3DC4A

Crystal structure of the drosophila kinesin family member nod in complex with adp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
321
structure length
291
Chain Sequence
AKLSAVRIAVREAPYRPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADLHHILELGTRNRRSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKAAALEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein Nod
publication title ATPase cycle of the nonmotile kinesin NOD allows microtubule end tracking and drives chromosome movement.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Motor protein
total genus 94
structure length 291
sequence length 321
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3dc4A00
2XAEA 1F9VA 3ZFDA 3K5EA 4ZCAA 2ZFIA 4PJNA 4E7ZA 1V8KA 1CZ7A 2GRYA 1VOMA 4LNUK 1FMVA 2V26A 3LREA 5LT0A 4BN2A 2X7EA 2FMEA 1MKJA 2UYMA 4PJLA 4ETPA 3KINA 3ZFCA 1BR1A 4PJJA 1F9WA 4DBRA 2Y65A 1I6IA 4A1ZA 1T5CA 2FL6A 4A5YA 1II6A 3U06A 1MNEA 2WOGA 4PFOA 5HLEA 3L9HA 2XT3A 2PG2A 1BG2A 2X7CA 3KARA 4PFPA 3ZCWA 1MMNA 2VASA 5LT4A 1MMAA 1VFXA 1D1AA 2NCDA 2GM1A 1G8XA 3B6UA 3NWNA 3CNZA 1N6MA 1D0YA 3B6VA 4UBFA 2VVGA 1GOJA 3X2TA 2X2RA 2Y5WA 1D0XA 2ZFKA 3HQDA 3CJOA 4AP0A 4H1GA 5GSZA 1D1CA 1VFVA 4A28A 1BR2A 1LKXA 3H4SA 2ZFLA 2Q2YA 2ZFJA 2G1QA 4PK4A 2X51A 2KINA 1MMDA 4BBGA 2FL2A 2IEHA 4Y05A 1VFZA 4AS7A 4B7BA 2FKYA 1F9TA 4E7SA 2X7DA 1D1BA 1V8JA 4GKRA 4ZHIA 3K3BA 2MYSA 4A50A 1FMWA 3WRDA 1F9UA 1I5SA 1D0ZA 3DC4A 1X88A 2HEHA 1MMGA 3DCBA 3WPNA 5LT2A 4A14A 3COBA 2Q2ZA 3T0QA 1KK7A 1LVKA 2UYIA 4PJMA 1YRSA 3PXNA 3GBJA 4BXNA 5LT3A 2OWMA 4DBQA 4ANJA 2VB6A 1VFWA 4A51A 1RY6A 4FRZA 3L1CA 1BR4A 4HNAK 3BFNA 1SDMA 2ZFMA 3KENA 5LT1A 1Q0BA
chains in the Genus database with same CATH superfamily
2XAEA 1F9VA 3ZFDA 3K5EA 4ZCAA 2ZFIA 4PJNA 4E7ZA 1V8KA 1CZ7A 2GRYA 1VOMA 4LNUK 1FMVA 2V26A 3LREA 5LT0A 4BN2A 2X7EA 2FMEA 4GKPA 1MKJA 2UYMA 4PJLA 4ETPA 3KINA 3ZFCA 1BR1A 4PJJA 1F9WA 4DBRA 2Y65A 1I6IA 4A1ZA 1T5CA 2FL6A 4A5YA 1II6A 3U06A 1MNEA 2WOGA 4PFOA 5HLEA 3L9HA 2XT3A 2PG2A 1BG2A 2X7CA 3KARA 4PFPA 3ZCWA 1MMNA 2VASA 5LT4A 1MMAA 4ETPB 1VFXA 1D1AA 2NCDA 2GM1A 1G8XA 3B6UA 3NWNA 3CNZA 1N6MA 1D0YA 3B6VA 4UBFA 2VVGA 1GOJA 3X2TA 2X2RA 2Y5WA 1D0XA 2ZFKA 2O0AA 3HQDA 3CJOA 4AP0A 4H1GA 5GSZA 1D1CA 1VFVA 4A28A 1BR2A 1LKXA 3H4SA 2ZFLA 2Q2YA 2ZFJA 2G1QA 4PK4A 2X51A 2KINA 1MMDA 4BBGA 2FL2A 2IEHA 4Y05A 1VFZA 4AS7A 4B7BA 2FKYA 1F9TA 4E7SA 2X7DA 1D1BA 1V8JA 4GKRA 4ZHIA 3K3BA 2MYSA 4A50A 1FMWA 3WRDA 1F9UA 1I5SA 1D0ZA 3DC4A 1X88A 2HEHA 1MMGA 3DCBA 3WPNA 5LT2A 4A14A 3COBA 2Q2ZA 3T0QA 1KK7A 1LVKA 2UYIA 4PJMA 1YRSA 3PXNA 3GBJA 4BXNA 5LT3A 2OWMA 4DBQA 4ANJA 2VB6A 1VFWA 4A51A 1RY6A 4FRZA 3L1CA 1BR4A 4HNAK 3BFNA 1SDMA 2ZFMA 3KENA 4GKQA 5LT1A 1Q0BA
chains in the Genus database with same CATH topology
2XAEA 1F9VA 3ZFDA 3K5EA 4ZCAA 2ZFIA 4PJNA 4E7ZA 1V8KA 1CZ7A 2GRYA 1VOMA 4LNUK 1FMVA 2V26A 3LREA 5LT0A 4BN2A 2X7EA 2FMEA 1MKJA 2UYMA 4PJLA 4ETPA 3KINA 3ZFCA 1BR1A 4PJJA 1F9WA 4DBRA 2Y65A 1I6IA 4A1ZA 1T5CA 2FL6A 4A5YA 1II6A 3U06A 1MNEA 2WOGA 4PFOA 5HLEA 3L9HA 2XT3A 2PG2A 1BG2A 2X7CA 3KARA 4PFPA 3ZCWA 1MMNA 2VASA 5LT4A 1MMAA 1VFXA 1D1AA 2NCDA 2GM1A 1G8XA 3B6UA 3NWNA 3CNZA 1N6MA 1D0YA 3B6VA 4UBFA 2VVGA 1GOJA 3X2TA 2X2RA 2Y5WA 1D0XA 2ZFKA 3HQDA 3CJOA 4AP0A 4H1GA 5GSZA 1D1CA 1VFVA 4A28A 1BR2A 1LKXA 3H4SA 2ZFLA 2Q2YA 2ZFJA 2G1QA 4PK4A 2X51A 2KINA 1MMDA 4BBGA 2FL2A 2IEHA 4Y05A 1VFZA 4AS7A 4B7BA 2FKYA 1F9TA 4E7SA 2X7DA 1D1BA 1V8JA 4GKRA 4ZHIA 3K3BA 2MYSA 4A50A 1FMWA 3WRDA 1F9UA 1I5SA 1D0ZA 3DC4A 1X88A 2HEHA 1MMGA 3DCBA 3WPNA 5LT2A 4A14A 3COBA 2Q2ZA 3T0QA 1KK7A 1LVKA 2UYIA 4PJMA 1YRSA 3PXNA 3GBJA 4BXNA 5LT3A 2OWMA 4DBQA 4ANJA 2VB6A 1VFWA 4A51A 1RY6A 4FRZA 3L1CA 1BR4A 4HNAK 3BFNA 1SDMA 2ZFMA 3KENA 5LT1A 1Q0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAE A;  1F9V A;  3ZFD A;  3K5E A;  4ZCA A;  2ZFI A;  4PJN A;  4E7Z A;  1V8K A;  1CZ7 A;  2GRY A;  1VOM A;  4LNU K;  1FMV A;  2V26 A;  3LRE A;  5LT0 A;  4BN2 A;  2X7E A;  2FME A;  1MKJ A;  2UYM A;  4PJL A;  4ETP A;  3KIN A;  3ZFC A;  1BR1 A;  4PJJ A;  1F9W A;  4DBR A;  2Y65 A;  1I6I A;  4A1Z A;  1T5C A;  2FL6 A;  4A5Y A;  1II6 A;  3U06 A;  1MNE A;  2WOG A;  4PFO A;  5HLE A;  3L9H A;  2XT3 A;  2PG2 A;  1BG2 A;  2X7C A;  3KAR A;  4PFP A;  3ZCW A;  1MMN A;  2VAS A;  5LT4 A;  1MMA A;  1VFX A;  1D1A A;  2NCD A;  2GM1 A;  1G8X A;  3B6U A;  3NWN A;  3CNZ A;  1N6M A;  1D0Y A;  3B6V A;  4UBF A;  2VVG A;  1GOJ A;  3X2T A;  2X2R A;  2Y5W A;  1D0X A;  2ZFK A;  3HQD A;  3CJO A;  4AP0 A;  4H1G A;  5GSZ A;  1D1C A;  1VFV A;  4A28 A;  1BR2 A;  1LKX A;  3H4S A;  2ZFL A;  2Q2Y A;  2ZFJ A;  2G1Q A;  4PK4 A;  2X51 A;  2KIN A;  1MMD A;  4BBG A;  2FL2 A;  2IEH A;  4Y05 A;  1VFZ A;  4AS7 A;  4B7B A;  2FKY A;  1F9T A;  4E7S A;  2X7D A;  1D1B A;  1V8J A;  4GKR A;  4ZHI A;  3K3B A;  2MYS A;  4A50 A;  1FMW A;  3WRD A;  1F9U A;  1I5S A;  1D0Z A;  3DC4 A;  1X88 A;  2HEH A;  1MMG A;  3DCB A;  3WPN A;  5LT2 A;  4A14 A;  3COB A;  2Q2Z A;  3T0Q A;  1KK7 A;  1LVK A;  2UYI A;  4PJM A;  1YRS A;  3PXN A;  3GBJ A;  4BXN A;  5LT3 A;  2OWM A;  4DBQ A;  4ANJ A;  2VB6 A;  1VFW A;  4A51 A;  1RY6 A;  4FRZ A;  3L1C A;  1BR4 A;  4HNA K;  3BFN A;  1SDM A;  2ZFM A;  3KEN A;  5LT1 A;  1Q0B A; 
#chains in the Genus database with same CATH topology
 2XAE A;  1F9V A;  3ZFD A;  3K5E A;  4ZCA A;  2ZFI A;  4PJN A;  4E7Z A;  1V8K A;  1CZ7 A;  2GRY A;  1VOM A;  4LNU K;  1FMV A;  2V26 A;  3LRE A;  5LT0 A;  4BN2 A;  2X7E A;  2FME A;  4GKP A;  1MKJ A;  2UYM A;  4PJL A;  4ETP A;  3KIN A;  3ZFC A;  1BR1 A;  4PJJ A;  1F9W A;  4DBR A;  2Y65 A;  1I6I A;  4A1Z A;  1T5C A;  2FL6 A;  4A5Y A;  1II6 A;  3U06 A;  1MNE A;  2WOG A;  4PFO A;  5HLE A;  3L9H A;  2XT3 A;  2PG2 A;  1BG2 A;  2X7C A;  3KAR A;  4PFP A;  3ZCW A;  1MMN A;  2VAS A;  5LT4 A;  1MMA A;  4ETP B;  1VFX A;  1D1A A;  2NCD A;  2GM1 A;  1G8X A;  3B6U A;  3NWN A;  3CNZ A;  1N6M A;  1D0Y A;  3B6V A;  4UBF A;  2VVG A;  1GOJ A;  3X2T A;  2X2R A;  2Y5W A;  1D0X A;  2ZFK A;  2O0A A;  3HQD A;  3CJO A;  4AP0 A;  4H1G A;  5GSZ A;  1D1C A;  1VFV A;  4A28 A;  1BR2 A;  1LKX A;  3H4S A;  2ZFL A;  2Q2Y A;  2ZFJ A;  2G1Q A;  4PK4 A;  2X51 A;  2KIN A;  1MMD A;  4BBG A;  2FL2 A;  2IEH A;  4Y05 A;  1VFZ A;  4AS7 A;  4B7B A;  2FKY A;  1F9T A;  4E7S A;  2X7D A;  1D1B A;  1V8J A;  4GKR A;  4ZHI A;  3K3B A;  2MYS A;  4A50 A;  1FMW A;  3WRD A;  1F9U A;  1I5S A;  1D0Z A;  3DC4 A;  1X88 A;  2HEH A;  1MMG A;  3DCB A;  3WPN A;  5LT2 A;  4A14 A;  3COB A;  2Q2Z A;  3T0Q A;  1KK7 A;  1LVK A;  2UYI A;  4PJM A;  1YRS A;  3PXN A;  3GBJ A;  4BXN A;  5LT3 A;  2OWM A;  4DBQ A;  4ANJ A;  2VB6 A;  1VFW A;  4A51 A;  1RY6 A;  4FRZ A;  3L1C A;  1BR4 A;  4HNA K;  3BFN A;  1SDM A;  2ZFM A;  3KEN A;  4GKQ A;  5LT1 A;  1Q0B A; 
#chains in the Genus database with same CATH homology
 2XAE A;  1F9V A;  3ZFD A;  3K5E A;  4ZCA A;  2ZFI A;  4PJN A;  4E7Z A;  1V8K A;  1CZ7 A;  2GRY A;  1VOM A;  4LNU K;  1FMV A;  2V26 A;  3LRE A;  5LT0 A;  4BN2 A;  2X7E A;  2FME A;  1MKJ A;  2UYM A;  4PJL A;  4ETP A;  3KIN A;  3ZFC A;  1BR1 A;  4PJJ A;  1F9W A;  4DBR A;  2Y65 A;  1I6I A;  4A1Z A;  1T5C A;  2FL6 A;  4A5Y A;  1II6 A;  3U06 A;  1MNE A;  2WOG A;  4PFO A;  5HLE A;  3L9H A;  2XT3 A;  2PG2 A;  1BG2 A;  2X7C A;  3KAR A;  4PFP A;  3ZCW A;  1MMN A;  2VAS A;  5LT4 A;  1MMA A;  1VFX A;  1D1A A;  2NCD A;  2GM1 A;  1G8X A;  3B6U A;  3NWN A;  3CNZ A;  1N6M A;  1D0Y A;  3B6V A;  4UBF A;  2VVG A;  1GOJ A;  3X2T A;  2X2R A;  2Y5W A;  1D0X A;  2ZFK A;  3HQD A;  3CJO A;  4AP0 A;  4H1G A;  5GSZ A;  1D1C A;  1VFV A;  4A28 A;  1BR2 A;  1LKX A;  3H4S A;  2ZFL A;  2Q2Y A;  2ZFJ A;  2G1Q A;  4PK4 A;  2X51 A;  2KIN A;  1MMD A;  4BBG A;  2FL2 A;  2IEH A;  4Y05 A;  1VFZ A;  4AS7 A;  4B7B A;  2FKY A;  1F9T A;  4E7S A;  2X7D A;  1D1B A;  1V8J A;  4GKR A;  4ZHI A;  3K3B A;  2MYS A;  4A50 A;  1FMW A;  3WRD A;  1F9U A;  1I5S A;  1D0Z A;  3DC4 A;  1X88 A;  2HEH A;  1MMG A;  3DCB A;  3WPN A;  5LT2 A;  4A14 A;  3COB A;  2Q2Z A;  3T0Q A;  1KK7 A;  1LVK A;  2UYI A;  4PJM A;  1YRS A;  3PXN A;  3GBJ A;  4BXN A;  5LT3 A;  2OWM A;  4DBQ A;  4ANJ A;  2VB6 A;  1VFW A;  4A51 A;  1RY6 A;  4FRZ A;  3L1C A;  1BR4 A;  4HNA K;  3BFN A;  1SDM A;  2ZFM A;  3KEN A;  5LT1 A;  1Q0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...