4ETPB

C-terminal motor and motor homology domain of kar3vik1 fused to a synthetic heterodimeric coiled coil
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
319
structure length
287
Chain Sequence
b'AALEKEIAALEKEIAALEKEISKQEKFYNDTYNTVCKELLRSRRLENSIIEQKGTMRVYAYVMEQNLPENLLFDYENGVITQSEHVYKFNRVIPHLKVSEDCFFTQEYSVYHDMALNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDLKFEKHSISLDSKLVIIENGLEDLPLNFSADEMGIIKVQFFPRDPVPVDFYFIELNNLKSIEQFDKSISAETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Kinesin-like protein KAR3
publication title Kar3Vik1, a member of the kinesin-14 superfamily, shows a novel kinesin microtubule binding pattern.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Motor protein
total genus 83
structure length 287
sequence length 319
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF16796 Microtub_bd Microtubule binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 4etpB00
4GKQA 4ETPB 4GKPA 2O0AA
chains in the Genus database with same CATH superfamily
1CZ7A 3KENA 3DC4A 2WOGA 4PJNA 4GKPA 2ZFIA 1F9TA 4HNAK 2V26A 2XAEA 4AS7A 2ZFKA 1BR4A 2MYSA 3ZCWA 2GRYA 1I5SA 4FRZA 4PJMA 1V8JA 1MMDA 3B6UA 5LT0A 1KK7A 3KARA 4B7BA 2VASA 1II6A 2ZFLA 2KINA 4PJJA 1YRSA 2X2RA 3L1CA 4PK4A 1RY6A 2ZFJA 4BBGA 1FMWA 1X88A 1LVKA 4A14A 2X7EA 4ZHIA 4E7SA 2Y65A 3H4SA 2VVGA 2UYMA 3KINA 1F9VA 4A28A 2FKYA 2O0AA 4PJLA 4H1GA 1F9WA 3DCBA 1MMGA 2X7CA 1VFWA 4PFOA 4PFPA 4ANJA 3T0QA 1F9UA 4LNUK 3U06A 5LT3A 1VFXA 5GSZA 3BFNA 2ZFMA 3L9HA 1MNEA 4A5YA 2HEHA 1N6MA 1D1CA 1SDMA 4ZCAA 2FMEA 1BR2A 3LREA 2VB6A 1GOJA 1D1AA 3X2TA 2NCDA 3WRDA 4ETPB 1VFZA 5LT2A 5LT1A 1BG2A 1LKXA 2Y5WA 1T5CA 1MKJA 2X51A 3K5EA 4ETPA 2FL2A 1VFVA 2Q2YA 2GM1A 3PXNA 5HLEA 4DBRA 4DBQA 1FMVA 2FL6A 1V8KA 2XT3A 4UBFA 4Y05A 4BXNA 4GKQA 1I6IA 1D1BA 1D0XA 1D0ZA 1G8XA 2G1QA 3COBA 4BN2A 1BR1A 3ZFDA 4GKRA 3K3BA 2IEHA 2OWMA 5LT4A 1MMNA 3CJOA 1Q0BA 2PG2A 1D0YA 3NWNA 4A51A 2X7DA 1MMAA 2Q2ZA 3B6VA 1VOMA 3WPNA 2UYIA 3HQDA 3ZFCA 4A50A 3CNZA 4E7ZA 3GBJA 4A1ZA 4AP0A
chains in the Genus database with same CATH topology
4GKQA 4ETPB 4GKPA 2O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKQ A;  4ETP B;  4GKP A;  2O0A A; 
#chains in the Genus database with same CATH topology
 1CZ7 A;  3KEN A;  3DC4 A;  2WOG A;  4PJN A;  4GKP A;  2ZFI A;  1F9T A;  4HNA K;  2V26 A;  2XAE A;  4AS7 A;  2ZFK A;  1BR4 A;  2MYS A;  3ZCW A;  2GRY A;  1I5S A;  4FRZ A;  4PJM A;  1V8J A;  1MMD A;  3B6U A;  5LT0 A;  1KK7 A;  3KAR A;  4B7B A;  2VAS A;  1II6 A;  2ZFL A;  2KIN A;  4PJJ A;  1YRS A;  2X2R A;  3L1C A;  4PK4 A;  1RY6 A;  2ZFJ A;  4BBG A;  1FMW A;  1X88 A;  1LVK A;  4A14 A;  2X7E A;  4ZHI A;  4E7S A;  2Y65 A;  3H4S A;  2VVG A;  2UYM A;  3KIN A;  1F9V A;  4A28 A;  2FKY A;  2O0A A;  4PJL A;  4H1G A;  1F9W A;  3DCB A;  1MMG A;  2X7C A;  1VFW A;  4PFO A;  4PFP A;  4ANJ A;  3T0Q A;  1F9U A;  4LNU K;  3U06 A;  5LT3 A;  1VFX A;  5GSZ A;  3BFN A;  2ZFM A;  3L9H A;  1MNE A;  4A5Y A;  2HEH A;  1N6M A;  1D1C A;  1SDM A;  4ZCA A;  2FME A;  1BR2 A;  3LRE A;  2VB6 A;  1GOJ A;  1D1A A;  3X2T A;  2NCD A;  3WRD A;  4ETP B;  1VFZ A;  5LT2 A;  5LT1 A;  1BG2 A;  1LKX A;  2Y5W A;  1T5C A;  1MKJ A;  2X51 A;  3K5E A;  4ETP A;  2FL2 A;  1VFV A;  2Q2Y A;  2GM1 A;  3PXN A;  5HLE A;  4DBR A;  4DBQ A;  1FMV A;  2FL6 A;  1V8K A;  2XT3 A;  4UBF A;  4Y05 A;  4BXN A;  4GKQ A;  1I6I A;  1D1B A;  1D0X A;  1D0Z A;  1G8X A;  2G1Q A;  3COB A;  4BN2 A;  1BR1 A;  3ZFD A;  4GKR A;  3K3B A;  2IEH A;  2OWM A;  5LT4 A;  1MMN A;  3CJO A;  1Q0B A;  2PG2 A;  1D0Y A;  3NWN A;  4A51 A;  2X7D A;  1MMA A;  2Q2Z A;  3B6V A;  1VOM A;  3WPN A;  2UYI A;  3HQD A;  3ZFC A;  4A50 A;  3CNZ A;  4E7Z A;  3GBJ A;  4A1Z A;  4AP0 A; 
#chains in the Genus database with same CATH homology
 4GKQ A;  4ETP B;  4GKP A;  2O0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...