MNE A;  1N6M A;  1LVK A;  3WRD A;  4AS7 A;  1FMW A;  4UBF A;  2V26 A;  1T5C A;  3KIN A;  3X2T A;  4A50 A;  1MKJ A;  1SDM A;  2X7C A;  4GKP A;  2X7D A;  4PJJ A;  3HQD A;  4A5Y A;  1G8X A;  4BN2 A;  1I5S A;  1F9T A; 
#chains in the Genus database with same CATH homology
 1VFZ A;  2GRY A;  2ZFK A;  2GM1 A;  4AP0 A;  4DBQ A;  3NWN A;  4PFP A;  1D1C A;  1VFX A;  3B6V A;  2Q2Z A;  3LRE A;  3ZCW A;  1I6I A;  1FMV A;  3L9H A;  5LT3 A;  2X51 A;  3DC4 A;  3KAR A;  4Y05 A;  1D0Y A;  1KK7 A;  1MMN A;  1BG2 A;  2UYM A;  3WPN A;  2FL2 A;  2X2R A;  4BBG A;  5GSZ A;  4A28 A;  1MMD A;  3COB A;  1BR2 A;  1VOM A;  2ZFM A;  2Y65 A;  1D0X A;  4E7S A;  2VB6 A;  4PK4 A;  3T0Q A;  2VVG A;  1MMA A;  5LT2 A;  2ZFJ A;  1F9V A;  2G1Q A;  1BR1 A;  2XT3 A;  4FRZ A;  3ZFC A;  4B7B A;  1D1B A;  1F9W A;  1GOJ A;  4PJM A;  4ANJ A;  4ETP A;  5LT4 A;  1Q0B A;  3GBJ A;  3ZFD A;  3B6U A;  4A1Z A;  2HEH A;  4PJN A;  2UYI A;  4DBR A;  1LKX A;  1D1A A;  1MMG A;  1VFW A;  2MYS A;  1VFV A;  3U06 A;  2NCD A;  2XAE A;  2ZFL A;  4HNA K;  3DCB A;  3H4S A;  1YRS A;  1CZ7 A;  2FL6 A;  4ZCA A;  3BFN A;  4BXN A;  4A14 A;  2IEH A;  1X88 A;  2PG2 A;  3CJO A;  3K3B A;  5LT1 A;  1V8K A;  1D0Z A;  4ZHI A;  1F9U A;  1BR4 A;  4A51 A;  3K5E A;  2Q2Y A;  5HLE A;  2ZFI A;  4H1G A;  2Y5W A;  4PJL A;  2FKY A;  3KEN A;  4LNU K;  4PFO A;  4GKR A;  5LT0 A;  2WOG A;  1II6 A;  1V8J A;  3PXN A;  2X7E A;  2OWM A;  2VAS A;  3L1C A;  3CNZ A;  4E7Z A;  1RY6 A;  2FME A;  2KIN A;  1MNE A;  1N6M A;  1LVK A;  3WRD A;  4AS7 A;  1FMW A;  4UBF A;  2V26 A;  1T5C A;  3KIN A;  3X2T A;  4A50 A;  1MKJ A;  1SDM A;  2X7C A;  2X7D A;  4PJJ A;  3HQD A;  4A5Y A;  1G8X A;  4BN2 A;  1I5S A;  1F9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...