5HLEA

Structural basis of backwards motion in kinesin-14: minus-end directed nkn664 in the adp state
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
321
structure length
303
Chain Sequence
NTVMDLRGNIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFAIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKSNRHVAEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKVKNINKSLSALGNVISALAEGTTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein claret segregational,Minus-end kinesin-1/kinesin-14,
publication title Backwards motion in kinesin-14 requires neck-mimic to control a neck-helix swing.
rcsb
source organism Drosophila melanogaster
molecule tags Hydrolase
total genus 83
structure length 303
sequence length 321
ec nomenclature
pdb deposition date 2016-01-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 5hleA00
2PG2A 4FRZA 4PK4A 3H4SA 1F9WA 1MKJA 1SDMA 3CNZA 2FKYA 4H1GA 2Q2YA 1MMDA 4E7ZA 4A28A 3COBA 3ZCWA 3DC4A 2ZFMA 2V26A 3NWNA 2FMEA 5LT4A 2GRYA 5LT0A 4ZHIA 3K5EA 2VASA 1KK7A 2KINA 2Q2ZA 2UYMA 3HQDA 3GBJA 2XT3A 1I6IA 1MMGA 2X2RA 1D0XA 3B6VA 1Q0BA 4UBFA 4GKRA 3WRDA 4LNUK 1BR1A 2WOGA 1D1CA 2X7EA 4ANJA 5GSZA 2ZFJA 3LREA 1V8KA 4PFPA 5LT2A 3ZFCA 4PJLA 1F9UA 3CJOA 2XAEA 2UYIA 3L1CA 3ZFDA 4B7BA 4ETPA 1V8JA 1YRSA 1VFZA 3X2TA 1G8XA 1CZ7A 3B6UA 1MMNA 4AP0A 5LT1A 2NCDA 3L9HA 2G1QA 1T5CA 1D0ZA 2VB6A 2Y65A 1BR2A 1FMVA 2X7CA 3KARA 5HLEA 1VOMA 2X7DA 1LKXA 1LVKA 4A50A 2ZFLA 3KINA 4A5YA 4DBRA 1VFWA 2X51A 1GOJA 4A51A 2MYSA 3WPNA 1VFVA 1MMAA 4Y05A 1D1AA 4PJJA 3BFNA 4BN2A 4BXNA 4BBGA 2HEHA 4ZCAA 2ZFIA 4E7SA 5LT3A 3U06A 3PXNA 2IEHA 1D0YA 3K3BA 4PJMA 2VVGA 1MNEA 2FL2A 1F9VA 1BR4A 1I5SA 4PJNA 2GM1A 2ZFKA 3DCBA 1N6MA 3T0QA 4HNAK 2OWMA 2Y5WA 4PFOA 3KENA 1FMWA 1X88A 4AS7A 4A14A 4DBQA 1RY6A 1BG2A 4A1ZA 1F9TA 2FL6A 1D1BA 1II6A 1VFXA
chains in the Genus database with same CATH superfamily
2PG2A 4FRZA 4PK4A 3H4SA 1F9WA 1MKJA 1SDMA 3CNZA 2FKYA 4H1GA 2Q2YA 1MMDA 4E7ZA 4A28A 3COBA 3ZCWA 3DC4A 2ZFMA 2V26A 3NWNA 2FMEA 5LT4A 2GRYA 5LT0A 4ZHIA 3K5EA 2VASA 1KK7A 2KINA 2Q2ZA 2UYMA 3HQDA 3GBJA 2XT3A 1I6IA 1MMGA 2X2RA 1D0XA 3B6VA 1Q0BA 4UBFA 4GKRA 3WRDA 4LNUK 1BR1A 2WOGA 1D1CA 2X7EA 4ANJA 5GSZA 2ZFJA 3LREA 1V8KA 4PFPA 5LT2A 3ZFCA 4PJLA 2O0AA 1F9UA 3CJOA 2XAEA 2UYIA 3L1CA 3ZFDA 4B7BA 4ETPA 4GKPA 1V8JA 1YRSA 4ETPB 1VFZA 3X2TA 1G8XA 1CZ7A 3B6UA 1MMNA 4AP0A 5LT1A 2NCDA 3L9HA 2G1QA 1T5CA 1D0ZA 2VB6A 2Y65A 1BR2A 1FMVA 2X7CA 3KARA 5HLEA 1VOMA 2X7DA 1LKXA 1LVKA 4A50A 2ZFLA 3KINA 4A5YA 4DBRA 1VFWA 2X51A 4GKQA 1GOJA 4A51A 2MYSA 3WPNA 1VFVA 1MMAA 4Y05A 1D1AA 4PJJA 3BFNA 4BN2A 4BXNA 4BBGA 2HEHA 4ZCAA 2ZFIA 4E7SA 5LT3A 3U06A 3PXNA 2IEHA 1D0YA 3K3BA 4PJMA 2VVGA 1MNEA 2FL2A 1F9VA 1BR4A 1I5SA 4PJNA 2GM1A 2ZFKA 3DCBA 1N6MA 3T0QA 4HNAK 2OWMA 2Y5WA 4PFOA 3KENA 1FMWA 1X88A 4AS7A 4A14A 4DBQA 1RY6A 1BG2A 4A1ZA 1F9TA 2FL6A 1D1BA 1II6A 1VFXA
chains in the Genus database with same CATH topology
2PG2A 4FRZA 4PK4A 3H4SA 1F9WA 1MKJA 1SDMA 3CNZA 2FKYA 4H1GA 2Q2YA 1MMDA 4E7ZA 4A28A 3COBA 3ZCWA 3DC4A 2ZFMA 2V26A 3NWNA 2FMEA 5LT4A 2GRYA 5LT0A 4ZHIA 3K5EA 2VASA 1KK7A 2KINA 2Q2ZA 2UYMA 3HQDA 3GBJA 2XT3A 1I6IA 1MMGA 2X2RA 1D0XA 3B6VA 1Q0BA 4UBFA 4GKRA 3WRDA 4LNUK 1BR1A 2WOGA 1D1CA 2X7EA 4ANJA 5GSZA 2ZFJA 3LREA 1V8KA 4PFPA 5LT2A 3ZFCA 4PJLA 1F9UA 3CJOA 2XAEA 2UYIA 3L1CA 3ZFDA 4B7BA 4ETPA 1V8JA 1YRSA 1VFZA 3X2TA 1G8XA 1CZ7A 3B6UA 1MMNA 4AP0A 5LT1A 2NCDA 3L9HA 2G1QA 1T5CA 1D0ZA 2VB6A 2Y65A 1BR2A 1FMVA 2X7CA 3KARA 5HLEA 1VOMA 2X7DA 1LKXA 1LVKA 4A50A 2ZFLA 3KINA 4A5YA 4DBRA 1VFWA 2X51A 1GOJA 4A51A 2MYSA 3WPNA 1VFVA 1MMAA 4Y05A 1D1AA 4PJJA 3BFNA 4BN2A 4BXNA 4BBGA 2HEHA 4ZCAA 2ZFIA 4E7SA 5LT3A 3U06A 3PXNA 2IEHA 1D0YA 3K3BA 4PJMA 2VVGA 1MNEA 2FL2A 1F9VA 1BR4A 1I5SA 4PJNA 2GM1A 2ZFKA 3DCBA 1N6MA 3T0QA 4HNAK 2OWMA 2Y5WA 4PFOA 3KENA 1FMWA 1X88A 4AS7A 4A14A 4DBQA 1RY6A 1BG2A 4A1ZA 1F9TA 2FL6A 1D1BA 1II6A 1VFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PG2 A;  4FRZ A;  4PK4 A;  3H4S A;  1F9W A;  1MKJ A;  1SDM A;  3CNZ A;  2FKY A;  4H1G A;  2Q2Y A;  1MMD A;  4E7Z A;  4A28 A;  3COB A;  3ZCW A;  3DC4 A;  2ZFM A;  2V26 A;  3NWN A;  2FME A;  5LT4 A;  2GRY A;  5LT0 A;  4ZHI A;  3K5E A;  2VAS A;  1KK7 A;  2KIN A;  2Q2Z A;  2UYM A;  3HQD A;  3GBJ A;  2XT3 A;  1I6I A;  1MMG A;  2X2R A;  1D0X A;  3B6V A;  1Q0B A;  4UBF A;  4GKR A;  3WRD A;  4LNU K;  1BR1 A;  2WOG A;  1D1C A;  2X7E A;  4ANJ A;  5GSZ A;  2ZFJ A;  3LRE A;  1V8K A;  4PFP A;  5LT2 A;  3ZFC A;  4PJL A;  1F9U A;  3CJO A;  2XAE A;  2UYI A;  3L1C A;  3ZFD A;  4B7B A;  4ETP A;  1V8J A;  1YRS A;  1VFZ A;  3X2T A;  1G8X A;  1CZ7 A;  3B6U A;  1MMN A;  4AP0 A;  5LT1 A;  2NCD A;  3L9H A;  2G1Q A;  1T5C A;  1D0Z A;  2VB6 A;  2Y65 A;  1BR2 A;  1FMV A;  2X7C A;  3KAR A;  5HLE A;  1VOM A;  2X7D A;  1LKX A;  1LVK A;  4A50 A;  2ZFL A;  3KIN A;  4A5Y A;  4DBR A;  1VFW A;  2X51 A;  1GOJ A;  4A51 A;  2MYS A;  3WPN A;  1VFV A;  1MMA A;  4Y05 A;  1D1A A;  4PJJ A;  3BFN A;  4BN2 A;  4BXN A;  4BBG A;  2HEH A;  4ZCA A;  2ZFI A;  4E7S A;  5LT3 A;  3U06 A;  3PXN A;  2IEH A;  1D0Y A;  3K3B A;  4PJM A;  2VVG A;  1MNE A;  2FL2 A;  1F9V A;  1BR4 A;  1I5S A;  4PJN A;  2GM1 A;  2ZFK A;  3DCB A;  1N6M A;  3T0Q A;  4HNA K;  2OWM A;  2Y5W A;  4PFO A;  3KEN A;  1FMW A;  1X88 A;  4AS7 A;  4A14 A;  4DBQ A;  1RY6 A;  1BG2 A;  4A1Z A;  1F9T A;  2FL6 A;  1D1B A;  1II6 A;  1VFX A; 
#chains in the Genus database with same CATH topology
 2PG2 A;  4FRZ A;  4PK4 A;  3H4S A;  1F9W A;  1MKJ A;  1SDM A;  3CNZ A;  2FKY A;  4H1G A;  2Q2Y A;  1MMD A;  4E7Z A;  4A28 A;  3COB A;  3ZCW A;  3DC4 A;  2ZFM A;  2V26 A;  3NWN A;  2FME A;  5LT4 A;  2GRY A;  5LT0 A;  4ZHI A;  3K5E A;  2VAS A;  1KK7 A;  2KIN A;  2Q2Z A;  2UYM A;  3HQD A;  3GBJ A;  2XT3 A;  1I6I A;  1MMG A;  2X2R A;  1D0X A;  3B6V A;  1Q0B A;  4UBF A;  4GKR A;  3WRD A;  4LNU K;  1BR1 A;  2WOG A;  1D1C A;  2X7E A;  4ANJ A;  5GSZ A;  2ZFJ A;  3LRE A;  1V8K A;  4PFP A;  5LT2 A;  3ZFC A;  4PJL A;  2O0A A;  1F9U A;  3CJO A;  2XAE A;  2UYI A;  3L1C A;  3ZFD A;  4B7B A;  4ETP A;  4GKP A;  1V8J A;  1YRS A;  4ETP B;  1VFZ A;  3X2T A;  1G8X A;  1CZ7 A;  3B6U A;  1MMN A;  4AP0 A;  5LT1 A;  2NCD A;  3L9H A;  2G1Q A;  1T5C A;  1D0Z A;  2VB6 A;  2Y65 A;  1BR2 A;  1FMV A;  2X7C A;  3KAR A;  5HLE A;  1VOM A;  2X7D A;  1LKX A;  1LVK A;  4A50 A;  2ZFL A;  3KIN A;  4A5Y A;  4DBR A;  1VFW A;  2X51 A;  4GKQ A;  1GOJ A;  4A51 A;  2MYS A;  3WPN A;  1VFV A;  1MMA A;  4Y05 A;  1D1A A;  4PJJ A;  3BFN A;  4BN2 A;  4BXN A;  4BBG A;  2HEH A;  4ZCA A;  2ZFI A;  4E7S A;  5LT3 A;  3U06 A;  3PXN A;  2IEH A;  1D0Y A;  3K3B A;  4PJM A;  2VVG A;  1MNE A;  2FL2 A;  1F9V A;  1BR4 A;  1I5S A;  4PJN A;  2GM1 A;  2ZFK A;  3DCB A;  1N6M A;  3T0Q A;  4HNA K;  2OWM A;  2Y5W A;  4PFO A;  3KEN A;  1FMW A;  1X88 A;  4AS7 A;  4A14 A;  4DBQ A;  1RY6 A;  1BG2 A;  4A1Z A;  1F9T A;  2FL6 A;  1D1B A;  1II6 A;  1VFX A; 
#chains in the Genus database with same CATH homology
 2PG2 A;  4FRZ A;  4PK4 A;  3H4S A;  1F9W A;  1MKJ A;  1SDM A;  3CNZ A;  2FKY A;  4H1G A;  2Q2Y A;  1MMD A;  4E7Z A;  4A28 A;  3COB A;  3ZCW A;  3DC4 A;  2ZFM A;  2V26 A;  3NWN A;  2FME A;  5LT4 A;  2GRY A;  5LT0 A;  4ZHI A;  3K5E A;  2VAS A;  1KK7 A;  2KIN A;  2Q2Z A;  2UYM A;  3HQD A;  3GBJ A;  2XT3 A;  1I6I A;  1MMG A;  2X2R A;  1D0X A;  3B6V A;  1Q0B A;  4UBF A;  4GKR A;  3WRD A;  4LNU K;  1BR1 A;  2WOG A;  1D1C A;  2X7E A;  4ANJ A;  5GSZ A;  2ZFJ A;  3LRE A;  1V8K A;  4PFP A;  5LT2 A;  3ZFC A;  4PJL A;  1F9U A;  3CJO A;  2XAE A;  2UYI A;  3L1C A;  3ZFD A;  4B7B A;  4ETP A;  1V8J A;  1YRS A;  1VFZ A;  3X2T A;  1G8X A;  1CZ7 A;  3B6U A;  1MMN A;  4AP0 A;  5LT1 A;  2NCD A;  3L9H A;  2G1Q A;  1T5C A;  1D0Z A;  2VB6 A;  2Y65 A;  1BR2 A;  1FMV A;  2X7C A;  3KAR A;  5HLE A;  1VOM A;  2X7D A;  1LKX A;  1LVK A;  4A50 A;  2ZFL A;  3KIN A;  4A5Y A;  4DBR A;  1VFW A;  2X51 A;  1GOJ A;  4A51 A;  2MYS A;  3WPN A;  1VFV A;  1MMA A;  4Y05 A;  1D1A A;  4PJJ A;  3BFN A;  4BN2 A;  4BXN A;  4BBG A;  2HEH A;  4ZCA A;  2ZFI A;  4E7S A;  5LT3 A;  3U06 A;  3PXN A;  2IEH A;  1D0Y A;  3K3B A;  4PJM A;  2VVG A;  1MNE A;  2FL2 A;  1F9V A;  1BR4 A;  1I5S A;  4PJN A;  2GM1 A;  2ZFK A;  3DCB A;  1N6M A;  3T0Q A;  4HNA K;  2OWM A;  2Y5W A;  4PFO A;  3KEN A;  1FMW A;  1X88 A;  4AS7 A;  4A14 A;  4DBQ A;  1RY6 A;  1BG2 A;  4A1Z A;  1F9T A;  2FL6 A;  1D1B A;  1II6 A;  1VFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...