3X2TA

Crystal structure of the kif5c motor domain with adp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
331
structure length
311
Chain Sequence
b'PAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKNKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin heavy chain isoform 5C
publication title X-ray and Cryo-EM structures reveal mutual conformational changes of Kinesin and GTP-state microtubules upon binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Motor protein
total genus 87
structure length 311
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3x2tA00
2ZFLA 2IEHA 2XT3A 4ANJA 4PJLA 1G8XA 2UYMA 4ZCAA 1BR1A 3COBA 1MKJA 3GBJA 1MMAA 1D0XA 1V8KA 4H1GA 4A51A 2GRYA 3U06A 3KENA 2UYIA 4PK4A 2HEHA 1MMNA 1II6A 4A14A 5LT4A 2Y65A 2FMEA 2V26A 5LT2A 1MMDA 1D0YA 1I5SA 3LREA 1VFZA 3L9HA 4LNUK 1YRSA 3H4SA 4BBGA 3WRDA 1BR2A 1VFXA 2X7EA 4ZHIA 2FKYA 1V8JA 3L1CA 1F9TA 1FMWA 3X2TA 3K3BA 4PFOA 4DBRA 3CNZA 3K5EA 2VVGA 5GSZA 4FRZA 1VFWA 1BR4A 2ZFJA 3BFNA 1N6MA 1FMVA 4A28A 2WOGA 3KINA 1LVKA 2G1QA 1CZ7A 4BN2A 3CJOA 4E7SA 3PXNA 4Y05A 2Q2ZA 4A50A 3NWNA 2ZFMA 3KARA 3ZFCA 2Q2YA 1D1AA 1MNEA 2ZFIA 3DCBA 5LT3A 4DBQA 3DC4A 2FL6A 4PJNA 4ETPA 5HLEA 4A5YA 4AS7A 2NCDA 4E7ZA 3B6VA 1BG2A 4GKRA 2VB6A 3HQDA 4A1ZA 2X2RA 1F9UA 4PJJA 1D1BA 2Y5WA 1SDMA 3B6UA 2X51A 4UBFA 3T0QA 1T5CA 1X88A 4BXNA 2OWMA 1F9VA 5LT0A 2FL2A 1GOJA 2KINA 2MYSA 1D0ZA 5LT1A 1F9WA 2X7DA 3ZFDA 2GM1A 1VOMA 1MMGA 2XAEA 4AP0A 1VFVA 3ZCWA 2PG2A 4HNAK 1D1CA 4B7BA 2X7CA 1I6IA 1KK7A 1LKXA 1RY6A 2VASA 2ZFKA 4PFPA 3WPNA 4PJMA 1Q0BA
chains in the Genus database with same CATH superfamily
2ZFLA 2IEHA 2XT3A 4ANJA 4PJLA 1G8XA 2UYMA 4ZCAA 1BR1A 3COBA 1MKJA 3GBJA 1MMAA 1D0XA 1V8KA 4H1GA 4A51A 2GRYA 3U06A 3KENA 2UYIA 4PK4A 2HEHA 1MMNA 1II6A 4A14A 5LT4A 2Y65A 2FMEA 2V26A 5LT2A 1MMDA 1D0YA 1I5SA 3LREA 1VFZA 3L9HA 4LNUK 1YRSA 3H4SA 4BBGA 3WRDA 1BR2A 1VFXA 2X7EA 4GKPA 4ZHIA 2FKYA 1V8JA 3L1CA 1F9TA 1FMWA 3X2TA 3K3BA 4PFOA 4DBRA 3CNZA 3K5EA 2VVGA 5GSZA 4FRZA 1VFWA 1BR4A 2ZFJA 3BFNA 1N6MA 1FMVA 4A28A 2WOGA 3KINA 1LVKA 2G1QA 1CZ7A 4BN2A 3CJOA 4GKQA 3PXNA 4Y05A 4E7SA 2Q2ZA 4A50A 4ETPB 3NWNA 2ZFMA 3KARA 3ZFCA 2Q2YA 1D1AA 1MNEA 2ZFIA 2O0AA 3DCBA 5LT3A 4DBQA 3DC4A 2FL6A 4PJNA 4ETPA 5HLEA 4A5YA 4AS7A 2NCDA 4E7ZA 3B6VA 1BG2A 4GKRA 2VB6A 3HQDA 4A1ZA 2X2RA 1F9UA 4PJJA 1D1BA 2Y5WA 1SDMA 3B6UA 2X51A 4UBFA 3T0QA 1T5CA 1X88A 4BXNA 2OWMA 1F9VA 5LT0A 2FL2A 1GOJA 2KINA 2MYSA 1D0ZA 5LT1A 1F9WA 2X7DA 3ZFDA 2GM1A 1VOMA 1MMGA 2XAEA 4AP0A 1VFVA 3ZCWA 2PG2A 4HNAK 1D1CA 4B7BA 2X7CA 1I6IA 1KK7A 1LKXA 1RY6A 2VASA 2ZFKA 4PFPA 3WPNA 4PJMA 1Q0BA
chains in the Genus database with same CATH topology
2ZFLA 2IEHA 2XT3A 4ANJA 4PJLA 1G8XA 2UYMA 4ZCAA 1BR1A 3COBA 1MKJA 3GBJA 1MMAA 1D0XA 1V8KA 4H1GA 4A51A 2GRYA 3U06A 3KENA 2UYIA 4PK4A 2HEHA 1MMNA 1II6A 4A14A 5LT4A 2Y65A 2FMEA 2V26A 5LT2A 1MMDA 1D0YA 1I5SA 3LREA 1VFZA 3L9HA 4LNUK 1YRSA 3H4SA 4BBGA 3WRDA 1BR2A 1VFXA 2X7EA 4ZHIA 2FKYA 1V8JA 3L1CA 1F9TA 1FMWA 3X2TA 3K3BA 4PFOA 4DBRA 3CNZA 3K5EA 2VVGA 5GSZA 4FRZA 1VFWA 1BR4A 2ZFJA 3BFNA 1N6MA 1FMVA 4A28A 2WOGA 3KINA 1LVKA 2G1QA 1CZ7A 4BN2A 3CJOA 4E7SA 3PXNA 4Y05A 2Q2ZA 4A50A 3NWNA 2ZFMA 3KARA 3ZFCA 2Q2YA 1D1AA 1MNEA 2ZFIA 3DCBA 5LT3A 4DBQA 3DC4A 2FL6A 4PJNA 4ETPA 5HLEA 4A5YA 4AS7A 2NCDA 4E7ZA 3B6VA 1BG2A 4GKRA 2VB6A 3HQDA 4A1ZA 2X2RA 1F9UA 4PJJA 1D1BA 2Y5WA 1SDMA 3B6UA 2X51A 4UBFA 3T0QA 1T5CA 1X88A 4BXNA 2OWMA 1F9VA 5LT0A 2FL2A 1GOJA 2KINA 2MYSA 1D0ZA 5LT1A 1F9WA 2X7DA 3ZFDA 2GM1A 1VOMA 1MMGA 2XAEA 4AP0A 1VFVA 3ZCWA 2PG2A 4HNAK 1D1CA 4B7BA 2X7CA 1I6IA 1KK7A 1LKXA 1RY6A 2VASA 2ZFKA 4PFPA 3WPNA 4PJMA 1Q0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFL A;  2IEH A;  2XT3 A;  4ANJ A;  4PJL A;  1G8X A;  2UYM A;  4ZCA A;  1BR1 A;  3COB A;  1MKJ A;  3GBJ A;  1MMA A;  1D0X A;  1V8K A;  4H1G A;  4A51 A;  2GRY A;  3U06 A;  3KEN A;  2UYI A;  4PK4 A;  2HEH A;  1MMN A;  1II6 A;  4A14 A;  5LT4 A;  2Y65 A;  2FME A;  2V26 A;  5LT2 A;  1MMD A;  1D0Y A;  1I5S A;  3LRE A;  1VFZ A;  3L9H A;  4LNU K;  1YRS A;  3H4S A;  4BBG A;  3WRD A;  1BR2 A;  1VFX A;  2X7E A;  4ZHI A;  2FKY A;  1V8J A;  3L1C A;  1F9T A;  1FMW A;  3X2T A;  3K3B A;  4PFO A;  4DBR A;  3CNZ A;  3K5E A;  2VVG A;  5GSZ A;  4FRZ A;  1VFW A;  1BR4 A;  2ZFJ A;  3BFN A;  1N6M A;  1FMV A;  4A28 A;  2WOG A;  3KIN A;  1LVK A;  2G1Q A;  1CZ7 A;  4BN2 A;  3CJO A;  4E7S A;  3PXN A;  4Y05 A;  2Q2Z A;  4A50 A;  3NWN A;  2ZFM A;  3KAR A;  3ZFC A;  2Q2Y A;  1D1A A;  1MNE A;  2ZFI A;  3DCB A;  5LT3 A;  4DBQ A;  3DC4 A;  2FL6 A;  4PJN A;  4ETP A;  5HLE A;  4A5Y A;  4AS7 A;  2NCD A;  4E7Z A;  3B6V A;  1BG2 A;  4GKR A;  2VB6 A;  3HQD A;  4A1Z A;  2X2R A;  1F9U A;  4PJJ A;  1D1B A;  2Y5W A;  1SDM A;  3B6U A;  2X51 A;  4UBF A;  3T0Q A;  1T5C A;  1X88 A;  4BXN A;  2OWM A;  1F9V A;  5LT0 A;  2FL2 A;  1GOJ A;  2KIN A;  2MYS A;  1D0Z A;  5LT1 A;  1F9W A;  2X7D A;  3ZFD A;  2GM1 A;  1VOM A;  1MMG A;  2XAE A;  4AP0 A;  1VFV A;  3ZCW A;  2PG2 A;  4HNA K;  1D1C A;  4B7B A;  2X7C A;  1I6I A;  1KK7 A;  1LKX A;  1RY6 A;  2VAS A;  2ZFK A;  4PFP A;  3WPN A;  4PJM A;  1Q0B A; 
#chains in the Genus database with same CATH topology
 2ZFL A;  2IEH A;  2XT3 A;  4ANJ A;  4PJL A;  1G8X A;  2UYM A;  4ZCA A;  1BR1 A;  3COB A;  1MKJ A;  3GBJ A;  1MMA A;  1D0X A;  1V8K A;  4H1G A;  4A51 A;  2GRY A;  3U06 A;  3KEN A;  2UYI A;  4PK4 A;  2HEH A;  1MMN A;  1II6 A;  4A14 A;  5LT4 A;  2Y65 A;  2FME A;  2V26 A;  5LT2 A;  1MMD A;  1D0Y A;  1I5S A;  3LRE A;  1VFZ A;  3L9H A;  4LNU K;  1YRS A;  3H4S A;  4BBG A;  3WRD A;  1BR2 A;  1VFX A;  2X7E A;  4GKP A;  4ZHI A;  2FKY A;  1V8J A;  3L1C A;  1F9T A;  1FMW A;  3X2T A;  3K3B A;  4PFO A;  4DBR A;  3CNZ A;  3K5E A;  2VVG A;  5GSZ A;  4FRZ A;  1VFW A;  1BR4 A;  2ZFJ A;  3BFN A;  1N6M A;  1FMV A;  4A28 A;  2WOG A;  3KIN A;  1LVK A;  2G1Q A;  1CZ7 A;  4BN2 A;  3CJO A;  4GKQ A;  3PXN A;  4Y05 A;  4E7S A;  2Q2Z A;  4A50 A;  4ETP B;  3NWN A;  2ZFM A;  3KAR A;  3ZFC A;  2Q2Y A;  1D1A A;  1MNE A;  2ZFI A;  2O0A A;  3DCB A;  5LT3 A;  4DBQ A;  3DC4 A;  2FL6 A;  4PJN A;  4ETP A;  5HLE A;  4A5Y A;  4AS7 A;  2NCD A;  4E7Z A;  3B6V A;  1BG2 A;  4GKR A;  2VB6 A;  3HQD A;  4A1Z A;  2X2R A;  1F9U A;  4PJJ A;  1D1B A;  2Y5W A;  1SDM A;  3B6U A;  2X51 A;  4UBF A;  3T0Q A;  1T5C A;  1X88 A;  4BXN A;  2OWM A;  1F9V A;  5LT0 A;  2FL2 A;  1GOJ A;  2KIN A;  2MYS A;  1D0Z A;  5LT1 A;  1F9W A;  2X7D A;  3ZFD A;  2GM1 A;  1VOM A;  1MMG A;  2XAE A;  4AP0 A;  1VFV A;  3ZCW A;  2PG2 A;  4HNA K;  1D1C A;  4B7B A;  2X7C A;  1I6I A;  1KK7 A;  1LKX A;  1RY6 A;  2VAS A;  2ZFK A;  4PFP A;  3WPN A;  4PJM A;  1Q0B A; 
#chains in the Genus database with same CATH homology
 2ZFL A;  2IEH A;  2XT3 A;  4ANJ A;  4PJL A;  1G8X A;  2UYM A;  4ZCA A;  1BR1 A;  3COB A;  1MKJ A;  3GBJ A;  1MMA A;  1D0X A;  1V8K A;  4H1G A;  4A51 A;  2GRY A;  3U06 A;  3KEN A;  2UYI A;  4PK4 A;  2HEH A;  1MMN A;  1II6 A;  4A14 A;  5LT4 A;  2Y65 A;  2FME A;  2V26 A;  5LT2 A;  1MMD A;  1D0Y A;  1I5S A;  3LRE A;  1VFZ A;  3L9H A;  4LNU K;  1YRS A;  3H4S A;  4BBG A;  3WRD A;  1BR2 A;  1VFX A;  2X7E A;  4ZHI A;  2FKY A;  1V8J A;  3L1C A;  1F9T A;  1FMW A;  3X2T A;  3K3B A;  4PFO A;  4DBR A;  3CNZ A;  3K5E A;  2VVG A;  5GSZ A;  4FRZ A;  1VFW A;  1BR4 A;  2ZFJ A;  3BFN A;  1N6M A;  1FMV A;  4A28 A;  2WOG A;  3KIN A;  1LVK A;  2G1Q A;  1CZ7 A;  4BN2 A;  3CJO A;  4E7S A;  3PXN A;  4Y05 A;  2Q2Z A;  4A50 A;  3NWN A;  2ZFM A;  3KAR A;  3ZFC A;  2Q2Y A;  1D1A A;  1MNE A;  2ZFI A;  3DCB A;  5LT3 A;  4DBQ A;  3DC4 A;  2FL6 A;  4PJN A;  4ETP A;  5HLE A;  4A5Y A;  4AS7 A;  2NCD A;  4E7Z A;  3B6V A;  1BG2 A;  4GKR A;  2VB6 A;  3HQD A;  4A1Z A;  2X2R A;  1F9U A;  4PJJ A;  1D1B A;  2Y5W A;  1SDM A;  3B6U A;  2X51 A;  4UBF A;  3T0Q A;  1T5C A;  1X88 A;  4BXN A;  2OWM A;  1F9V A;  5LT0 A;  2FL2 A;  1GOJ A;  2KIN A;  2MYS A;  1D0Z A;  5LT1 A;  1F9W A;  2X7D A;  3ZFD A;  2GM1 A;  1VOM A;  1MMG A;  2XAE A;  4AP0 A;  1VFV A;  3ZCW A;  2PG2 A;  4HNA K;  1D1C A;  4B7B A;  2X7C A;  1I6I A;  1KK7 A;  1LKX A;  1RY6 A;  2VAS A;  2ZFK A;  4PFP A;  3WPN A;  4PJM A;  1Q0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...