3WRDA

Crystal structure of the kif5c motor domain without any nucleotide
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
330
structure length
310
Chain Sequence
b'AECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKKSLSALGNVISALAEKTHVPYRDSKMTRILQDSLGGNCRTTIVICCSPSVFNEAETKSTLMFGQRAKTIKNTVSVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin heavy chain isoform 5C
publication title X-ray and Cryo-EM structures reveal mutual conformational changes of Kinesin and GTP-state microtubules upon binding
pubmed doi rcsb
source organism Mus musculus
molecule tags Motor protein
total genus 77
structure length 310
sequence length 330
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3wrdA00
1MMDA 4FRZA 4GKRA 1BR1A 2WOGA 4ANJA 3CNZA 4A51A 1RY6A 4PFPA 4DBQA 4BBGA 4A5YA 1FMVA 2Y5WA 4PJJA 1D0XA 2X7CA 4UBFA 5LT3A 1VFVA 1F9TA 2UYMA 1VFXA 2XAEA 3KINA 2XT3A 3LREA 3X2TA 1F9WA 4A14A 1V8KA 1G8XA 2KINA 3ZCWA 4Y05A 5LT1A 2UYIA 3COBA 1MMAA 4DBRA 1T5CA 2ZFKA 4LNUK 1MNEA 5LT4A 1D1AA 4PJLA 3DCBA 2NCDA 4AP0A 1I5SA 2GRYA 1D1CA 1N6MA 3K5EA 3HQDA 5LT0A 5HLEA 4PK4A 3GBJA 2MYSA 2X2RA 1SDMA 3B6VA 2VB6A 4BXNA 4E7ZA 4AS7A 3U06A 1V8JA 1MKJA 2OWMA 1BR2A 1F9UA 2X7EA 2ZFLA 3PXNA 4BN2A 3B6UA 2FL6A 2ZFMA 1LKXA 3H4SA 1F9VA 1YRSA 3WPNA 2VASA 3ZFCA 1GOJA 3KENA 1VFWA 3CJOA 3BFNA 4A28A 1D1BA 5GSZA 1VOMA 4HNAK 3T0QA 4ZCAA 3WRDA 1CZ7A 3K3BA 2IEHA 4B7BA 2VVGA 4ETPA 3L9HA 1VFZA 1D0ZA 4PJMA 3DC4A 1Q0BA 4A1ZA 4PFOA 2X7DA 4A50A 3KARA 5LT2A 3ZFDA 2HEHA 2PG2A 2FKYA 1II6A 1D0YA 4E7SA 2FMEA 3NWNA 4PJNA 2Q2ZA 2V26A 2GM1A 1FMWA 3L1CA 1MMGA 2Y65A 4H1GA 4ZHIA 2FL2A 2ZFIA 2G1QA 1X88A 1MMNA 1I6IA 1KK7A 1LVKA 2Q2YA 1BG2A 2X51A 2ZFJA 1BR4A
chains in the Genus database with same CATH superfamily
1MMDA 4FRZA 4GKRA 1BR1A 2WOGA 4ANJA 3CNZA 4A51A 1RY6A 4PFPA 4DBQA 4BBGA 4A5YA 1FMVA 2Y5WA 4PJJA 1D0XA 2X7CA 4UBFA 5LT3A 1VFVA 1F9TA 2UYMA 1VFXA 2XAEA 3KINA 4GKQA 2XT3A 3LREA 3X2TA 1F9WA 4A14A 1V8KA 1G8XA 2KINA 3ZCWA 4Y05A 5LT1A 2O0AA 2UYIA 3COBA 1MMAA 4DBRA 1T5CA 2ZFKA 4LNUK 1MNEA 5LT4A 1D1AA 4PJLA 3DCBA 2NCDA 4AP0A 1I5SA 2GRYA 1D1CA 1N6MA 3K5EA 3HQDA 5LT0A 5HLEA 4PK4A 3GBJA 2MYSA 2X2RA 1SDMA 3B6VA 2VB6A 4BXNA 4E7ZA 4AS7A 3U06A 1V8JA 1MKJA 2OWMA 1BR2A 1F9UA 2X7EA 2ZFLA 3PXNA 4BN2A 3B6UA 2FL6A 2ZFMA 1LKXA 3H4SA 1F9VA 1YRSA 3WPNA 2VASA 3ZFCA 1GOJA 3KENA 1VFWA 3CJOA 3BFNA 4A28A 1D1BA 5GSZA 1VOMA 4HNAK 3T0QA 4ZCAA 3WRDA 1CZ7A 4GKPA 3K3BA 2IEHA 4B7BA 2VVGA 4ETPA 3L9HA 1VFZA 1D0ZA 4PJMA 3DC4A 1Q0BA 4A1ZA 4PFOA 2X7DA 4A50A 3KARA 4ETPB 5LT2A 3ZFDA 2HEHA 2PG2A 2FKYA 1II6A 1D0YA 4E7SA 2FMEA 3NWNA 4PJNA 2Q2ZA 2V26A 2GM1A 1FMWA 3L1CA 1MMGA 2Y65A 4H1GA 4ZHIA 2FL2A 2ZFIA 2G1QA 1X88A 1MMNA 1I6IA 1KK7A 1LVKA 2Q2YA 1BG2A 2X51A 2ZFJA 1BR4A
chains in the Genus database with same CATH topology
1MMDA 4FRZA 4GKRA 1BR1A 2WOGA 4ANJA 3CNZA 4A51A 1RY6A 4PFPA 4DBQA 4BBGA 4A5YA 1FMVA 2Y5WA 4PJJA 1D0XA 2X7CA 4UBFA 5LT3A 1VFVA 1F9TA 2UYMA 1VFXA 2XAEA 3KINA 2XT3A 3LREA 3X2TA 1F9WA 4A14A 1V8KA 1G8XA 2KINA 3ZCWA 4Y05A 5LT1A 2UYIA 3COBA 1MMAA 4DBRA 1T5CA 2ZFKA 4LNUK 1MNEA 5LT4A 1D1AA 4PJLA 3DCBA 2NCDA 4AP0A 1I5SA 2GRYA 1D1CA 1N6MA 3K5EA 3HQDA 5LT0A 5HLEA 4PK4A 3GBJA 2MYSA 2X2RA 1SDMA 3B6VA 2VB6A 4BXNA 4E7ZA 4AS7A 3U06A 1V8JA 1MKJA 2OWMA 1BR2A 1F9UA 2X7EA 2ZFLA 3PXNA 4BN2A 3B6UA 2FL6A 2ZFMA 1LKXA 3H4SA 1F9VA 1YRSA 3WPNA 2VASA 3ZFCA 1GOJA 3KENA 1VFWA 3CJOA 3BFNA 4A28A 1D1BA 5GSZA 1VOMA 4HNAK 3T0QA 4ZCAA 3WRDA 1CZ7A 3K3BA 2IEHA 4B7BA 2VVGA 4ETPA 3L9HA 1VFZA 1D0ZA 4PJMA 3DC4A 1Q0BA 4A1ZA 4PFOA 2X7DA 4A50A 3KARA 5LT2A 3ZFDA 2HEHA 2PG2A 2FKYA 1II6A 1D0YA 4E7SA 2FMEA 3NWNA 4PJNA 2Q2ZA 2V26A 2GM1A 1FMWA 3L1CA 1MMGA 2Y65A 4H1GA 4ZHIA 2FL2A 2ZFIA 2G1QA 1X88A 1MMNA 1I6IA 1KK7A 1LVKA 2Q2YA 1BG2A 2X51A 2ZFJA 1BR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMD A;  4FRZ A;  4GKR A;  1BR1 A;  2WOG A;  4ANJ A;  3CNZ A;  4A51 A;  1RY6 A;  4PFP A;  4DBQ A;  4BBG A;  4A5Y A;  1FMV A;  2Y5W A;  4PJJ A;  1D0X A;  2X7C A;  4UBF A;  5LT3 A;  1VFV A;  1F9T A;  2UYM A;  1VFX A;  2XAE A;  3KIN A;  2XT3 A;  3LRE A;  3X2T A;  1F9W A;  4A14 A;  1V8K A;  1G8X A;  2KIN A;  3ZCW A;  4Y05 A;  5LT1 A;  2UYI A;  3COB A;  1MMA A;  4DBR A;  1T5C A;  2ZFK A;  4LNU K;  1MNE A;  5LT4 A;  1D1A A;  4PJL A;  3DCB A;  2NCD A;  4AP0 A;  1I5S A;  2GRY A;  1D1C A;  1N6M A;  3K5E A;  3HQD A;  5LT0 A;  5HLE A;  4PK4 A;  3GBJ A;  2MYS A;  2X2R A;  1SDM A;  3B6V A;  2VB6 A;  4BXN A;  4E7Z A;  4AS7 A;  3U06 A;  1V8J A;  1MKJ A;  2OWM A;  1BR2 A;  1F9U A;  2X7E A;  2ZFL A;  3PXN A;  4BN2 A;  3B6U A;  2FL6 A;  2ZFM A;  1LKX A;  3H4S A;  1F9V A;  1YRS A;  3WPN A;  2VAS A;  3ZFC A;  1GOJ A;  3KEN A;  1VFW A;  3CJO A;  3BFN A;  4A28 A;  1D1B A;  5GSZ A;  1VOM A;  4HNA K;  3T0Q A;  4ZCA A;  3WRD A;  1CZ7 A;  3K3B A;  2IEH A;  4B7B A;  2VVG A;  4ETP A;  3L9H A;  1VFZ A;  1D0Z A;  4PJM A;  3DC4 A;  1Q0B A;  4A1Z A;  4PFO A;  2X7D A;  4A50 A;  3KAR A;  5LT2 A;  3ZFD A;  2HEH A;  2PG2 A;  2FKY A;  1II6 A;  1D0Y A;  4E7S A;  2FME A;  3NWN A;  4PJN A;  2Q2Z A;  2V26 A;  2GM1 A;  1FMW A;  3L1C A;  1MMG A;  2Y65 A;  4H1G A;  4ZHI A;  2FL2 A;  2ZFI A;  2G1Q A;  1X88 A;  1MMN A;  1I6I A;  1KK7 A;  1LVK A;  2Q2Y A;  1BG2 A;  2X51 A;  2ZFJ A;  1BR4 A; 
#chains in the Genus database with same CATH topology
 1MMD A;  4FRZ A;  4GKR A;  1BR1 A;  2WOG A;  4ANJ A;  3CNZ A;  4A51 A;  1RY6 A;  4PFP A;  4DBQ A;  4BBG A;  4A5Y A;  1FMV A;  2Y5W A;  4PJJ A;  1D0X A;  2X7C A;  4UBF A;  5LT3 A;  1VFV A;  1F9T A;  2UYM A;  1VFX A;  2XAE A;  3KIN A;  4GKQ A;  2XT3 A;  3LRE A;  3X2T A;  1F9W A;  4A14 A;  1V8K A;  1G8X A;  2KIN A;  3ZCW A;  4Y05 A;  5LT1 A;  2O0A A;  2UYI A;  3COB A;  1MMA A;  4DBR A;  1T5C A;  2ZFK A;  4LNU K;  1MNE A;  5LT4 A;  1D1A A;  4PJL A;  3DCB A;  2NCD A;  4AP0 A;  1I5S A;  2GRY A;  1D1C A;  1N6M A;  3K5E A;  3HQD A;  5LT0 A;  5HLE A;  4PK4 A;  3GBJ A;  2MYS A;  2X2R A;  1SDM A;  3B6V A;  2VB6 A;  4BXN A;  4E7Z A;  4AS7 A;  3U06 A;  1V8J A;  1MKJ A;  2OWM A;  1BR2 A;  1F9U A;  2X7E A;  2ZFL A;  3PXN A;  4BN2 A;  3B6U A;  2FL6 A;  2ZFM A;  1LKX A;  3H4S A;  1F9V A;  1YRS A;  3WPN A;  2VAS A;  3ZFC A;  1GOJ A;  3KEN A;  1VFW A;  3CJO A;  3BFN A;  4A28 A;  1D1B A;  5GSZ A;  1VOM A;  4HNA K;  3T0Q A;  4ZCA A;  3WRD A;  1CZ7 A;  4GKP A;  3K3B A;  2IEH A;  4B7B A;  2VVG A;  4ETP A;  3L9H A;  1VFZ A;  1D0Z A;  4PJM A;  3DC4 A;  1Q0B A;  4A1Z A;  4PFO A;  2X7D A;  4A50 A;  3KAR A;  4ETP B;  5LT2 A;  3ZFD A;  2HEH A;  2PG2 A;  2FKY A;  1II6 A;  1D0Y A;  4E7S A;  2FME A;  3NWN A;  4PJN A;  2Q2Z A;  2V26 A;  2GM1 A;  1FMW A;  3L1C A;  1MMG A;  2Y65 A;  4H1G A;  4ZHI A;  2FL2 A;  2ZFI A;  2G1Q A;  1X88 A;  1MMN A;  1I6I A;  1KK7 A;  1LVK A;  2Q2Y A;  1BG2 A;  2X51 A;  2ZFJ A;  1BR4 A; 
#chains in the Genus database with same CATH homology
 1MMD A;  4FRZ A;  4GKR A;  1BR1 A;  2WOG A;  4ANJ A;  3CNZ A;  4A51 A;  1RY6 A;  4PFP A;  4DBQ A;  4BBG A;  4A5Y A;  1FMV A;  2Y5W A;  4PJJ A;  1D0X A;  2X7C A;  4UBF A;  5LT3 A;  1VFV A;  1F9T A;  2UYM A;  1VFX A;  2XAE A;  3KIN A;  2XT3 A;  3LRE A;  3X2T A;  1F9W A;  4A14 A;  1V8K A;  1G8X A;  2KIN A;  3ZCW A;  4Y05 A;  5LT1 A;  2UYI A;  3COB A;  1MMA A;  4DBR A;  1T5C A;  2ZFK A;  4LNU K;  1MNE A;  5LT4 A;  1D1A A;  4PJL A;  3DCB A;  2NCD A;  4AP0 A;  1I5S A;  2GRY A;  1D1C A;  1N6M A;  3K5E A;  3HQD A;  5LT0 A;  5HLE A;  4PK4 A;  3GBJ A;  2MYS A;  2X2R A;  1SDM A;  3B6V A;  2VB6 A;  4BXN A;  4E7Z A;  4AS7 A;  3U06 A;  1V8J A;  1MKJ A;  2OWM A;  1BR2 A;  1F9U A;  2X7E A;  2ZFL A;  3PXN A;  4BN2 A;  3B6U A;  2FL6 A;  2ZFM A;  1LKX A;  3H4S A;  1F9V A;  1YRS A;  3WPN A;  2VAS A;  3ZFC A;  1GOJ A;  3KEN A;  1VFW A;  3CJO A;  3BFN A;  4A28 A;  1D1B A;  5GSZ A;  1VOM A;  4HNA K;  3T0Q A;  4ZCA A;  3WRD A;  1CZ7 A;  3K3B A;  2IEH A;  4B7B A;  2VVG A;  4ETP A;  3L9H A;  1VFZ A;  1D0Z A;  4PJM A;  3DC4 A;  1Q0B A;  4A1Z A;  4PFO A;  2X7D A;  4A50 A;  3KAR A;  5LT2 A;  3ZFD A;  2HEH A;  2PG2 A;  2FKY A;  1II6 A;  1D0Y A;  4E7S A;  2FME A;  3NWN A;  4PJN A;  2Q2Z A;  2V26 A;  2GM1 A;  1FMW A;  3L1C A;  1MMG A;  2Y65 A;  4H1G A;  4ZHI A;  2FL2 A;  2ZFI A;  2G1Q A;  1X88 A;  1MMN A;  1I6I A;  1KK7 A;  1LVK A;  2Q2Y A;  1BG2 A;  2X51 A;  2ZFJ A;  1BR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...