1VFVA

Crystal structure of the kif1a motor domain complexed with mg-amppnp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
360
structure length
324
Chain Sequence
GASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVTSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEANINKSLTTLGKVISALAEMFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVSVNH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Fusion protein consisting of Kinesin-like protein K
publication title KIF1A Alternately Uses Two Loops to Bind Microtubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 102
structure length 324
sequence length 360
ec nomenclature
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1vfvA00
4PFPA 1D0XA 3T0QA 1D0ZA 2UYIA 4DBQA 1VFVA 5LT3A 1D1AA 4PJMA 1T5CA 4A50A 4BN2A 4ETPA 4A1ZA 2OWMA 2X51A 1II6A 2MYSA 1MMAA 3LREA 1MKJA 2V26A 3CJOA 1LVKA 3B6UA 1V8JA 5HLEA 2G1QA 4BXNA 1D1CA 4ANJA 2XT3A 1I5SA 3H4SA 4PJLA 2VASA 4DBRA 3WPNA 2X2RA 4B7BA 1F9WA 2FMEA 2GRYA 4E7SA 2UYMA 4AS7A 4A51A 2Y5WA 1KK7A 1MNEA 1CZ7A 1Q0BA 1BR1A 3K5EA 2X7DA 1BG2A 1D1BA 4FRZA 3CNZA 2FL6A 2FKYA 3ZFDA 5LT4A 4ZCAA 1F9VA 3L1CA 3WRDA 4GKRA 2VVGA 2GM1A 2ZFKA 1D0YA 4PFOA 1VFZA 4Y05A 2XAEA 3COBA 1BR4A 4BBGA 1GOJA 2ZFMA 2HEHA 1MMGA 3K3BA 1MMNA 3U06A 2PG2A 3B6VA 3X2TA 1V8KA 4H1GA 4ZHIA 2FL2A 4HNAK 3L9HA 1G8XA 4A28A 4UBFA 4A5YA 2ZFLA 2VB6A 1VFWA 1YRSA 3NWNA 1FMWA 3DC4A 3KINA 2X7CA 3ZCWA 2WOGA 1SDMA 1MMDA 3HQDA 4E7ZA 5LT0A 2Q2YA 2Y65A 2KINA 5GSZA 1N6MA 4LNUK 1VOMA 3ZFCA 2Q2ZA 4PK4A 3BFNA 1BR2A 4AP0A 1FMVA 2X7EA 4PJNA 5LT2A 2ZFIA 5LT1A 1VFXA 2ZFJA 3KENA 1LKXA 1F9UA 3PXNA 1I6IA 1F9TA 1RY6A 3GBJA 3DCBA 1X88A 2IEHA 4PJJA 4A14A 2NCDA 3KARA
chains in the Genus database with same CATH superfamily
4PFPA 1D0XA 3T0QA 1D0ZA 2UYIA 4DBQA 1VFVA 5LT3A 1D1AA 4PJMA 1T5CA 2O0AA 4A50A 4BN2A 4ETPA 4A1ZA 2OWMA 2X51A 1II6A 2MYSA 1MMAA 3LREA 1MKJA 2V26A 3CJOA 1LVKA 3B6UA 1V8JA 5HLEA 2G1QA 4BXNA 1D1CA 4ANJA 2XT3A 1I5SA 3H4SA 4PJLA 2VASA 4DBRA 3WPNA 2X2RA 4B7BA 1F9WA 2FMEA 2GRYA 4E7SA 2UYMA 4AS7A 4A51A 2Y5WA 1KK7A 1MNEA 1CZ7A 1Q0BA 1BR1A 3K5EA 2X7DA 1BG2A 1D1BA 4FRZA 3CNZA 2FL6A 2FKYA 3ZFDA 5LT4A 4ZCAA 1F9VA 3L1CA 3WRDA 4GKRA 2VVGA 2GM1A 2ZFKA 1D0YA 4PFOA 1VFZA 4Y05A 2XAEA 3COBA 1BR4A 4BBGA 1GOJA 2ZFMA 2HEHA 1MMGA 3K3BA 1MMNA 3U06A 2PG2A 4GKQA 3B6VA 3X2TA 1V8KA 4H1GA 4ZHIA 2FL2A 4HNAK 3L9HA 1G8XA 4A28A 4UBFA 4A5YA 4ETPB 2ZFLA 2VB6A 1VFWA 1YRSA 3NWNA 1FMWA 4GKPA 3DC4A 3KINA 2X7CA 3ZCWA 2WOGA 1SDMA 1MMDA 3HQDA 4E7ZA 5LT0A 2Q2YA 2Y65A 2KINA 5GSZA 1N6MA 4LNUK 1VOMA 3ZFCA 2Q2ZA 4PK4A 3BFNA 1BR2A 4AP0A 1FMVA 2X7EA 4PJNA 5LT2A 2ZFIA 5LT1A 1VFXA 2ZFJA 3KENA 1LKXA 1F9UA 3PXNA 1I6IA 1F9TA 1RY6A 3GBJA 3DCBA 1X88A 2IEHA 4PJJA 4A14A 2NCDA 3KARA
chains in the Genus database with same CATH topology
4PFPA 1D0XA 3T0QA 1D0ZA 2UYIA 4DBQA 1VFVA 5LT3A 1D1AA 4PJMA 1T5CA 4A50A 4BN2A 4ETPA 4A1ZA 2OWMA 2X51A 1II6A 2MYSA 1MMAA 3LREA 1MKJA 2V26A 3CJOA 1LVKA 3B6UA 1V8JA 5HLEA 2G1QA 4BXNA 1D1CA 4ANJA 2XT3A 1I5SA 3H4SA 4PJLA 2VASA 4DBRA 3WPNA 2X2RA 4B7BA 1F9WA 2FMEA 2GRYA 4E7SA 2UYMA 4AS7A 4A51A 2Y5WA 1KK7A 1MNEA 1CZ7A 1Q0BA 1BR1A 3K5EA 2X7DA 1BG2A 1D1BA 4FRZA 3CNZA 2FL6A 2FKYA 3ZFDA 5LT4A 4ZCAA 1F9VA 3L1CA 3WRDA 4GKRA 2VVGA 2GM1A 2ZFKA 1D0YA 4PFOA 1VFZA 4Y05A 2XAEA 3COBA 1BR4A 4BBGA 1GOJA 2ZFMA 2HEHA 1MMGA 3K3BA 1MMNA 3U06A 2PG2A 3B6VA 3X2TA 1V8KA 4H1GA 4ZHIA 2FL2A 4HNAK 3L9HA 1G8XA 4A28A 4UBFA 4A5YA 2ZFLA 2VB6A 1VFWA 1YRSA 3NWNA 1FMWA 3DC4A 3KINA 2X7CA 3ZCWA 2WOGA 1SDMA 1MMDA 3HQDA 4E7ZA 5LT0A 2Q2YA 2Y65A 2KINA 5GSZA 1N6MA 4LNUK 1VOMA 3ZFCA 2Q2ZA 4PK4A 3BFNA 1BR2A 4AP0A 1FMVA 2X7EA 4PJNA 5LT2A 2ZFIA 5LT1A 1VFXA 2ZFJA 3KENA 1LKXA 1F9UA 3PXNA 1I6IA 1F9TA 1RY6A 3GBJA 3DCBA 1X88A 2IEHA 4PJJA 4A14A 2NCDA 3KARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFP A;  1D0X A;  3T0Q A;  1D0Z A;  2UYI A;  4DBQ A;  1VFV A;  5LT3 A;  1D1A A;  4PJM A;  1T5C A;  4A50 A;  4BN2 A;  4ETP A;  4A1Z A;  2OWM A;  2X51 A;  1II6 A;  2MYS A;  1MMA A;  3LRE A;  1MKJ A;  2V26 A;  3CJO A;  1LVK A;  3B6U A;  1V8J A;  5HLE A;  2G1Q A;  4BXN A;  1D1C A;  4ANJ A;  2XT3 A;  1I5S A;  3H4S A;  4PJL A;  2VAS A;  4DBR A;  3WPN A;  2X2R A;  4B7B A;  1F9W A;  2FME A;  2GRY A;  4E7S A;  2UYM A;  4AS7 A;  4A51 A;  2Y5W A;  1KK7 A;  1MNE A;  1CZ7 A;  1Q0B A;  1BR1 A;  3K5E A;  2X7D A;  1BG2 A;  1D1B A;  4FRZ A;  3CNZ A;  2FL6 A;  2FKY A;  3ZFD A;  5LT4 A;  4ZCA A;  1F9V A;  3L1C A;  3WRD A;  4GKR A;  2VVG A;  2GM1 A;  2ZFK A;  1D0Y A;  4PFO A;  1VFZ A;  4Y05 A;  2XAE A;  3COB A;  1BR4 A;  4BBG A;  1GOJ A;  2ZFM A;  2HEH A;  1MMG A;  3K3B A;  1MMN A;  3U06 A;  2PG2 A;  3B6V A;  3X2T A;  1V8K A;  4H1G A;  4ZHI A;  2FL2 A;  4HNA K;  3L9H A;  1G8X A;  4A28 A;  4UBF A;  4A5Y A;  2ZFL A;  2VB6 A;  1VFW A;  1YRS A;  3NWN A;  1FMW A;  3DC4 A;  3KIN A;  2X7C A;  3ZCW A;  2WOG A;  1SDM A;  1MMD A;  3HQD A;  4E7Z A;  5LT0 A;  2Q2Y A;  2Y65 A;  2KIN A;  5GSZ A;  1N6M A;  4LNU K;  1VOM A;  3ZFC A;  2Q2Z A;  4PK4 A;  3BFN A;  1BR2 A;  4AP0 A;  1FMV A;  2X7E A;  4PJN A;  5LT2 A;  2ZFI A;  5LT1 A;  1VFX A;  2ZFJ A;  3KEN A;  1LKX A;  1F9U A;  3PXN A;  1I6I A;  1F9T A;  1RY6 A;  3GBJ A;  3DCB A;  1X88 A;  2IEH A;  4PJJ A;  4A14 A;  2NCD A;  3KAR A; 
#chains in the Genus database with same CATH topology
 4PFP A;  1D0X A;  3T0Q A;  1D0Z A;  2UYI A;  4DBQ A;  1VFV A;  5LT3 A;  1D1A A;  4PJM A;  1T5C A;  2O0A A;  4A50 A;  4BN2 A;  4ETP A;  4A1Z A;  2OWM A;  2X51 A;  1II6 A;  2MYS A;  1MMA A;  3LRE A;  1MKJ A;  2V26 A;  3CJO A;  1LVK A;  3B6U A;  1V8J A;  5HLE A;  2G1Q A;  4BXN A;  1D1C A;  4ANJ A;  2XT3 A;  1I5S A;  3H4S A;  4PJL A;  2VAS A;  4DBR A;  3WPN A;  2X2R A;  4B7B A;  1F9W A;  2FME A;  2GRY A;  4E7S A;  2UYM A;  4AS7 A;  4A51 A;  2Y5W A;  1KK7 A;  1MNE A;  1CZ7 A;  1Q0B A;  1BR1 A;  3K5E A;  2X7D A;  1BG2 A;  1D1B A;  4FRZ A;  3CNZ A;  2FL6 A;  2FKY A;  3ZFD A;  5LT4 A;  4ZCA A;  1F9V A;  3L1C A;  3WRD A;  4GKR A;  2VVG A;  2GM1 A;  2ZFK A;  1D0Y A;  4PFO A;  1VFZ A;  4Y05 A;  2XAE A;  3COB A;  1BR4 A;  4BBG A;  1GOJ A;  2ZFM A;  2HEH A;  1MMG A;  3K3B A;  1MMN A;  3U06 A;  2PG2 A;  4GKQ A;  3B6V A;  3X2T A;  1V8K A;  4H1G A;  4ZHI A;  2FL2 A;  4HNA K;  3L9H A;  1G8X A;  4A28 A;  4UBF A;  4A5Y A;  4ETP B;  2ZFL A;  2VB6 A;  1VFW A;  1YRS A;  3NWN A;  1FMW A;  4GKP A;  3DC4 A;  3KIN A;  2X7C A;  3ZCW A;  2WOG A;  1SDM A;  1MMD A;  3HQD A;  4E7Z A;  5LT0 A;  2Q2Y A;  2Y65 A;  2KIN A;  5GSZ A;  1N6M A;  4LNU K;  1VOM A;  3ZFC A;  2Q2Z A;  4PK4 A;  3BFN A;  1BR2 A;  4AP0 A;  1FMV A;  2X7E A;  4PJN A;  5LT2 A;  2ZFI A;  5LT1 A;  1VFX A;  2ZFJ A;  3KEN A;  1LKX A;  1F9U A;  3PXN A;  1I6I A;  1F9T A;  1RY6 A;  3GBJ A;  3DCB A;  1X88 A;  2IEH A;  4PJJ A;  4A14 A;  2NCD A;  3KAR A; 
#chains in the Genus database with same CATH homology
 4PFP A;  1D0X A;  3T0Q A;  1D0Z A;  2UYI A;  4DBQ A;  1VFV A;  5LT3 A;  1D1A A;  4PJM A;  1T5C A;  4A50 A;  4BN2 A;  4ETP A;  4A1Z A;  2OWM A;  2X51 A;  1II6 A;  2MYS A;  1MMA A;  3LRE A;  1MKJ A;  2V26 A;  3CJO A;  1LVK A;  3B6U A;  1V8J A;  5HLE A;  2G1Q A;  4BXN A;  1D1C A;  4ANJ A;  2XT3 A;  1I5S A;  3H4S A;  4PJL A;  2VAS A;  4DBR A;  3WPN A;  2X2R A;  4B7B A;  1F9W A;  2FME A;  2GRY A;  4E7S A;  2UYM A;  4AS7 A;  4A51 A;  2Y5W A;  1KK7 A;  1MNE A;  1CZ7 A;  1Q0B A;  1BR1 A;  3K5E A;  2X7D A;  1BG2 A;  1D1B A;  4FRZ A;  3CNZ A;  2FL6 A;  2FKY A;  3ZFD A;  5LT4 A;  4ZCA A;  1F9V A;  3L1C A;  3WRD A;  4GKR A;  2VVG A;  2GM1 A;  2ZFK A;  1D0Y A;  4PFO A;  1VFZ A;  4Y05 A;  2XAE A;  3COB A;  1BR4 A;  4BBG A;  1GOJ A;  2ZFM A;  2HEH A;  1MMG A;  3K3B A;  1MMN A;  3U06 A;  2PG2 A;  3B6V A;  3X2T A;  1V8K A;  4H1G A;  4ZHI A;  2FL2 A;  4HNA K;  3L9H A;  1G8X A;  4A28 A;  4UBF A;  4A5Y A;  2ZFL A;  2VB6 A;  1VFW A;  1YRS A;  3NWN A;  1FMW A;  3DC4 A;  3KIN A;  2X7C A;  3ZCW A;  2WOG A;  1SDM A;  1MMD A;  3HQD A;  4E7Z A;  5LT0 A;  2Q2Y A;  2Y65 A;  2KIN A;  5GSZ A;  1N6M A;  4LNU K;  1VOM A;  3ZFC A;  2Q2Z A;  4PK4 A;  3BFN A;  1BR2 A;  4AP0 A;  1FMV A;  2X7E A;  4PJN A;  5LT2 A;  2ZFI A;  5LT1 A;  1VFX A;  2ZFJ A;  3KEN A;  1LKX A;  1F9U A;  3PXN A;  1I6I A;  1F9T A;  1RY6 A;  3GBJ A;  3DCB A;  1X88 A;  2IEH A;  4PJJ A;  4A14 A;  2NCD A;  3KAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...