3X2TA

Crystal structure of the kif5c motor domain with adp
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
331
structure length
311
Chain Sequence
PAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKNKSLSALGNVISALAEGTKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin heavy chain isoform 5C
publication title X-ray and Cryo-EM structures reveal mutual conformational changes of Kinesin and GTP-state microtubules upon binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Motor protein
total genus 87
structure length 311
sequence length 331
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3x2tA00
1KK7A 1YRSA 3WPNA 1BG2A 4LNUK 1X88A 2UYIA 5GSZA 2Y65A 2FL2A 1SDMA 3GBJA 3K3BA 5LT4A 3ZFCA 2FL6A 4PJLA 4A28A 1VFVA 2VB6A 3CNZA 5LT0A 2V26A 2HEHA 3HQDA 5LT2A 1D1CA 4Y05A 1LVKA 1MMNA 4GKRA 4BN2A 1V8KA 3NWNA 2Q2ZA 1VFXA 2OWMA 1MMAA 3U06A 4DBRA 3B6UA 2NCDA 2UYMA 1VFWA 2ZFIA 1I5SA 1V8JA 4ANJA 2XAEA 2WOGA 4PK4A 1VFZA 3KENA 1GOJA 4UBFA 4A14A 1FMWA 4PJMA 2Q2YA 2ZFLA 2X7DA 2PG2A 3ZCWA 2FKYA 1MNEA 4H1GA 2X7CA 4BXNA 1I6IA 3KINA 2G1QA 4FRZA 2Y5WA 1BR4A 1F9WA 5LT1A 1D0ZA 4BBGA 4E7ZA 2GM1A 1Q0BA 4E7SA 4AP0A 3LREA 1BR1A 4A1ZA 2X2RA 2MYSA 1D0XA 3PXNA 3CJOA 2X51A 3KARA 4PJJA 2KINA 1D0YA 1II6A 4HNAK 4ZHIA 1F9UA 1D1AA 1FMVA 2GRYA 1LKXA 3WRDA 4AS7A 1CZ7A 3X2TA 2ZFKA 3T0QA 4ETPA 4A5YA 4A50A 2VASA 1MMGA 2IEHA 2ZFMA 1F9VA 2XT3A 3K5EA 3L9HA 2X7EA 1T5CA 1N6MA 4PJNA 1D1BA 4PFOA 2FMEA 4PFPA 4B7BA 3L1CA 2VVGA 2ZFJA 3DC4A 3H4SA 4DBQA 1VOMA 4A51A 1BR2A 4ZCAA 1G8XA 3B6VA 5LT3A 1RY6A 1MMDA 5HLEA 1F9TA 3BFNA 3ZFDA 3DCBA 3COBA 1MKJA
chains in the Genus database with same CATH superfamily
1KK7A 1YRSA 2O0AA 3WPNA 1BG2A 4LNUK 1X88A 2UYIA 5GSZA 2Y65A 2FL2A 1SDMA 3GBJA 3K3BA 5LT4A 3ZFCA 2FL6A 4PJLA 4A28A 1VFVA 2VB6A 3CNZA 5LT0A 2V26A 2HEHA 3HQDA 5LT2A 1D1CA 4Y05A 1LVKA 1MMNA 4GKRA 4BN2A 4GKQA 1V8KA 3NWNA 2Q2ZA 1VFXA 2OWMA 1MMAA 3U06A 4DBRA 3B6UA 2NCDA 2UYMA 1VFWA 2ZFIA 1I5SA 1V8JA 4ANJA 2XAEA 2WOGA 4PK4A 1VFZA 3KENA 1GOJA 4UBFA 4A14A 1FMWA 4PJMA 2Q2YA 2ZFLA 4ETPB 2X7DA 2PG2A 3ZCWA 2FKYA 1MNEA 4H1GA 2X7CA 4BXNA 1I6IA 3KINA 2G1QA 4FRZA 2Y5WA 1BR4A 1F9WA 5LT1A 1D0ZA 4BBGA 4E7ZA 4GKPA 2GM1A 1Q0BA 4E7SA 4AP0A 3LREA 1BR1A 4A1ZA 2X2RA 2MYSA 1D0XA 3PXNA 3CJOA 2X51A 3KARA 4PJJA 2KINA 1D0YA 1II6A 4HNAK 4ZHIA 1F9UA 1D1AA 1FMVA 2GRYA 1LKXA 3WRDA 4AS7A 1CZ7A 3X2TA 2ZFKA 3T0QA 4ETPA 4A5YA 4A50A 2VASA 1MMGA 2IEHA 2ZFMA 1F9VA 2XT3A 3K5EA 3L9HA 2X7EA 1T5CA 1N6MA 4PJNA 1D1BA 4PFOA 2FMEA 4PFPA 4B7BA 3L1CA 2VVGA 2ZFJA 3DC4A 3H4SA 4DBQA 1VOMA 4A51A 1BR2A 4ZCAA 1G8XA 3B6VA 5LT3A 1RY6A 1MMDA 5HLEA 1F9TA 3BFNA 3ZFDA 3DCBA 3COBA 1MKJA
chains in the Genus database with same CATH topology
1KK7A 1YRSA 3WPNA 1BG2A 4LNUK 1X88A 2UYIA 5GSZA 2Y65A 2FL2A 1SDMA 3GBJA 3K3BA 5LT4A 3ZFCA 2FL6A 4PJLA 4A28A 1VFVA 2VB6A 3CNZA 5LT0A 2V26A 2HEHA 3HQDA 5LT2A 1D1CA 4Y05A 1LVKA 1MMNA 4GKRA 4BN2A 1V8KA 3NWNA 2Q2ZA 1VFXA 2OWMA 1MMAA 3U06A 4DBRA 3B6UA 2NCDA 2UYMA 1VFWA 2ZFIA 1I5SA 1V8JA 4ANJA 2XAEA 2WOGA 4PK4A 1VFZA 3KENA 1GOJA 4UBFA 4A14A 1FMWA 4PJMA 2Q2YA 2ZFLA 2X7DA 2PG2A 3ZCWA 2FKYA 1MNEA 4H1GA 2X7CA 4BXNA 1I6IA 3KINA 2G1QA 4FRZA 2Y5WA 1BR4A 1F9WA 5LT1A 1D0ZA 4BBGA 4E7ZA 2GM1A 1Q0BA 4E7SA 4AP0A 3LREA 1BR1A 4A1ZA 2X2RA 2MYSA 1D0XA 3PXNA 3CJOA 2X51A 3KARA 4PJJA 2KINA 1D0YA 1II6A 4HNAK 4ZHIA 1F9UA 1D1AA 1FMVA 2GRYA 1LKXA 3WRDA 4AS7A 1CZ7A 3X2TA 2ZFKA 3T0QA 4ETPA 4A5YA 4A50A 2VASA 1MMGA 2IEHA 2ZFMA 1F9VA 2XT3A 3K5EA 3L9HA 2X7EA 1T5CA 1N6MA 4PJNA 1D1BA 4PFOA 2FMEA 4PFPA 4B7BA 3L1CA 2VVGA 2ZFJA 3DC4A 3H4SA 4DBQA 1VOMA 4A51A 1BR2A 4ZCAA 1G8XA 3B6VA 5LT3A 1RY6A 1MMDA 5HLEA 1F9TA 3BFNA 3ZFDA 3DCBA 3COBA 1MKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KK7 A;  1YRS A;  3WPN A;  1BG2 A;  4LNU K;  1X88 A;  2UYI A;  5GSZ A;  2Y65 A;  2FL2 A;  1SDM A;  3GBJ A;  3K3B A;  5LT4 A;  3ZFC A;  2FL6 A;  4PJL A;  4A28 A;  1VFV A;  2VB6 A;  3CNZ A;  5LT0 A;  2V26 A;  2HEH A;  3HQD A;  5LT2 A;  1D1C A;  4Y05 A;  1LVK A;  1MMN A;  4GKR A;  4BN2 A;  1V8K A;  3NWN A;  2Q2Z A;  1VFX A;  2OWM A;  1MMA A;  3U06 A;  4DBR A;  3B6U A;  2NCD A;  2UYM A;  1VFW A;  2ZFI A;  1I5S A;  1V8J A;  4ANJ A;  2XAE A;  2WOG A;  4PK4 A;  1VFZ A;  3KEN A;  1GOJ A;  4UBF A;  4A14 A;  1FMW A;  4PJM A;  2Q2Y A;  2ZFL A;  2X7D A;  2PG2 A;  3ZCW A;  2FKY A;  1MNE A;  4H1G A;  2X7C A;  4BXN A;  1I6I A;  3KIN A;  2G1Q A;  4FRZ A;  2Y5W A;  1BR4 A;  1F9W A;  5LT1 A;  1D0Z A;  4BBG A;  4E7Z A;  2GM1 A;  1Q0B A;  4E7S A;  4AP0 A;  3LRE A;  1BR1 A;  4A1Z A;  2X2R A;  2MYS A;  1D0X A;  3PXN A;  3CJO A;  2X51 A;  3KAR A;  4PJJ A;  2KIN A;  1D0Y A;  1II6 A;  4HNA K;  4ZHI A;  1F9U A;  1D1A A;  1FMV A;  2GRY A;  1LKX A;  3WRD A;  4AS7 A;  1CZ7 A;  3X2T A;  2ZFK A;  3T0Q A;  4ETP A;  4A5Y A;  4A50 A;  2VAS A;  1MMG A;  2IEH A;  2ZFM A;  1F9V A;  2XT3 A;  3K5E A;  3L9H A;  2X7E A;  1T5C A;  1N6M A;  4PJN A;  1D1B A;  4PFO A;  2FME A;  4PFP A;  4B7B A;  3L1C A;  2VVG A;  2ZFJ A;  3DC4 A;  3H4S A;  4DBQ A;  1VOM A;  4A51 A;  1BR2 A;  4ZCA A;  1G8X A;  3B6V A;  5LT3 A;  1RY6 A;  1MMD A;  5HLE A;  1F9T A;  3BFN A;  3ZFD A;  3DCB A;  3COB A;  1MKJ A; 
#chains in the Genus database with same CATH topology
 1KK7 A;  1YRS A;  2O0A A;  3WPN A;  1BG2 A;  4LNU K;  1X88 A;  2UYI A;  5GSZ A;  2Y65 A;  2FL2 A;  1SDM A;  3GBJ A;  3K3B A;  5LT4 A;  3ZFC A;  2FL6 A;  4PJL A;  4A28 A;  1VFV A;  2VB6 A;  3CNZ A;  5LT0 A;  2V26 A;  2HEH A;  3HQD A;  5LT2 A;  1D1C A;  4Y05 A;  1LVK A;  1MMN A;  4GKR A;  4BN2 A;  4GKQ A;  1V8K A;  3NWN A;  2Q2Z A;  1VFX A;  2OWM A;  1MMA A;  3U06 A;  4DBR A;  3B6U A;  2NCD A;  2UYM A;  1VFW A;  2ZFI A;  1I5S A;  1V8J A;  4ANJ A;  2XAE A;  2WOG A;  4PK4 A;  1VFZ A;  3KEN A;  1GOJ A;  4UBF A;  4A14 A;  1FMW A;  4PJM A;  2Q2Y A;  2ZFL A;  4ETP B;  2X7D A;  2PG2 A;  3ZCW A;  2FKY A;  1MNE A;  4H1G A;  2X7C A;  4BXN A;  1I6I A;  3KIN A;  2G1Q A;  4FRZ A;  2Y5W A;  1BR4 A;  1F9W A;  5LT1 A;  1D0Z A;  4BBG A;  4E7Z A;  4GKP A;  2GM1 A;  1Q0B A;  4E7S A;  4AP0 A;  3LRE A;  1BR1 A;  4A1Z A;  2X2R A;  2MYS A;  1D0X A;  3PXN A;  3CJO A;  2X51 A;  3KAR A;  4PJJ A;  2KIN A;  1D0Y A;  1II6 A;  4HNA K;  4ZHI A;  1F9U A;  1D1A A;  1FMV A;  2GRY A;  1LKX A;  3WRD A;  4AS7 A;  1CZ7 A;  3X2T A;  2ZFK A;  3T0Q A;  4ETP A;  4A5Y A;  4A50 A;  2VAS A;  1MMG A;  2IEH A;  2ZFM A;  1F9V A;  2XT3 A;  3K5E A;  3L9H A;  2X7E A;  1T5C A;  1N6M A;  4PJN A;  1D1B A;  4PFO A;  2FME A;  4PFP A;  4B7B A;  3L1C A;  2VVG A;  2ZFJ A;  3DC4 A;  3H4S A;  4DBQ A;  1VOM A;  4A51 A;  1BR2 A;  4ZCA A;  1G8X A;  3B6V A;  5LT3 A;  1RY6 A;  1MMD A;  5HLE A;  1F9T A;  3BFN A;  3ZFD A;  3DCB A;  3COB A;  1MKJ A; 
#chains in the Genus database with same CATH homology
 1KK7 A;  1YRS A;  3WPN A;  1BG2 A;  4LNU K;  1X88 A;  2UYI A;  5GSZ A;  2Y65 A;  2FL2 A;  1SDM A;  3GBJ A;  3K3B A;  5LT4 A;  3ZFC A;  2FL6 A;  4PJL A;  4A28 A;  1VFV A;  2VB6 A;  3CNZ A;  5LT0 A;  2V26 A;  2HEH A;  3HQD A;  5LT2 A;  1D1C A;  4Y05 A;  1LVK A;  1MMN A;  4GKR A;  4BN2 A;  1V8K A;  3NWN A;  2Q2Z A;  1VFX A;  2OWM A;  1MMA A;  3U06 A;  4DBR A;  3B6U A;  2NCD A;  2UYM A;  1VFW A;  2ZFI A;  1I5S A;  1V8J A;  4ANJ A;  2XAE A;  2WOG A;  4PK4 A;  1VFZ A;  3KEN A;  1GOJ A;  4UBF A;  4A14 A;  1FMW A;  4PJM A;  2Q2Y A;  2ZFL A;  2X7D A;  2PG2 A;  3ZCW A;  2FKY A;  1MNE A;  4H1G A;  2X7C A;  4BXN A;  1I6I A;  3KIN A;  2G1Q A;  4FRZ A;  2Y5W A;  1BR4 A;  1F9W A;  5LT1 A;  1D0Z A;  4BBG A;  4E7Z A;  2GM1 A;  1Q0B A;  4E7S A;  4AP0 A;  3LRE A;  1BR1 A;  4A1Z A;  2X2R A;  2MYS A;  1D0X A;  3PXN A;  3CJO A;  2X51 A;  3KAR A;  4PJJ A;  2KIN A;  1D0Y A;  1II6 A;  4HNA K;  4ZHI A;  1F9U A;  1D1A A;  1FMV A;  2GRY A;  1LKX A;  3WRD A;  4AS7 A;  1CZ7 A;  3X2T A;  2ZFK A;  3T0Q A;  4ETP A;  4A5Y A;  4A50 A;  2VAS A;  1MMG A;  2IEH A;  2ZFM A;  1F9V A;  2XT3 A;  3K5E A;  3L9H A;  2X7E A;  1T5C A;  1N6M A;  4PJN A;  1D1B A;  4PFO A;  2FME A;  4PFP A;  4B7B A;  3L1C A;  2VVG A;  2ZFJ A;  3DC4 A;  3H4S A;  4DBQ A;  1VOM A;  4A51 A;  1BR2 A;  4ZCA A;  1G8X A;  3B6V A;  5LT3 A;  1RY6 A;  1MMD A;  5HLE A;  1F9T A;  3BFN A;  3ZFD A;  3DCB A;  3COB A;  1MKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...