1I6IA

Crystal structure of the kif1a motor domain complexed with mg-amppcp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
364
structure length
333
Chain Sequence
GASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKARTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEANINKSLTTLGKVISALAEMDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN-LIKE PROTEIN KIF1A
publication title Switch-based mechanism of kinesin motors
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 109
structure length 333
sequence length 364
ec nomenclature
pdb deposition date 2001-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1i6iA00
1VOMA 2PG2A 3WRDA 1RY6A 5LT2A 1BG2A 1LKXA 1FMVA 2UYMA 5LT0A 4ZHIA 4DBRA 1II6A 4A14A 4UBFA 2Y5WA 4A50A 1LVKA 1MMDA 4ETPA 1MMNA 4E7SA 2X7CA 4PJJA 3B6UA 4BXNA 2ZFIA 2V26A 4A51A 4DBQA 3NWNA 1MKJA 1CZ7A 1V8KA 1V8JA 4GKRA 3B6VA 4BN2A 5HLEA 3H4SA 1GOJA 2XAEA 1F9UA 2VVGA 5GSZA 2X2RA 2FKYA 4HNAK 4FRZA 4PJMA 1BR1A 4PJLA 3U06A 1BR2A 2FMEA 3ZFDA 3T0QA 4LNUK 3COBA 3K5EA 5LT4A 1BR4A 2Y65A 3CNZA 2G1QA 2NCDA 4B7BA 1G8XA 1SDMA 3KENA 2X7EA 3HQDA 2OWMA 2FL6A 2ZFLA 4E7ZA 2KINA 4A28A 4AS7A 4PFOA 5LT3A 2XT3A 4Y05A 4A5YA 2UYIA 3DCBA 4PJNA 3ZCWA 2VASA 3GBJA 1F9VA 2VB6A 4A1ZA 2Q2YA 1N6MA 2HEHA 3L1CA 3LREA 1X88A 1D0XA 2GRYA 2ZFKA 4AP0A 3L9HA 2ZFMA 1D1AA 3WPNA 2X51A 1FMWA 1Q0BA 1D0ZA 1MNEA 3KARA 4BBGA 4H1GA 1MMGA 2WOGA 1VFXA 3BFNA 2Q2ZA 1F9WA 2X7DA 3PXNA 1I6IA 3ZFCA 1D1BA 2MYSA 1YRSA 3X2TA 4PK4A 2ZFJA 1D0YA 2IEHA 3DC4A 4ZCAA 4ANJA 1VFVA 5LT1A 3KINA 1D1CA 1VFZA 2FL2A 1KK7A 2GM1A 3CJOA 1T5CA 4PFPA 1VFWA 3K3BA 1I5SA 1MMAA 1F9TA
chains in the Genus database with same CATH superfamily
1VOMA 2PG2A 3WRDA 1RY6A 5LT2A 1BG2A 1LKXA 1FMVA 2UYMA 5LT0A 2O0AA 4DBRA 4ZHIA 1II6A 4A14A 4UBFA 2Y5WA 4A50A 1LVKA 1MMDA 4ETPA 1MMNA 4E7SA 2X7CA 4PJJA 3B6UA 4BXNA 2ZFIA 2V26A 4A51A 4DBQA 3NWNA 1MKJA 1CZ7A 1V8KA 1V8JA 4GKRA 3B6VA 4BN2A 5HLEA 3H4SA 1GOJA 2XAEA 1F9UA 2VVGA 5GSZA 2X2RA 2FKYA 4HNAK 4FRZA 4PJMA 1BR1A 4PJLA 3U06A 1BR2A 2FMEA 3ZFDA 3T0QA 4LNUK 3COBA 3K5EA 5LT4A 1BR4A 2Y65A 3CNZA 2G1QA 2NCDA 4B7BA 1G8XA 1SDMA 3KENA 2X7EA 3HQDA 4GKPA 2OWMA 2FL6A 2ZFLA 4E7ZA 2KINA 4A28A 4AS7A 4PFOA 5LT3A 2XT3A 4Y05A 4A5YA 2UYIA 3DCBA 4PJNA 3ZCWA 2VASA 3GBJA 1F9VA 2VB6A 4A1ZA 2Q2YA 1N6MA 2HEHA 3L1CA 3LREA 1X88A 1D0XA 2GRYA 2ZFKA 4AP0A 3L9HA 2ZFMA 1D1AA 3WPNA 2X51A 1FMWA 1Q0BA 1D0ZA 1MNEA 3KARA 4BBGA 4H1GA 1MMGA 4ETPB 2WOGA 1VFXA 3BFNA 2Q2ZA 1F9WA 2X7DA 3PXNA 1I6IA 3ZFCA 1D1BA 2MYSA 1YRSA 3X2TA 4GKQA 4PK4A 2ZFJA 1D0YA 2IEHA 3DC4A 4ZCAA 4ANJA 1VFVA 5LT1A 3KINA 1D1CA 1VFZA 2FL2A 1KK7A 2GM1A 3CJOA 1T5CA 4PFPA 1VFWA 3K3BA 1I5SA 1MMAA 1F9TA
chains in the Genus database with same CATH topology
1VOMA 2PG2A 3WRDA 1RY6A 5LT2A 1BG2A 1LKXA 1FMVA 2UYMA 5LT0A 4ZHIA 4DBRA 1II6A 4A14A 4UBFA 2Y5WA 4A50A 1LVKA 1MMDA 4ETPA 1MMNA 4E7SA 2X7CA 4PJJA 3B6UA 4BXNA 2ZFIA 2V26A 4A51A 4DBQA 3NWNA 1MKJA 1CZ7A 1V8KA 1V8JA 4GKRA 3B6VA 4BN2A 5HLEA 3H4SA 1GOJA 2XAEA 1F9UA 2VVGA 5GSZA 2X2RA 2FKYA 4HNAK 4FRZA 4PJMA 1BR1A 4PJLA 3U06A 1BR2A 2FMEA 3ZFDA 3T0QA 4LNUK 3COBA 3K5EA 5LT4A 1BR4A 2Y65A 3CNZA 2G1QA 2NCDA 4B7BA 1G8XA 1SDMA 3KENA 2X7EA 3HQDA 2OWMA 2FL6A 2ZFLA 4E7ZA 2KINA 4A28A 4AS7A 4PFOA 5LT3A 2XT3A 4Y05A 4A5YA 2UYIA 3DCBA 4PJNA 3ZCWA 2VASA 3GBJA 1F9VA 2VB6A 4A1ZA 2Q2YA 1N6MA 2HEHA 3L1CA 3LREA 1X88A 1D0XA 2GRYA 2ZFKA 4AP0A 3L9HA 2ZFMA 1D1AA 3WPNA 2X51A 1FMWA 1Q0BA 1D0ZA 1MNEA 3KARA 4BBGA 4H1GA 1MMGA 2WOGA 1VFXA 3BFNA 2Q2ZA 1F9WA 2X7DA 3PXNA 1I6IA 3ZFCA 1D1BA 2MYSA 1YRSA 3X2TA 4PK4A 2ZFJA 1D0YA 2IEHA 3DC4A 4ZCAA 4ANJA 1VFVA 5LT1A 3KINA 1D1CA 1VFZA 2FL2A 1KK7A 2GM1A 3CJOA 1T5CA 4PFPA 1VFWA 3K3BA 1I5SA 1MMAA 1F9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VOM A;  2PG2 A;  3WRD A;  1RY6 A;  5LT2 A;  1BG2 A;  1LKX A;  1FMV A;  2UYM A;  5LT0 A;  4ZHI A;  4DBR A;  1II6 A;  4A14 A;  4UBF A;  2Y5W A;  4A50 A;  1LVK A;  1MMD A;  4ETP A;  1MMN A;  4E7S A;  2X7C A;  4PJJ A;  3B6U A;  4BXN A;  2ZFI A;  2V26 A;  4A51 A;  4DBQ A;  3NWN A;  1MKJ A;  1CZ7 A;  1V8K A;  1V8J A;  4GKR A;  3B6V A;  4BN2 A;  5HLE A;  3H4S A;  1GOJ A;  2XAE A;  1F9U A;  2VVG A;  5GSZ A;  2X2R A;  2FKY A;  4HNA K;  4FRZ A;  4PJM A;  1BR1 A;  4PJL A;  3U06 A;  1BR2 A;  2FME A;  3ZFD A;  3T0Q A;  4LNU K;  3COB A;  3K5E A;  5LT4 A;  1BR4 A;  2Y65 A;  3CNZ A;  2G1Q A;  2NCD A;  4B7B A;  1G8X A;  1SDM A;  3KEN A;  2X7E A;  3HQD A;  2OWM A;  2FL6 A;  2ZFL A;  4E7Z A;  2KIN A;  4A28 A;  4AS7 A;  4PFO A;  5LT3 A;  2XT3 A;  4Y05 A;  4A5Y A;  2UYI A;  3DCB A;  4PJN A;  3ZCW A;  2VAS A;  3GBJ A;  1F9V A;  2VB6 A;  4A1Z A;  2Q2Y A;  1N6M A;  2HEH A;  3L1C A;  3LRE A;  1X88 A;  1D0X A;  2GRY A;  2ZFK A;  4AP0 A;  3L9H A;  2ZFM A;  1D1A A;  3WPN A;  2X51 A;  1FMW A;  1Q0B A;  1D0Z A;  1MNE A;  3KAR A;  4BBG A;  4H1G A;  1MMG A;  2WOG A;  1VFX A;  3BFN A;  2Q2Z A;  1F9W A;  2X7D A;  3PXN A;  1I6I A;  3ZFC A;  1D1B A;  2MYS A;  1YRS A;  3X2T A;  4PK4 A;  2ZFJ A;  1D0Y A;  2IEH A;  3DC4 A;  4ZCA A;  4ANJ A;  1VFV A;  5LT1 A;  3KIN A;  1D1C A;  1VFZ A;  2FL2 A;  1KK7 A;  2GM1 A;  3CJO A;  1T5C A;  4PFP A;  1VFW A;  3K3B A;  1I5S A;  1MMA A;  1F9T A; 
#chains in the Genus database with same CATH topology
 1VOM A;  2PG2 A;  3WRD A;  1RY6 A;  5LT2 A;  1BG2 A;  1LKX A;  1FMV A;  2UYM A;  5LT0 A;  2O0A A;  4DBR A;  4ZHI A;  1II6 A;  4A14 A;  4UBF A;  2Y5W A;  4A50 A;  1LVK A;  1MMD A;  4ETP A;  1MMN A;  4E7S A;  2X7C A;  4PJJ A;  3B6U A;  4BXN A;  2ZFI A;  2V26 A;  4A51 A;  4DBQ A;  3NWN A;  1MKJ A;  1CZ7 A;  1V8K A;  1V8J A;  4GKR A;  3B6V A;  4BN2 A;  5HLE A;  3H4S A;  1GOJ A;  2XAE A;  1F9U A;  2VVG A;  5GSZ A;  2X2R A;  2FKY A;  4HNA K;  4FRZ A;  4PJM A;  1BR1 A;  4PJL A;  3U06 A;  1BR2 A;  2FME A;  3ZFD A;  3T0Q A;  4LNU K;  3COB A;  3K5E A;  5LT4 A;  1BR4 A;  2Y65 A;  3CNZ A;  2G1Q A;  2NCD A;  4B7B A;  1G8X A;  1SDM A;  3KEN A;  2X7E A;  3HQD A;  4GKP A;  2OWM A;  2FL6 A;  2ZFL A;  4E7Z A;  2KIN A;  4A28 A;  4AS7 A;  4PFO A;  5LT3 A;  2XT3 A;  4Y05 A;  4A5Y A;  2UYI A;  3DCB A;  4PJN A;  3ZCW A;  2VAS A;  3GBJ A;  1F9V A;  2VB6 A;  4A1Z A;  2Q2Y A;  1N6M A;  2HEH A;  3L1C A;  3LRE A;  1X88 A;  1D0X A;  2GRY A;  2ZFK A;  4AP0 A;  3L9H A;  2ZFM A;  1D1A A;  3WPN A;  2X51 A;  1FMW A;  1Q0B A;  1D0Z A;  1MNE A;  3KAR A;  4BBG A;  4H1G A;  1MMG A;  4ETP B;  2WOG A;  1VFX A;  3BFN A;  2Q2Z A;  1F9W A;  2X7D A;  3PXN A;  1I6I A;  3ZFC A;  1D1B A;  2MYS A;  1YRS A;  3X2T A;  4GKQ A;  4PK4 A;  2ZFJ A;  1D0Y A;  2IEH A;  3DC4 A;  4ZCA A;  4ANJ A;  1VFV A;  5LT1 A;  3KIN A;  1D1C A;  1VFZ A;  2FL2 A;  1KK7 A;  2GM1 A;  3CJO A;  1T5C A;  4PFP A;  1VFW A;  3K3B A;  1I5S A;  1MMA A;  1F9T A; 
#chains in the Genus database with same CATH homology
 1VOM A;  2PG2 A;  3WRD A;  1RY6 A;  5LT2 A;  1BG2 A;  1LKX A;  1FMV A;  2UYM A;  5LT0 A;  4ZHI A;  4DBR A;  1II6 A;  4A14 A;  4UBF A;  2Y5W A;  4A50 A;  1LVK A;  1MMD A;  4ETP A;  1MMN A;  4E7S A;  2X7C A;  4PJJ A;  3B6U A;  4BXN A;  2ZFI A;  2V26 A;  4A51 A;  4DBQ A;  3NWN A;  1MKJ A;  1CZ7 A;  1V8K A;  1V8J A;  4GKR A;  3B6V A;  4BN2 A;  5HLE A;  3H4S A;  1GOJ A;  2XAE A;  1F9U A;  2VVG A;  5GSZ A;  2X2R A;  2FKY A;  4HNA K;  4FRZ A;  4PJM A;  1BR1 A;  4PJL A;  3U06 A;  1BR2 A;  2FME A;  3ZFD A;  3T0Q A;  4LNU K;  3COB A;  3K5E A;  5LT4 A;  1BR4 A;  2Y65 A;  3CNZ A;  2G1Q A;  2NCD A;  4B7B A;  1G8X A;  1SDM A;  3KEN A;  2X7E A;  3HQD A;  2OWM A;  2FL6 A;  2ZFL A;  4E7Z A;  2KIN A;  4A28 A;  4AS7 A;  4PFO A;  5LT3 A;  2XT3 A;  4Y05 A;  4A5Y A;  2UYI A;  3DCB A;  4PJN A;  3ZCW A;  2VAS A;  3GBJ A;  1F9V A;  2VB6 A;  4A1Z A;  2Q2Y A;  1N6M A;  2HEH A;  3L1C A;  3LRE A;  1X88 A;  1D0X A;  2GRY A;  2ZFK A;  4AP0 A;  3L9H A;  2ZFM A;  1D1A A;  3WPN A;  2X51 A;  1FMW A;  1Q0B A;  1D0Z A;  1MNE A;  3KAR A;  4BBG A;  4H1G A;  1MMG A;  2WOG A;  1VFX A;  3BFN A;  2Q2Z A;  1F9W A;  2X7D A;  3PXN A;  1I6I A;  3ZFC A;  1D1B A;  2MYS A;  1YRS A;  3X2T A;  4PK4 A;  2ZFJ A;  1D0Y A;  2IEH A;  3DC4 A;  4ZCA A;  4ANJ A;  1VFV A;  5LT1 A;  3KIN A;  1D1C A;  1VFZ A;  2FL2 A;  1KK7 A;  2GM1 A;  3CJO A;  1T5C A;  4PFP A;  1VFW A;  3K3B A;  1I5S A;  1MMA A;  1F9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...