1I6IA

Crystal structure of the kif1a motor domain complexed with mg-amppcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
364
structure length
333
Chain Sequence
b'GASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEANINKSLTTLGKVISALAEMDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN-LIKE PROTEIN KIF1A
publication title Switch-based mechanism of kinesin motors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 109
structure length 333
sequence length 364
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1i6iA00
3KINA 1I6IA 3K3BA 4PJJA 4E7ZA 1V8JA 2UYMA 3CNZA 1BR1A 2UYIA 3K5EA 2WOGA 2X51A 5LT3A 4ANJA 1MKJA 5LT2A 4B7BA 4GKRA 1SDMA 1F9UA 2ZFMA 3DCBA 2ZFJA 4A28A 1D0YA 4PFPA 3B6VA 3X2TA 1MMDA 2HEHA 3HQDA 1F9VA 1YRSA 5LT1A 2FKYA 2Y5WA 4A14A 3U06A 4H1GA 4PK4A 1N6MA 1I5SA 4PJMA 1FMWA 1CZ7A 1F9WA 1RY6A 1D1CA 3L9HA 2ZFIA 5LT4A 2G1QA 1VFXA 1II6A 1KK7A 5GSZA 2PG2A 2X7DA 4A1ZA 3KENA 3COBA 1MMGA 3WPNA 1D1AA 1X88A 2GRYA 4LNUK 1VFZA 3DC4A 3PXNA 5HLEA 1V8KA 4AP0A 1D1BA 2X2RA 1BR4A 4ZHIA 1T5CA 2X7CA 4ZCAA 1VFWA 1VFVA 3CJOA 3NWNA 4BXNA 2XAEA 2FL6A 1GOJA 4PJNA 4ETPA 2OWMA 2Q2YA 1Q0BA 4E7SA 1D0ZA 5LT0A 2NCDA 2VASA 4A5YA 1MMAA 1BG2A 3T0QA 2Y65A 3L1CA 2MYSA 3WRDA 4PFOA 2ZFLA 2GM1A 4PJLA 4AS7A 4HNAK 3ZCWA 2VB6A 2IEHA 2ZFKA 4BBGA 2Q2ZA 3ZFCA 2FMEA 3GBJA 3B6UA 1D0XA 4DBQA 3KARA 1VOMA 3LREA 4DBRA 2XT3A 2FL2A 2X7EA 4Y05A 3ZFDA 2VVGA 1F9TA 3BFNA 1FMVA 2V26A 1BR2A 1MNEA 4A50A 2KINA 1G8XA 4UBFA 1LVKA 4A51A 3H4SA 4FRZA 1LKXA 4BN2A 1MMNA
chains in the Genus database with same CATH superfamily
3KINA 4ETPB 1I6IA 3K3BA 4PJJA 4E7ZA 1V8JA 2UYMA 3CNZA 1BR1A 2UYIA 3K5EA 2WOGA 2X51A 5LT3A 4ANJA 1MKJA 5LT2A 4B7BA 4GKRA 1SDMA 1F9UA 2ZFMA 3DCBA 2ZFJA 4A28A 1D0YA 4PFPA 4GKQA 3B6VA 3X2TA 1MMDA 2HEHA 3HQDA 1F9VA 1YRSA 5LT1A 2O0AA 2FKYA 2Y5WA 4A14A 3U06A 4H1GA 4PK4A 1N6MA 1I5SA 4PJMA 1FMWA 1CZ7A 1F9WA 1RY6A 1D1CA 3L9HA 2ZFIA 5LT4A 2G1QA 1VFXA 1II6A 1KK7A 5GSZA 2PG2A 2X7DA 4A1ZA 3KENA 3COBA 1MMGA 3WPNA 1D1AA 1X88A 2GRYA 4LNUK 1VFZA 3DC4A 3PXNA 5HLEA 1V8KA 4AP0A 1D1BA 2X2RA 1BR4A 4ZHIA 1T5CA 2X7CA 4ZCAA 1VFWA 1VFVA 3CJOA 4GKPA 3NWNA 4BXNA 2XAEA 2FL6A 1GOJA 4PJNA 4ETPA 2OWMA 2Q2YA 1Q0BA 4E7SA 1D0ZA 5LT0A 2NCDA 2VASA 4A5YA 1MMAA 1BG2A 3T0QA 2Y65A 3L1CA 2MYSA 3WRDA 4PFOA 2ZFLA 2GM1A 4PJLA 4AS7A 4HNAK 3ZCWA 2VB6A 2IEHA 2ZFKA 4BBGA 2Q2ZA 3ZFCA 2FMEA 3GBJA 3B6UA 1D0XA 4DBQA 3KARA 1VOMA 3LREA 4DBRA 2XT3A 2FL2A 2X7EA 4Y05A 3ZFDA 2VVGA 1F9TA 3BFNA 1FMVA 2V26A 1BR2A 1MNEA 4A50A 2KINA 1G8XA 4UBFA 1LVKA 4A51A 3H4SA 4FRZA 1LKXA 4BN2A 1MMNA
chains in the Genus database with same CATH topology
3KINA 1I6IA 3K3BA 4PJJA 4E7ZA 1V8JA 2UYMA 3CNZA 1BR1A 2UYIA 3K5EA 2WOGA 2X51A 5LT3A 4ANJA 1MKJA 5LT2A 4B7BA 4GKRA 1SDMA 1F9UA 2ZFMA 3DCBA 2ZFJA 4A28A 1D0YA 4PFPA 3B6VA 3X2TA 1MMDA 2HEHA 3HQDA 1F9VA 1YRSA 5LT1A 2FKYA 2Y5WA 4A14A 3U06A 4H1GA 4PK4A 1N6MA 1I5SA 4PJMA 1FMWA 1CZ7A 1F9WA 1RY6A 1D1CA 3L9HA 2ZFIA 5LT4A 2G1QA 1VFXA 1II6A 1KK7A 5GSZA 2PG2A 2X7DA 4A1ZA 3KENA 3COBA 1MMGA 3WPNA 1D1AA 1X88A 2GRYA 4LNUK 1VFZA 3DC4A 3PXNA 5HLEA 1V8KA 4AP0A 1D1BA 2X2RA 1BR4A 4ZHIA 1T5CA 2X7CA 4ZCAA 1VFWA 1VFVA 3CJOA 3NWNA 4BXNA 2XAEA 2FL6A 1GOJA 4PJNA 4ETPA 2OWMA 2Q2YA 1Q0BA 4E7SA 1D0ZA 5LT0A 2NCDA 2VASA 4A5YA 1MMAA 1BG2A 3T0QA 2Y65A 3L1CA 2MYSA 3WRDA 4PFOA 2ZFLA 2GM1A 4PJLA 4AS7A 4HNAK 3ZCWA 2VB6A 2IEHA 2ZFKA 4BBGA 2Q2ZA 3ZFCA 2FMEA 3GBJA 3B6UA 1D0XA 4DBQA 3KARA 1VOMA 3LREA 4DBRA 2XT3A 2FL2A 2X7EA 4Y05A 3ZFDA 2VVGA 1F9TA 3BFNA 1FMVA 2V26A 1BR2A 1MNEA 4A50A 2KINA 1G8XA 4UBFA 1LVKA 4A51A 3H4SA 4FRZA 1LKXA 4BN2A 1MMNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KIN A;  1I6I A;  3K3B A;  4PJJ A;  4E7Z A;  1V8J A;  2UYM A;  3CNZ A;  1BR1 A;  2UYI A;  3K5E A;  2WOG A;  2X51 A;  5LT3 A;  4ANJ A;  1MKJ A;  5LT2 A;  4B7B A;  4GKR A;  1SDM A;  1F9U A;  2ZFM A;  3DCB A;  2ZFJ A;  4A28 A;  1D0Y A;  4PFP A;  3B6V A;  3X2T A;  1MMD A;  2HEH A;  3HQD A;  1F9V A;  1YRS A;  5LT1 A;  2FKY A;  2Y5W A;  4A14 A;  3U06 A;  4H1G A;  4PK4 A;  1N6M A;  1I5S A;  4PJM A;  1FMW A;  1CZ7 A;  1F9W A;  1RY6 A;  1D1C A;  3L9H A;  2ZFI A;  5LT4 A;  2G1Q A;  1VFX A;  1II6 A;  1KK7 A;  5GSZ A;  2PG2 A;  2X7D A;  4A1Z A;  3KEN A;  3COB A;  1MMG A;  3WPN A;  1D1A A;  1X88 A;  2GRY A;  4LNU K;  1VFZ A;  3DC4 A;  3PXN A;  5HLE A;  1V8K A;  4AP0 A;  1D1B A;  2X2R A;  1BR4 A;  4ZHI A;  1T5C A;  2X7C A;  4ZCA A;  1VFW A;  1VFV A;  3CJO A;  3NWN A;  4BXN A;  2XAE A;  2FL6 A;  1GOJ A;  4PJN A;  4ETP A;  2OWM A;  2Q2Y A;  1Q0B A;  4E7S A;  1D0Z A;  5LT0 A;  2NCD A;  2VAS A;  4A5Y A;  1MMA A;  1BG2 A;  3T0Q A;  2Y65 A;  3L1C A;  2MYS A;  3WRD A;  4PFO A;  2ZFL A;  2GM1 A;  4PJL A;  4AS7 A;  4HNA K;  3ZCW A;  2VB6 A;  2IEH A;  2ZFK A;  4BBG A;  2Q2Z A;  3ZFC A;  2FME A;  3GBJ A;  3B6U A;  1D0X A;  4DBQ A;  3KAR A;  1VOM A;  3LRE A;  4DBR A;  2XT3 A;  2FL2 A;  2X7E A;  4Y05 A;  3ZFD A;  2VVG A;  1F9T A;  3BFN A;  1FMV A;  2V26 A;  1BR2 A;  1MNE A;  4A50 A;  2KIN A;  1G8X A;  4UBF A;  1LVK A;  4A51 A;  3H4S A;  4FRZ A;  1LKX A;  4BN2 A;  1MMN A; 
#chains in the Genus database with same CATH topology
 3KIN A;  4ETP B;  1I6I A;  3K3B A;  4PJJ A;  4E7Z A;  1V8J A;  2UYM A;  3CNZ A;  1BR1 A;  2UYI A;  3K5E A;  2WOG A;  2X51 A;  5LT3 A;  4ANJ A;  1MKJ A;  5LT2 A;  4B7B A;  4GKR A;  1SDM A;  1F9U A;  2ZFM A;  3DCB A;  2ZFJ A;  4A28 A;  1D0Y A;  4PFP A;  4GKQ A;  3B6V A;  3X2T A;  1MMD A;  2HEH A;  3HQD A;  1F9V A;  1YRS A;  5LT1 A;  2O0A A;  2FKY A;  2Y5W A;  4A14 A;  3U06 A;  4H1G A;  4PK4 A;  1N6M A;  1I5S A;  4PJM A;  1FMW A;  1CZ7 A;  1F9W A;  1RY6 A;  1D1C A;  3L9H A;  2ZFI A;  5LT4 A;  2G1Q A;  1VFX A;  1II6 A;  1KK7 A;  5GSZ A;  2PG2 A;  2X7D A;  4A1Z A;  3KEN A;  3COB A;  1MMG A;  3WPN A;  1D1A A;  1X88 A;  2GRY A;  4LNU K;  1VFZ A;  3DC4 A;  3PXN A;  5HLE A;  1V8K A;  4AP0 A;  1D1B A;  2X2R A;  1BR4 A;  4ZHI A;  1T5C A;  2X7C A;  4ZCA A;  1VFW A;  1VFV A;  3CJO A;  4GKP A;  3NWN A;  4BXN A;  2XAE A;  2FL6 A;  1GOJ A;  4PJN A;  4ETP A;  2OWM A;  2Q2Y A;  1Q0B A;  4E7S A;  1D0Z A;  5LT0 A;  2NCD A;  2VAS A;  4A5Y A;  1MMA A;  1BG2 A;  3T0Q A;  2Y65 A;  3L1C A;  2MYS A;  3WRD A;  4PFO A;  2ZFL A;  2GM1 A;  4PJL A;  4AS7 A;  4HNA K;  3ZCW A;  2VB6 A;  2IEH A;  2ZFK A;  4BBG A;  2Q2Z A;  3ZFC A;  2FME A;  3GBJ A;  3B6U A;  1D0X A;  4DBQ A;  3KAR A;  1VOM A;  3LRE A;  4DBR A;  2XT3 A;  2FL2 A;  2X7E A;  4Y05 A;  3ZFD A;  2VVG A;  1F9T A;  3BFN A;  1FMV A;  2V26 A;  1BR2 A;  1MNE A;  4A50 A;  2KIN A;  1G8X A;  4UBF A;  1LVK A;  4A51 A;  3H4S A;  4FRZ A;  1LKX A;  4BN2 A;  1MMN A; 
#chains in the Genus database with same CATH homology
 3KIN A;  1I6I A;  3K3B A;  4PJJ A;  4E7Z A;  1V8J A;  2UYM A;  3CNZ A;  1BR1 A;  2UYI A;  3K5E A;  2WOG A;  2X51 A;  5LT3 A;  4ANJ A;  1MKJ A;  5LT2 A;  4B7B A;  4GKR A;  1SDM A;  1F9U A;  2ZFM A;  3DCB A;  2ZFJ A;  4A28 A;  1D0Y A;  4PFP A;  3B6V A;  3X2T A;  1MMD A;  2HEH A;  3HQD A;  1F9V A;  1YRS A;  5LT1 A;  2FKY A;  2Y5W A;  4A14 A;  3U06 A;  4H1G A;  4PK4 A;  1N6M A;  1I5S A;  4PJM A;  1FMW A;  1CZ7 A;  1F9W A;  1RY6 A;  1D1C A;  3L9H A;  2ZFI A;  5LT4 A;  2G1Q A;  1VFX A;  1II6 A;  1KK7 A;  5GSZ A;  2PG2 A;  2X7D A;  4A1Z A;  3KEN A;  3COB A;  1MMG A;  3WPN A;  1D1A A;  1X88 A;  2GRY A;  4LNU K;  1VFZ A;  3DC4 A;  3PXN A;  5HLE A;  1V8K A;  4AP0 A;  1D1B A;  2X2R A;  1BR4 A;  4ZHI A;  1T5C A;  2X7C A;  4ZCA A;  1VFW A;  1VFV A;  3CJO A;  3NWN A;  4BXN A;  2XAE A;  2FL6 A;  1GOJ A;  4PJN A;  4ETP A;  2OWM A;  2Q2Y A;  1Q0B A;  4E7S A;  1D0Z A;  5LT0 A;  2NCD A;  2VAS A;  4A5Y A;  1MMA A;  1BG2 A;  3T0Q A;  2Y65 A;  3L1C A;  2MYS A;  3WRD A;  4PFO A;  2ZFL A;  2GM1 A;  4PJL A;  4AS7 A;  4HNA K;  3ZCW A;  2VB6 A;  2IEH A;  2ZFK A;  4BBG A;  2Q2Z A;  3ZFC A;  2FME A;  3GBJ A;  3B6U A;  1D0X A;  4DBQ A;  3KAR A;  1VOM A;  3LRE A;  4DBR A;  2XT3 A;  2FL2 A;  2X7E A;  4Y05 A;  3ZFD A;  2VVG A;  1F9T A;  3BFN A;  1FMV A;  2V26 A;  1BR2 A;  1MNE A;  4A50 A;  2KIN A;  1G8X A;  4UBF A;  1LVK A;  4A51 A;  3H4S A;  4FRZ A;  1LKX A;  4BN2 A;  1MMN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...