3WRDA

Crystal structure of the kif5c motor domain without any nucleotide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
330
structure length
310
Chain Sequence
AECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKKSLSALGNVISALAEKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin heavy chain isoform 5C
publication title X-ray and Cryo-EM structures reveal mutual conformational changes of Kinesin and GTP-state microtubules upon binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Motor protein
total genus 77
structure length 310
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3wrdA00
5LT2A 1F9WA 2IEHA 3COBA 2ZFKA 4A28A 1D1BA 5LT3A 4LNUK 1I6IA 4DBQA 2X7CA 1D1CA 2Y65A 1YRSA 1KK7A 1BR1A 2X2RA 3B6VA 3CJOA 3K5EA 4BXNA 3GBJA 4PFPA 4A14A 1RY6A 1F9VA 1FMWA 2V26A 1MMGA 4PJMA 4HNAK 2Y5WA 2WOGA 1G8XA 3X2TA 1VFXA 4ANJA 3L9HA 3NWNA 1F9UA 1BR4A 2HEHA 4A1ZA 1MNEA 4Y05A 3T0QA 1N6MA 4E7ZA 3ZCWA 1MMNA 5LT0A 2X7DA 4PK4A 4PJNA 1VFZA 2MYSA 3ZFCA 2XAEA 1D1AA 1VFVA 2FL6A 4AP0A 1D0YA 2UYIA 1Q0BA 2VASA 5LT4A 1II6A 1X88A 2ZFLA 3L1CA 1GOJA 3LREA 3DC4A 2Q2ZA 4GKRA 2KINA 1VOMA 1CZ7A 1V8JA 2X7EA 2XT3A 1FMVA 3KINA 2GRYA 2FL2A 1I5SA 4E7SA 1MMAA 3HQDA 3ZFDA 4PJLA 5HLEA 5GSZA 3B6UA 3H4SA 2UYMA 2VVGA 2GM1A 2OWMA 3BFNA 2NCDA 4AS7A 2Q2YA 3CNZA 1VFWA 2FMEA 3WPNA 1LKXA 3KARA 2PG2A 4A50A 3K3BA 1BG2A 4PJJA 2ZFJA 4ETPA 1F9TA 1T5CA 4DBRA 1D0ZA 4B7BA 1SDMA 4BBGA 2ZFIA 2FKYA 1MMDA 4ZCAA 4PFOA 3DCBA 4H1GA 4UBFA 3WRDA 4A51A 1LVKA 3PXNA 3U06A 1MKJA 5LT1A 4A5YA 1BR2A 2G1QA 4FRZA 1V8KA 4BN2A 1D0XA 4ZHIA 3KENA 2ZFMA 2VB6A 2X51A
chains in the Genus database with same CATH superfamily
5LT2A 4GKQA 1F9WA 2IEHA 3COBA 2ZFKA 4A28A 1D1BA 5LT3A 4LNUK 1I6IA 4DBQA 2X7CA 1D1CA 2Y65A 1YRSA 1KK7A 1BR1A 2X2RA 3B6VA 3CJOA 3K5EA 4BXNA 3GBJA 4PFPA 4A14A 1RY6A 1F9VA 1FMWA 2V26A 1MMGA 4PJMA 4HNAK 2Y5WA 2WOGA 1G8XA 3X2TA 1VFXA 4ANJA 3L9HA 3NWNA 1F9UA 4GKPA 1BR4A 2HEHA 4A1ZA 1MNEA 4Y05A 3T0QA 1N6MA 4E7ZA 3ZCWA 1MMNA 5LT0A 2X7DA 4PK4A 4PJNA 1VFZA 2MYSA 3ZFCA 2XAEA 1D1AA 1VFVA 2FL6A 4AP0A 1D0YA 2UYIA 1Q0BA 2VASA 5LT4A 1II6A 1X88A 2ZFLA 3L1CA 1GOJA 3LREA 3DC4A 2Q2ZA 4GKRA 2KINA 1VOMA 1CZ7A 1V8JA 2X7EA 2XT3A 2O0AA 1FMVA 3KINA 2GRYA 2FL2A 1I5SA 4E7SA 1MMAA 3HQDA 3ZFDA 4PJLA 5HLEA 5GSZA 3B6UA 3H4SA 2UYMA 2VVGA 2GM1A 2OWMA 3BFNA 2NCDA 4AS7A 2Q2YA 3CNZA 1VFWA 2FMEA 3WPNA 1LKXA 3KARA 2PG2A 4A50A 3K3BA 1BG2A 4PJJA 2ZFJA 4ETPA 1F9TA 1T5CA 4DBRA 1D0ZA 4B7BA 1SDMA 4BBGA 2ZFIA 2FKYA 1MMDA 4ZCAA 4PFOA 3DCBA 4H1GA 4UBFA 4ETPB 3WRDA 4A51A 1LVKA 3PXNA 3U06A 1MKJA 5LT1A 4A5YA 1BR2A 2G1QA 4FRZA 1V8KA 4BN2A 1D0XA 4ZHIA 3KENA 2ZFMA 2VB6A 2X51A
chains in the Genus database with same CATH topology
5LT2A 1F9WA 2IEHA 3COBA 2ZFKA 4A28A 1D1BA 5LT3A 4LNUK 1I6IA 4DBQA 2X7CA 1D1CA 2Y65A 1YRSA 1KK7A 1BR1A 2X2RA 3B6VA 3CJOA 3K5EA 4BXNA 3GBJA 4PFPA 4A14A 1RY6A 1F9VA 1FMWA 2V26A 1MMGA 4PJMA 4HNAK 2Y5WA 2WOGA 1G8XA 3X2TA 1VFXA 4ANJA 3L9HA 3NWNA 1F9UA 1BR4A 2HEHA 4A1ZA 1MNEA 4Y05A 3T0QA 1N6MA 4E7ZA 3ZCWA 1MMNA 5LT0A 2X7DA 4PK4A 4PJNA 1VFZA 2MYSA 3ZFCA 2XAEA 1D1AA 1VFVA 2FL6A 4AP0A 1D0YA 2UYIA 1Q0BA 2VASA 5LT4A 1II6A 1X88A 2ZFLA 3L1CA 1GOJA 3LREA 3DC4A 2Q2ZA 4GKRA 2KINA 1VOMA 1CZ7A 1V8JA 2X7EA 2XT3A 1FMVA 3KINA 2GRYA 2FL2A 1I5SA 4E7SA 1MMAA 3HQDA 3ZFDA 4PJLA 5HLEA 5GSZA 3B6UA 3H4SA 2UYMA 2VVGA 2GM1A 2OWMA 3BFNA 2NCDA 4AS7A 2Q2YA 3CNZA 1VFWA 2FMEA 3WPNA 1LKXA 3KARA 2PG2A 4A50A 3K3BA 1BG2A 4PJJA 2ZFJA 4ETPA 1F9TA 1T5CA 4DBRA 1D0ZA 4B7BA 1SDMA 4BBGA 2ZFIA 2FKYA 1MMDA 4ZCAA 4PFOA 3DCBA 4H1GA 4UBFA 3WRDA 4A51A 1LVKA 3PXNA 3U06A 1MKJA 5LT1A 4A5YA 1BR2A 2G1QA 4FRZA 1V8KA 4BN2A 1D0XA 4ZHIA 3KENA 2ZFMA 2VB6A 2X51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LT2 A;  1F9W A;  2IEH A;  3COB A;  2ZFK A;  4A28 A;  1D1B A;  5LT3 A;  4LNU K;  1I6I A;  4DBQ A;  2X7C A;  1D1C A;  2Y65 A;  1YRS A;  1KK7 A;  1BR1 A;  2X2R A;  3B6V A;  3CJO A;  3K5E A;  4BXN A;  3GBJ A;  4PFP A;  4A14 A;  1RY6 A;  1F9V A;  1FMW A;  2V26 A;  1MMG A;  4PJM A;  4HNA K;  2Y5W A;  2WOG A;  1G8X A;  3X2T A;  1VFX A;  4ANJ A;  3L9H A;  3NWN A;  1F9U A;  1BR4 A;  2HEH A;  4A1Z A;  1MNE A;  4Y05 A;  3T0Q A;  1N6M A;  4E7Z A;  3ZCW A;  1MMN A;  5LT0 A;  2X7D A;  4PK4 A;  4PJN A;  1VFZ A;  2MYS A;  3ZFC A;  2XAE A;  1D1A A;  1VFV A;  2FL6 A;  4AP0 A;  1D0Y A;  2UYI A;  1Q0B A;  2VAS A;  5LT4 A;  1II6 A;  1X88 A;  2ZFL A;  3L1C A;  1GOJ A;  3LRE A;  3DC4 A;  2Q2Z A;  4GKR A;  2KIN A;  1VOM A;  1CZ7 A;  1V8J A;  2X7E A;  2XT3 A;  1FMV A;  3KIN A;  2GRY A;  2FL2 A;  1I5S A;  4E7S A;  1MMA A;  3HQD A;  3ZFD A;  4PJL A;  5HLE A;  5GSZ A;  3B6U A;  3H4S A;  2UYM A;  2VVG A;  2GM1 A;  2OWM A;  3BFN A;  2NCD A;  4AS7 A;  2Q2Y A;  3CNZ A;  1VFW A;  2FME A;  3WPN A;  1LKX A;  3KAR A;  2PG2 A;  4A50 A;  3K3B A;  1BG2 A;  4PJJ A;  2ZFJ A;  4ETP A;  1F9T A;  1T5C A;  4DBR A;  1D0Z A;  4B7B A;  1SDM A;  4BBG A;  2ZFI A;  2FKY A;  1MMD A;  4ZCA A;  4PFO A;  3DCB A;  4H1G A;  4UBF A;  3WRD A;  4A51 A;  1LVK A;  3PXN A;  3U06 A;  1MKJ A;  5LT1 A;  4A5Y A;  1BR2 A;  2G1Q A;  4FRZ A;  1V8K A;  4BN2 A;  1D0X A;  4ZHI A;  3KEN A;  2ZFM A;  2VB6 A;  2X51 A; 
#chains in the Genus database with same CATH topology
 5LT2 A;  4GKQ A;  1F9W A;  2IEH A;  3COB A;  2ZFK A;  4A28 A;  1D1B A;  5LT3 A;  4LNU K;  1I6I A;  4DBQ A;  2X7C A;  1D1C A;  2Y65 A;  1YRS A;  1KK7 A;  1BR1 A;  2X2R A;  3B6V A;  3CJO A;  3K5E A;  4BXN A;  3GBJ A;  4PFP A;  4A14 A;  1RY6 A;  1F9V A;  1FMW A;  2V26 A;  1MMG A;  4PJM A;  4HNA K;  2Y5W A;  2WOG A;  1G8X A;  3X2T A;  1VFX A;  4ANJ A;  3L9H A;  3NWN A;  1F9U A;  4GKP A;  1BR4 A;  2HEH A;  4A1Z A;  1MNE A;  4Y05 A;  3T0Q A;  1N6M A;  4E7Z A;  3ZCW A;  1MMN A;  5LT0 A;  2X7D A;  4PK4 A;  4PJN A;  1VFZ A;  2MYS A;  3ZFC A;  2XAE A;  1D1A A;  1VFV A;  2FL6 A;  4AP0 A;  1D0Y A;  2UYI A;  1Q0B A;  2VAS A;  5LT4 A;  1II6 A;  1X88 A;  2ZFL A;  3L1C A;  1GOJ A;  3LRE A;  3DC4 A;  2Q2Z A;  4GKR A;  2KIN A;  1VOM A;  1CZ7 A;  1V8J A;  2X7E A;  2XT3 A;  2O0A A;  1FMV A;  3KIN A;  2GRY A;  2FL2 A;  1I5S A;  4E7S A;  1MMA A;  3HQD A;  3ZFD A;  4PJL A;  5HLE A;  5GSZ A;  3B6U A;  3H4S A;  2UYM A;  2VVG A;  2GM1 A;  2OWM A;  3BFN A;  2NCD A;  4AS7 A;  2Q2Y A;  3CNZ A;  1VFW A;  2FME A;  3WPN A;  1LKX A;  3KAR A;  2PG2 A;  4A50 A;  3K3B A;  1BG2 A;  4PJJ A;  2ZFJ A;  4ETP A;  1F9T A;  1T5C A;  4DBR A;  1D0Z A;  4B7B A;  1SDM A;  4BBG A;  2ZFI A;  2FKY A;  1MMD A;  4ZCA A;  4PFO A;  3DCB A;  4H1G A;  4UBF A;  4ETP B;  3WRD A;  4A51 A;  1LVK A;  3PXN A;  3U06 A;  1MKJ A;  5LT1 A;  4A5Y A;  1BR2 A;  2G1Q A;  4FRZ A;  1V8K A;  4BN2 A;  1D0X A;  4ZHI A;  3KEN A;  2ZFM A;  2VB6 A;  2X51 A; 
#chains in the Genus database with same CATH homology
 5LT2 A;  1F9W A;  2IEH A;  3COB A;  2ZFK A;  4A28 A;  1D1B A;  5LT3 A;  4LNU K;  1I6I A;  4DBQ A;  2X7C A;  1D1C A;  2Y65 A;  1YRS A;  1KK7 A;  1BR1 A;  2X2R A;  3B6V A;  3CJO A;  3K5E A;  4BXN A;  3GBJ A;  4PFP A;  4A14 A;  1RY6 A;  1F9V A;  1FMW A;  2V26 A;  1MMG A;  4PJM A;  4HNA K;  2Y5W A;  2WOG A;  1G8X A;  3X2T A;  1VFX A;  4ANJ A;  3L9H A;  3NWN A;  1F9U A;  1BR4 A;  2HEH A;  4A1Z A;  1MNE A;  4Y05 A;  3T0Q A;  1N6M A;  4E7Z A;  3ZCW A;  1MMN A;  5LT0 A;  2X7D A;  4PK4 A;  4PJN A;  1VFZ A;  2MYS A;  3ZFC A;  2XAE A;  1D1A A;  1VFV A;  2FL6 A;  4AP0 A;  1D0Y A;  2UYI A;  1Q0B A;  2VAS A;  5LT4 A;  1II6 A;  1X88 A;  2ZFL A;  3L1C A;  1GOJ A;  3LRE A;  3DC4 A;  2Q2Z A;  4GKR A;  2KIN A;  1VOM A;  1CZ7 A;  1V8J A;  2X7E A;  2XT3 A;  1FMV A;  3KIN A;  2GRY A;  2FL2 A;  1I5S A;  4E7S A;  1MMA A;  3HQD A;  3ZFD A;  4PJL A;  5HLE A;  5GSZ A;  3B6U A;  3H4S A;  2UYM A;  2VVG A;  2GM1 A;  2OWM A;  3BFN A;  2NCD A;  4AS7 A;  2Q2Y A;  3CNZ A;  1VFW A;  2FME A;  3WPN A;  1LKX A;  3KAR A;  2PG2 A;  4A50 A;  3K3B A;  1BG2 A;  4PJJ A;  2ZFJ A;  4ETP A;  1F9T A;  1T5C A;  4DBR A;  1D0Z A;  4B7B A;  1SDM A;  4BBG A;  2ZFI A;  2FKY A;  1MMD A;  4ZCA A;  4PFO A;  3DCB A;  4H1G A;  4UBF A;  3WRD A;  4A51 A;  1LVK A;  3PXN A;  3U06 A;  1MKJ A;  5LT1 A;  4A5Y A;  1BR2 A;  2G1Q A;  4FRZ A;  1V8K A;  4BN2 A;  1D0X A;  4ZHI A;  3KEN A;  2ZFM A;  2VB6 A;  2X51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...