4ETPB

C-terminal motor and motor homology domain of kar3vik1 fused to a synthetic heterodimeric coiled coil
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
287
Chain Sequence
AALEKEIAALEKEIAALEKEISKQEKFYNDTYNTVCKELLRSRRLENSIIEQKGTMRVYAYVMEQNLPENLLFDYENGVITQSEHVYKFNRVIPHLKVSEDCFFTQEYSVYHDMALNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDLKFEKHSISLDSKLVIIENGLEDLPLNFSADEMGIIKVQFFPRDPVPVDFYFIELNNLKSIEQFDKSISAETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinesin-like protein KAR3
publication title Kar3Vik1, a member of the kinesin-14 superfamily, shows a novel kinesin microtubule binding pattern.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Motor protein
total genus 83
structure length 287
sequence length 319
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16796 Microtub_bd Microtubule binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 4etpB00
4ETPB 4GKPA 4GKQA 2O0AA
chains in the Genus database with same CATH superfamily
5LT2A 5HLEA 3WRDA 4ZCAA 2GM1A 1KK7A 1F9UA 1VOMA 3ZFCA 4BN2A 3KARA 1LVKA 4FRZA 2X7EA 1BR4A 2ZFKA 5LT4A 2UYIA 3L1CA 3B6VA 1II6A 4UBFA 3KENA 4A51A 2GRYA 4LNUK 4PFOA 3U06A 2FMEA 1YRSA 2V26A 4DBRA 2IEHA 1MMDA 4Y05A 1I5SA 3GBJA 2VVGA 1MMNA 4PK4A 4A1ZA 3KINA 2X7DA 4GKPA 4GKQA 2XAEA 1LKXA 1GOJA 3K3BA 2VASA 2ZFMA 3DC4A 2HEHA 4PJJA 3H4SA 1F9VA 4PFPA 3BFNA 1D1BA 4HNAK 4ETPB 1RY6A 4ANJA 2WOGA 2X51A 1VFXA 4AP0A 3X2TA 1BR2A 3HQDA 1D0ZA 1CZ7A 1MKJA 4ZHIA 2OWMA 3T0QA 1MMAA 2MYSA 3CJOA 3DCBA 4PJNA 3LREA 1SDMA 1BG2A 1MMGA 1F9TA 2VB6A 1Q0BA 1V8JA 2FL2A 2KINA 4BBGA 3ZFDA 3L9HA 2NCDA 4PJMA 4A5YA 1G8XA 2FL6A 1V8KA 2Y65A 2FKYA 2PG2A 1FMVA 2Q2ZA 3WPNA 4ETPA 2ZFJA 2Y5WA 2UYMA 4E7ZA 4AS7A 3PXNA 1VFVA 2XT3A 4BXNA 1D1AA 1D0XA 1F9WA 1I6IA 2X2RA 4DBQA 2Q2YA 4E7SA 4A28A 3K5EA 2ZFIA 5GSZA 5LT0A 1VFZA 3B6UA 1N6MA 5LT1A 2X7CA 2O0AA 3NWNA 3COBA 1MNEA 4A14A 1T5CA 1VFWA 1D0YA 2G1QA 5LT3A 4GKRA 4H1GA 1BR1A 1D1CA 4A50A 4B7BA 1FMWA 4PJLA 3ZCWA 3CNZA 2ZFLA 1X88A
chains in the Genus database with same CATH topology
4ETPB 4GKPA 4GKQA 2O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETP B;  4GKP A;  4GKQ A;  2O0A A; 
#chains in the Genus database with same CATH topology
 5LT2 A;  5HLE A;  3WRD A;  4ZCA A;  2GM1 A;  1KK7 A;  1F9U A;  1VOM A;  3ZFC A;  4BN2 A;  3KAR A;  1LVK A;  4FRZ A;  2X7E A;  1BR4 A;  2ZFK A;  5LT4 A;  2UYI A;  3L1C A;  3B6V A;  1II6 A;  4UBF A;  3KEN A;  4A51 A;  2GRY A;  4LNU K;  4PFO A;  3U06 A;  2FME A;  1YRS A;  2V26 A;  4DBR A;  2IEH A;  1MMD A;  4Y05 A;  1I5S A;  3GBJ A;  2VVG A;  1MMN A;  4PK4 A;  4A1Z A;  3KIN A;  2X7D A;  4GKP A;  4GKQ A;  2XAE A;  1LKX A;  1GOJ A;  3K3B A;  2VAS A;  2ZFM A;  3DC4 A;  2HEH A;  4PJJ A;  3H4S A;  1F9V A;  4PFP A;  3BFN A;  1D1B A;  4HNA K;  4ETP B;  1RY6 A;  4ANJ A;  2WOG A;  2X51 A;  1VFX A;  4AP0 A;  3X2T A;  1BR2 A;  3HQD A;  1D0Z A;  1CZ7 A;  1MKJ A;  4ZHI A;  2OWM A;  3T0Q A;  1MMA A;  2MYS A;  3CJO A;  3DCB A;  4PJN A;  3LRE A;  1SDM A;  1BG2 A;  1MMG A;  1F9T A;  2VB6 A;  1Q0B A;  1V8J A;  2FL2 A;  2KIN A;  4BBG A;  3ZFD A;  3L9H A;  2NCD A;  4PJM A;  4A5Y A;  1G8X A;  2FL6 A;  1V8K A;  2Y65 A;  2FKY A;  2PG2 A;  1FMV A;  2Q2Z A;  3WPN A;  4ETP A;  2ZFJ A;  2Y5W A;  2UYM A;  4E7Z A;  4AS7 A;  3PXN A;  1VFV A;  2XT3 A;  4BXN A;  1D1A A;  1D0X A;  1F9W A;  1I6I A;  2X2R A;  4DBQ A;  2Q2Y A;  4E7S A;  4A28 A;  3K5E A;  2ZFI A;  5GSZ A;  5LT0 A;  1VFZ A;  3B6U A;  1N6M A;  5LT1 A;  2X7C A;  2O0A A;  3NWN A;  3COB A;  1MNE A;  4A14 A;  1T5C A;  1VFW A;  1D0Y A;  2G1Q A;  5LT3 A;  4GKR A;  4H1G A;  1BR1 A;  1D1C A;  4A50 A;  4B7B A;  1FMW A;  4PJL A;  3ZCW A;  3CNZ A;  2ZFL A;  1X88 A; 
#chains in the Genus database with same CATH homology
 4ETP B;  4GKP A;  4GKQ A;  2O0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...