3DC4A

Crystal structure of the drosophila kinesin family member nod in complex with adp
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
321
structure length
291
Chain Sequence
b'AKLSAVRIAVREAPYRPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADLHHILELGTRNRRSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKAAALEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein Nod
publication title ATPase cycle of the nonmotile kinesin NOD allows microtubule end tracking and drives chromosome movement.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Motor protein
total genus 94
structure length 291
sequence length 321
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3dc4A00
1T5CA 2PG2A 3KARA 2NCDA 2X7CA 3WPNA 4BBGA 2ZFKA 3COBA 2MYSA 4HNAK 1D0YA 3L1CA 4ETPA 5LT1A 1D0XA 1V8KA 1II6A 1V8JA 1F9UA 4A51A 3BFNA 1YRSA 2VB6A 1CZ7A 1Q0BA 1FMVA 1MNEA 2Y65A 1G8XA 2Q2YA 1D0ZA 4A5YA 3NWNA 4UBFA 3ZFCA 3HQDA 4BN2A 3DCBA 2FKYA 1D1AA 3B6UA 2ZFLA 1MKJA 4PJMA 2X7DA 4E7ZA 2FL6A 3K3BA 3U06A 4GKRA 4PJLA 4FRZA 2V26A 1BG2A 3WRDA 1I5SA 2XAEA 1MMAA 5LT2A 1VFXA 2ZFIA 4LNUK 3B6VA 2FMEA 2VASA 4A28A 1RY6A 4A14A 3T0QA 1BR4A 4Y05A 4E7SA 1F9TA 1D1CA 2IEHA 1VFWA 5LT0A 2Y5WA 2OWMA 1F9VA 1MMDA 3L9HA 2FL2A 3CNZA 5LT4A 1MMNA 4BXNA 1LKXA 1X88A 1I6IA 2X51A 3X2TA 4AP0A 1GOJA 4PFPA 2WOGA 4AS7A 1VFVA 5GSZA 2KINA 2ZFMA 1KK7A 3H4SA 4ZCAA 1N6MA 4ZHIA 1FMWA 4ANJA 1SDMA 3GBJA 3DC4A 4DBRA 2GRYA 1BR1A 3KINA 4A1ZA 1LVKA 2G1QA 3K5EA 2HEHA 2Q2ZA 2UYIA 3KENA 3LREA 3PXNA 5HLEA 4PJNA 1VFZA 4A50A 4DBQA 2GM1A 2ZFJA 4PK4A 5LT3A 1VOMA 3ZFDA 1BR2A 1F9WA 2XT3A 3CJOA 2VVGA 2X7EA 4PJJA 4B7BA 3ZCWA 2X2RA 4H1GA 1MMGA 2UYMA 1D1BA 4PFOA
chains in the Genus database with same CATH superfamily
1T5CA 2PG2A 3KARA 2NCDA 2X7CA 3WPNA 4BBGA 2ZFKA 3COBA 2MYSA 4HNAK 1D0YA 3L1CA 4ETPA 5LT1A 1D0XA 1V8KA 1II6A 1V8JA 1F9UA 4A51A 3BFNA 1YRSA 2VB6A 1CZ7A 1Q0BA 1FMVA 1MNEA 2Y65A 1G8XA 2Q2YA 1D0ZA 4A5YA 3NWNA 4UBFA 3ZFCA 3HQDA 4BN2A 3DCBA 2FKYA 1D1AA 3B6UA 2ZFLA 1MKJA 4PJMA 2X7DA 4E7ZA 2FL6A 3K3BA 3U06A 4GKRA 4PJLA 4FRZA 2V26A 1BG2A 3WRDA 1I5SA 2XAEA 1MMAA 5LT2A 1VFXA 2ZFIA 4LNUK 3B6VA 4ETPB 2FMEA 2VASA 4A28A 1RY6A 4A14A 3T0QA 1BR4A 4Y05A 4E7SA 1F9TA 1D1CA 2IEHA 1VFWA 5LT0A 2Y5WA 2OWMA 1F9VA 1MMDA 3L9HA 2FL2A 3CNZA 5LT4A 1MMNA 4BXNA 1LKXA 1X88A 1I6IA 2X51A 3X2TA 4AP0A 1GOJA 4PFPA 2WOGA 4AS7A 1VFVA 5GSZA 2KINA 2ZFMA 1KK7A 3H4SA 4ZCAA 1N6MA 4ZHIA 1FMWA 4ANJA 1SDMA 3GBJA 3DC4A 4DBRA 2GRYA 1BR1A 3KINA 4A1ZA 1LVKA 2G1QA 3K5EA 2HEHA 2Q2ZA 2UYIA 3KENA 3LREA 3PXNA 5HLEA 4PJNA 1VFZA 4A50A 4DBQA 2GM1A 2ZFJA 4PK4A 5LT3A 4GKPA 1VOMA 3ZFDA 4GKQA 1BR2A 1F9WA 2XT3A 3CJOA 2VVGA 2X7EA 4PJJA 4B7BA 2O0AA 3ZCWA 2X2RA 4H1GA 1MMGA 2UYMA 1D1BA 4PFOA
chains in the Genus database with same CATH topology
1T5CA 2PG2A 3KARA 2NCDA 2X7CA 3WPNA 4BBGA 2ZFKA 3COBA 2MYSA 4HNAK 1D0YA 3L1CA 4ETPA 5LT1A 1D0XA 1V8KA 1II6A 1V8JA 1F9UA 4A51A 3BFNA 1YRSA 2VB6A 1CZ7A 1Q0BA 1FMVA 1MNEA 2Y65A 1G8XA 2Q2YA 1D0ZA 4A5YA 3NWNA 4UBFA 3ZFCA 3HQDA 4BN2A 3DCBA 2FKYA 1D1AA 3B6UA 2ZFLA 1MKJA 4PJMA 2X7DA 4E7ZA 2FL6A 3K3BA 3U06A 4GKRA 4PJLA 4FRZA 2V26A 1BG2A 3WRDA 1I5SA 2XAEA 1MMAA 5LT2A 1VFXA 2ZFIA 4LNUK 3B6VA 2FMEA 2VASA 4A28A 1RY6A 4A14A 3T0QA 1BR4A 4Y05A 4E7SA 1F9TA 1D1CA 2IEHA 1VFWA 5LT0A 2Y5WA 2OWMA 1F9VA 1MMDA 3L9HA 2FL2A 3CNZA 5LT4A 1MMNA 4BXNA 1LKXA 1X88A 1I6IA 2X51A 3X2TA 4AP0A 1GOJA 4PFPA 2WOGA 4AS7A 1VFVA 5GSZA 2KINA 2ZFMA 1KK7A 3H4SA 4ZCAA 1N6MA 4ZHIA 1FMWA 4ANJA 1SDMA 3GBJA 3DC4A 4DBRA 2GRYA 1BR1A 3KINA 4A1ZA 1LVKA 2G1QA 3K5EA 2HEHA 2Q2ZA 2UYIA 3KENA 3LREA 3PXNA 5HLEA 4PJNA 1VFZA 4A50A 4DBQA 2GM1A 2ZFJA 4PK4A 5LT3A 1VOMA 3ZFDA 1BR2A 1F9WA 2XT3A 3CJOA 2VVGA 2X7EA 4PJJA 4B7BA 3ZCWA 2X2RA 4H1GA 1MMGA 2UYMA 1D1BA 4PFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T5C A;  2PG2 A;  3KAR A;  2NCD A;  2X7C A;  3WPN A;  4BBG A;  2ZFK A;  3COB A;  2MYS A;  4HNA K;  1D0Y A;  3L1C A;  4ETP A;  5LT1 A;  1D0X A;  1V8K A;  1II6 A;  1V8J A;  1F9U A;  4A51 A;  3BFN A;  1YRS A;  2VB6 A;  1CZ7 A;  1Q0B A;  1FMV A;  1MNE A;  2Y65 A;  1G8X A;  2Q2Y A;  1D0Z A;  4A5Y A;  3NWN A;  4UBF A;  3ZFC A;  3HQD A;  4BN2 A;  3DCB A;  2FKY A;  1D1A A;  3B6U A;  2ZFL A;  1MKJ A;  4PJM A;  2X7D A;  4E7Z A;  2FL6 A;  3K3B A;  3U06 A;  4GKR A;  4PJL A;  4FRZ A;  2V26 A;  1BG2 A;  3WRD A;  1I5S A;  2XAE A;  1MMA A;  5LT2 A;  1VFX A;  2ZFI A;  4LNU K;  3B6V A;  2FME A;  2VAS A;  4A28 A;  1RY6 A;  4A14 A;  3T0Q A;  1BR4 A;  4Y05 A;  4E7S A;  1F9T A;  1D1C A;  2IEH A;  1VFW A;  5LT0 A;  2Y5W A;  2OWM A;  1F9V A;  1MMD A;  3L9H A;  2FL2 A;  3CNZ A;  5LT4 A;  1MMN A;  4BXN A;  1LKX A;  1X88 A;  1I6I A;  2X51 A;  3X2T A;  4AP0 A;  1GOJ A;  4PFP A;  2WOG A;  4AS7 A;  1VFV A;  5GSZ A;  2KIN A;  2ZFM A;  1KK7 A;  3H4S A;  4ZCA A;  1N6M A;  4ZHI A;  1FMW A;  4ANJ A;  1SDM A;  3GBJ A;  3DC4 A;  4DBR A;  2GRY A;  1BR1 A;  3KIN A;  4A1Z A;  1LVK A;  2G1Q A;  3K5E A;  2HEH A;  2Q2Z A;  2UYI A;  3KEN A;  3LRE A;  3PXN A;  5HLE A;  4PJN A;  1VFZ A;  4A50 A;  4DBQ A;  2GM1 A;  2ZFJ A;  4PK4 A;  5LT3 A;  1VOM A;  3ZFD A;  1BR2 A;  1F9W A;  2XT3 A;  3CJO A;  2VVG A;  2X7E A;  4PJJ A;  4B7B A;  3ZCW A;  2X2R A;  4H1G A;  1MMG A;  2UYM A;  1D1B A;  4PFO A; 
#chains in the Genus database with same CATH topology
 1T5C A;  2PG2 A;  3KAR A;  2NCD A;  2X7C A;  3WPN A;  4BBG A;  2ZFK A;  3COB A;  2MYS A;  4HNA K;  1D0Y A;  3L1C A;  4ETP A;  5LT1 A;  1D0X A;  1V8K A;  1II6 A;  1V8J A;  1F9U A;  4A51 A;  3BFN A;  1YRS A;  2VB6 A;  1CZ7 A;  1Q0B A;  1FMV A;  1MNE A;  2Y65 A;  1G8X A;  2Q2Y A;  1D0Z A;  4A5Y A;  3NWN A;  4UBF A;  3ZFC A;  3HQD A;  4BN2 A;  3DCB A;  2FKY A;  1D1A A;  3B6U A;  2ZFL A;  1MKJ A;  4PJM A;  2X7D A;  4E7Z A;  2FL6 A;  3K3B A;  3U06 A;  4GKR A;  4PJL A;  4FRZ A;  2V26 A;  1BG2 A;  3WRD A;  1I5S A;  2XAE A;  1MMA A;  5LT2 A;  1VFX A;  2ZFI A;  4LNU K;  3B6V A;  4ETP B;  2FME A;  2VAS A;  4A28 A;  1RY6 A;  4A14 A;  3T0Q A;  1BR4 A;  4Y05 A;  4E7S A;  1F9T A;  1D1C A;  2IEH A;  1VFW A;  5LT0 A;  2Y5W A;  2OWM A;  1F9V A;  1MMD A;  3L9H A;  2FL2 A;  3CNZ A;  5LT4 A;  1MMN A;  4BXN A;  1LKX A;  1X88 A;  1I6I A;  2X51 A;  3X2T A;  4AP0 A;  1GOJ A;  4PFP A;  2WOG A;  4AS7 A;  1VFV A;  5GSZ A;  2KIN A;  2ZFM A;  1KK7 A;  3H4S A;  4ZCA A;  1N6M A;  4ZHI A;  1FMW A;  4ANJ A;  1SDM A;  3GBJ A;  3DC4 A;  4DBR A;  2GRY A;  1BR1 A;  3KIN A;  4A1Z A;  1LVK A;  2G1Q A;  3K5E A;  2HEH A;  2Q2Z A;  2UYI A;  3KEN A;  3LRE A;  3PXN A;  5HLE A;  4PJN A;  1VFZ A;  4A50 A;  4DBQ A;  2GM1 A;  2ZFJ A;  4PK4 A;  5LT3 A;  4GKP A;  1VOM A;  3ZFD A;  4GKQ A;  1BR2 A;  1F9W A;  2XT3 A;  3CJO A;  2VVG A;  2X7E A;  4PJJ A;  4B7B A;  2O0A A;  3ZCW A;  2X2R A;  4H1G A;  1MMG A;  2UYM A;  1D1B A;  4PFO A; 
#chains in the Genus database with same CATH homology
 1T5C A;  2PG2 A;  3KAR A;  2NCD A;  2X7C A;  3WPN A;  4BBG A;  2ZFK A;  3COB A;  2MYS A;  4HNA K;  1D0Y A;  3L1C A;  4ETP A;  5LT1 A;  1D0X A;  1V8K A;  1II6 A;  1V8J A;  1F9U A;  4A51 A;  3BFN A;  1YRS A;  2VB6 A;  1CZ7 A;  1Q0B A;  1FMV A;  1MNE A;  2Y65 A;  1G8X A;  2Q2Y A;  1D0Z A;  4A5Y A;  3NWN A;  4UBF A;  3ZFC A;  3HQD A;  4BN2 A;  3DCB A;  2FKY A;  1D1A A;  3B6U A;  2ZFL A;  1MKJ A;  4PJM A;  2X7D A;  4E7Z A;  2FL6 A;  3K3B A;  3U06 A;  4GKR A;  4PJL A;  4FRZ A;  2V26 A;  1BG2 A;  3WRD A;  1I5S A;  2XAE A;  1MMA A;  5LT2 A;  1VFX A;  2ZFI A;  4LNU K;  3B6V A;  2FME A;  2VAS A;  4A28 A;  1RY6 A;  4A14 A;  3T0Q A;  1BR4 A;  4Y05 A;  4E7S A;  1F9T A;  1D1C A;  2IEH A;  1VFW A;  5LT0 A;  2Y5W A;  2OWM A;  1F9V A;  1MMD A;  3L9H A;  2FL2 A;  3CNZ A;  5LT4 A;  1MMN A;  4BXN A;  1LKX A;  1X88 A;  1I6I A;  2X51 A;  3X2T A;  4AP0 A;  1GOJ A;  4PFP A;  2WOG A;  4AS7 A;  1VFV A;  5GSZ A;  2KIN A;  2ZFM A;  1KK7 A;  3H4S A;  4ZCA A;  1N6M A;  4ZHI A;  1FMW A;  4ANJ A;  1SDM A;  3GBJ A;  3DC4 A;  4DBR A;  2GRY A;  1BR1 A;  3KIN A;  4A1Z A;  1LVK A;  2G1Q A;  3K5E A;  2HEH A;  2Q2Z A;  2UYI A;  3KEN A;  3LRE A;  3PXN A;  5HLE A;  4PJN A;  1VFZ A;  4A50 A;  4DBQ A;  2GM1 A;  2ZFJ A;  4PK4 A;  5LT3 A;  1VOM A;  3ZFD A;  1BR2 A;  1F9W A;  2XT3 A;  3CJO A;  2VVG A;  2X7E A;  4PJJ A;  4B7B A;  3ZCW A;  2X2R A;  4H1G A;  1MMG A;  2UYM A;  1D1B A;  4PFO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...