1VFVA

Crystal structure of the kif1a motor domain complexed with mg-amppnp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
360
structure length
324
Chain Sequence
b'GASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVTSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEANINKSLTTLGKVISALAEMFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVSVNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Fusion protein consisting of Kinesin-like protein K
publication title KIF1A Alternately Uses Two Loops to Bind Microtubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 102
structure length 324
sequence length 360
ec nomenclature
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1vfvA00
1Q0BA 2FMEA 4DBQA 2VVGA 1I5SA 3B6UA 2NCDA 4ANJA 3H4SA 1BR4A 2X51A 1FMVA 1RY6A 1D1CA 3WRDA 2ZFLA 5HLEA 3CJOA 1T5CA 1BG2A 4BXNA 5LT4A 2Q2ZA 2HEHA 2Y5WA 1F9UA 4GKRA 1D0YA 2Q2YA 4DBRA 3ZCWA 1G8XA 4A50A 1MMDA 4PFPA 3K5EA 4LNUK 2G1QA 3PXNA 3LREA 1VFZA 4A1ZA 3L9HA 2X7DA 4PJNA 2X7EA 3KINA 3GBJA 1MMNA 1D1BA 4E7ZA 4PK4A 4PJJA 1VFXA 1F9TA 2IEHA 1LVKA 1CZ7A 3K3BA 3NWNA 4Y05A 2GM1A 2ZFMA 2VASA 3X2TA 1D0ZA 1BR1A 5LT2A 4BN2A 4B7BA 2OWMA 2V26A 2X7CA 2Y65A 3WPNA 4ZHIA 1VFWA 4PJLA 3T0QA 5LT1A 5LT0A 1II6A 3ZFCA 1X88A 1V8KA 1V8JA 4ZCAA 2ZFIA 2PG2A 4AS7A 4HNAK 1MNEA 1BR2A 1VFVA 4A14A 1D0XA 1N6MA 1SDMA 4A51A 5LT3A 1MMAA 1D1AA 1KK7A 3KENA 2XAEA 2XT3A 3KARA 2VB6A 1F9WA 4PFOA 1MKJA 1FMWA 3HQDA 2FL2A 1MMGA 3L1CA 4A28A 3DC4A 2FL6A 2GRYA 4A5YA 4UBFA 4FRZA 3DCBA 3U06A 2ZFKA 3BFNA 1F9VA 2X2RA 4AP0A 4BBGA 2FKYA 1LKXA 1VOMA 4ETPA 3COBA 3CNZA 4PJMA 1YRSA 5GSZA 2KINA 2ZFJA 1I6IA 2MYSA 3B6VA 4H1GA 2UYMA 1GOJA 3ZFDA 2UYIA 4E7SA 2WOGA
chains in the Genus database with same CATH superfamily
1Q0BA 2FMEA 4DBQA 2VVGA 1I5SA 3B6UA 2NCDA 4ANJA 3H4SA 1BR4A 2X51A 1FMVA 1RY6A 1D1CA 3WRDA 2ZFLA 5HLEA 3CJOA 1T5CA 1BG2A 4BXNA 5LT4A 2Q2ZA 2HEHA 2Y5WA 1F9UA 4GKRA 1D0YA 2Q2YA 4DBRA 3ZCWA 1G8XA 4A50A 1MMDA 4PFPA 3K5EA 4GKPA 4LNUK 2G1QA 3PXNA 3LREA 1VFZA 4A1ZA 3L9HA 2X7DA 4PJNA 2X7EA 3KINA 3GBJA 1MMNA 1D1BA 4E7ZA 4PK4A 4PJJA 1VFXA 1F9TA 2IEHA 1LVKA 1CZ7A 3K3BA 3NWNA 4Y05A 2GM1A 2ZFMA 2VASA 3X2TA 1D0ZA 1BR1A 5LT2A 4BN2A 4B7BA 2OWMA 2O0AA 2V26A 2X7CA 2Y65A 3WPNA 4ZHIA 1VFWA 4PJLA 3T0QA 5LT1A 5LT0A 1II6A 3ZFCA 1X88A 1V8KA 1V8JA 4ZCAA 2ZFIA 2PG2A 4AS7A 4HNAK 1MNEA 1BR2A 4GKQA 1VFVA 4A14A 1D0XA 1N6MA 1SDMA 4A51A 5LT3A 1MMAA 1D1AA 1KK7A 3KENA 2XAEA 2XT3A 3KARA 2VB6A 1F9WA 4PFOA 1MKJA 1FMWA 3HQDA 2FL2A 1MMGA 3L1CA 4A28A 3DC4A 2FL6A 2GRYA 4A5YA 4ETPB 4UBFA 4FRZA 3DCBA 3U06A 2ZFKA 3BFNA 1F9VA 2X2RA 4AP0A 4BBGA 2FKYA 1LKXA 1VOMA 4ETPA 3COBA 3CNZA 4PJMA 1YRSA 5GSZA 2KINA 2ZFJA 1I6IA 2MYSA 3B6VA 4H1GA 2UYMA 1GOJA 3ZFDA 2UYIA 4E7SA 2WOGA
chains in the Genus database with same CATH topology
1Q0BA 2FMEA 4DBQA 2VVGA 1I5SA 3B6UA 2NCDA 4ANJA 3H4SA 1BR4A 2X51A 1FMVA 1RY6A 1D1CA 3WRDA 2ZFLA 5HLEA 3CJOA 1T5CA 1BG2A 4BXNA 5LT4A 2Q2ZA 2HEHA 2Y5WA 1F9UA 4GKRA 1D0YA 2Q2YA 4DBRA 3ZCWA 1G8XA 4A50A 1MMDA 4PFPA 3K5EA 4LNUK 2G1QA 3PXNA 3LREA 1VFZA 4A1ZA 3L9HA 2X7DA 4PJNA 2X7EA 3KINA 3GBJA 1MMNA 1D1BA 4E7ZA 4PK4A 4PJJA 1VFXA 1F9TA 2IEHA 1LVKA 1CZ7A 3K3BA 3NWNA 4Y05A 2GM1A 2ZFMA 2VASA 3X2TA 1D0ZA 1BR1A 5LT2A 4BN2A 4B7BA 2OWMA 2V26A 2X7CA 2Y65A 3WPNA 4ZHIA 1VFWA 4PJLA 3T0QA 5LT1A 5LT0A 1II6A 3ZFCA 1X88A 1V8KA 1V8JA 4ZCAA 2ZFIA 2PG2A 4AS7A 4HNAK 1MNEA 1BR2A 1VFVA 4A14A 1D0XA 1N6MA 1SDMA 4A51A 5LT3A 1MMAA 1D1AA 1KK7A 3KENA 2XAEA 2XT3A 3KARA 2VB6A 1F9WA 4PFOA 1MKJA 1FMWA 3HQDA 2FL2A 1MMGA 3L1CA 4A28A 3DC4A 2FL6A 2GRYA 4A5YA 4UBFA 4FRZA 3DCBA 3U06A 2ZFKA 3BFNA 1F9VA 2X2RA 4AP0A 4BBGA 2FKYA 1LKXA 1VOMA 4ETPA 3COBA 3CNZA 4PJMA 1YRSA 5GSZA 2KINA 2ZFJA 1I6IA 2MYSA 3B6VA 4H1GA 2UYMA 1GOJA 3ZFDA 2UYIA 4E7SA 2WOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q0B A;  2FME A;  4DBQ A;  2VVG A;  1I5S A;  3B6U A;  2NCD A;  4ANJ A;  3H4S A;  1BR4 A;  2X51 A;  1FMV A;  1RY6 A;  1D1C A;  3WRD A;  2ZFL A;  5HLE A;  3CJO A;  1T5C A;  1BG2 A;  4BXN A;  5LT4 A;  2Q2Z A;  2HEH A;  2Y5W A;  1F9U A;  4GKR A;  1D0Y A;  2Q2Y A;  4DBR A;  3ZCW A;  1G8X A;  4A50 A;  1MMD A;  4PFP A;  3K5E A;  4LNU K;  2G1Q A;  3PXN A;  3LRE A;  1VFZ A;  4A1Z A;  3L9H A;  2X7D A;  4PJN A;  2X7E A;  3KIN A;  3GBJ A;  1MMN A;  1D1B A;  4E7Z A;  4PK4 A;  4PJJ A;  1VFX A;  1F9T A;  2IEH A;  1LVK A;  1CZ7 A;  3K3B A;  3NWN A;  4Y05 A;  2GM1 A;  2ZFM A;  2VAS A;  3X2T A;  1D0Z A;  1BR1 A;  5LT2 A;  4BN2 A;  4B7B A;  2OWM A;  2V26 A;  2X7C A;  2Y65 A;  3WPN A;  4ZHI A;  1VFW A;  4PJL A;  3T0Q A;  5LT1 A;  5LT0 A;  1II6 A;  3ZFC A;  1X88 A;  1V8K A;  1V8J A;  4ZCA A;  2ZFI A;  2PG2 A;  4AS7 A;  4HNA K;  1MNE A;  1BR2 A;  1VFV A;  4A14 A;  1D0X A;  1N6M A;  1SDM A;  4A51 A;  5LT3 A;  1MMA A;  1D1A A;  1KK7 A;  3KEN A;  2XAE A;  2XT3 A;  3KAR A;  2VB6 A;  1F9W A;  4PFO A;  1MKJ A;  1FMW A;  3HQD A;  2FL2 A;  1MMG A;  3L1C A;  4A28 A;  3DC4 A;  2FL6 A;  2GRY A;  4A5Y A;  4UBF A;  4FRZ A;  3DCB A;  3U06 A;  2ZFK A;  3BFN A;  1F9V A;  2X2R A;  4AP0 A;  4BBG A;  2FKY A;  1LKX A;  1VOM A;  4ETP A;  3COB A;  3CNZ A;  4PJM A;  1YRS A;  5GSZ A;  2KIN A;  2ZFJ A;  1I6I A;  2MYS A;  3B6V A;  4H1G A;  2UYM A;  1GOJ A;  3ZFD A;  2UYI A;  4E7S A;  2WOG A; 
#chains in the Genus database with same CATH topology
 1Q0B A;  2FME A;  4DBQ A;  2VVG A;  1I5S A;  3B6U A;  2NCD A;  4ANJ A;  3H4S A;  1BR4 A;  2X51 A;  1FMV A;  1RY6 A;  1D1C A;  3WRD A;  2ZFL A;  5HLE A;  3CJO A;  1T5C A;  1BG2 A;  4BXN A;  5LT4 A;  2Q2Z A;  2HEH A;  2Y5W A;  1F9U A;  4GKR A;  1D0Y A;  2Q2Y A;  4DBR A;  3ZCW A;  1G8X A;  4A50 A;  1MMD A;  4PFP A;  3K5E A;  4GKP A;  4LNU K;  2G1Q A;  3PXN A;  3LRE A;  1VFZ A;  4A1Z A;  3L9H A;  2X7D A;  4PJN A;  2X7E A;  3KIN A;  3GBJ A;  1MMN A;  1D1B A;  4E7Z A;  4PK4 A;  4PJJ A;  1VFX A;  1F9T A;  2IEH A;  1LVK A;  1CZ7 A;  3K3B A;  3NWN A;  4Y05 A;  2GM1 A;  2ZFM A;  2VAS A;  3X2T A;  1D0Z A;  1BR1 A;  5LT2 A;  4BN2 A;  4B7B A;  2OWM A;  2O0A A;  2V26 A;  2X7C A;  2Y65 A;  3WPN A;  4ZHI A;  1VFW A;  4PJL A;  3T0Q A;  5LT1 A;  5LT0 A;  1II6 A;  3ZFC A;  1X88 A;  1V8K A;  1V8J A;  4ZCA A;  2ZFI A;  2PG2 A;  4AS7 A;  4HNA K;  1MNE A;  1BR2 A;  4GKQ A;  1VFV A;  4A14 A;  1D0X A;  1N6M A;  1SDM A;  4A51 A;  5LT3 A;  1MMA A;  1D1A A;  1KK7 A;  3KEN A;  2XAE A;  2XT3 A;  3KAR A;  2VB6 A;  1F9W A;  4PFO A;  1MKJ A;  1FMW A;  3HQD A;  2FL2 A;  1MMG A;  3L1C A;  4A28 A;  3DC4 A;  2FL6 A;  2GRY A;  4A5Y A;  4ETP B;  4UBF A;  4FRZ A;  3DCB A;  3U06 A;  2ZFK A;  3BFN A;  1F9V A;  2X2R A;  4AP0 A;  4BBG A;  2FKY A;  1LKX A;  1VOM A;  4ETP A;  3COB A;  3CNZ A;  4PJM A;  1YRS A;  5GSZ A;  2KIN A;  2ZFJ A;  1I6I A;  2MYS A;  3B6V A;  4H1G A;  2UYM A;  1GOJ A;  3ZFD A;  2UYI A;  4E7S A;  2WOG A; 
#chains in the Genus database with same CATH homology
 1Q0B A;  2FME A;  4DBQ A;  2VVG A;  1I5S A;  3B6U A;  2NCD A;  4ANJ A;  3H4S A;  1BR4 A;  2X51 A;  1FMV A;  1RY6 A;  1D1C A;  3WRD A;  2ZFL A;  5HLE A;  3CJO A;  1T5C A;  1BG2 A;  4BXN A;  5LT4 A;  2Q2Z A;  2HEH A;  2Y5W A;  1F9U A;  4GKR A;  1D0Y A;  2Q2Y A;  4DBR A;  3ZCW A;  1G8X A;  4A50 A;  1MMD A;  4PFP A;  3K5E A;  4LNU K;  2G1Q A;  3PXN A;  3LRE A;  1VFZ A;  4A1Z A;  3L9H A;  2X7D A;  4PJN A;  2X7E A;  3KIN A;  3GBJ A;  1MMN A;  1D1B A;  4E7Z A;  4PK4 A;  4PJJ A;  1VFX A;  1F9T A;  2IEH A;  1LVK A;  1CZ7 A;  3K3B A;  3NWN A;  4Y05 A;  2GM1 A;  2ZFM A;  2VAS A;  3X2T A;  1D0Z A;  1BR1 A;  5LT2 A;  4BN2 A;  4B7B A;  2OWM A;  2V26 A;  2X7C A;  2Y65 A;  3WPN A;  4ZHI A;  1VFW A;  4PJL A;  3T0Q A;  5LT1 A;  5LT0 A;  1II6 A;  3ZFC A;  1X88 A;  1V8K A;  1V8J A;  4ZCA A;  2ZFI A;  2PG2 A;  4AS7 A;  4HNA K;  1MNE A;  1BR2 A;  1VFV A;  4A14 A;  1D0X A;  1N6M A;  1SDM A;  4A51 A;  5LT3 A;  1MMA A;  1D1A A;  1KK7 A;  3KEN A;  2XAE A;  2XT3 A;  3KAR A;  2VB6 A;  1F9W A;  4PFO A;  1MKJ A;  1FMW A;  3HQD A;  2FL2 A;  1MMG A;  3L1C A;  4A28 A;  3DC4 A;  2FL6 A;  2GRY A;  4A5Y A;  4UBF A;  4FRZ A;  3DCB A;  3U06 A;  2ZFK A;  3BFN A;  1F9V A;  2X2R A;  4AP0 A;  4BBG A;  2FKY A;  1LKX A;  1VOM A;  4ETP A;  3COB A;  3CNZ A;  4PJM A;  1YRS A;  5GSZ A;  2KIN A;  2ZFJ A;  1I6I A;  2MYS A;  3B6V A;  4H1G A;  2UYM A;  1GOJ A;  3ZFD A;  2UYI A;  4E7S A;  2WOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...