4GKPA

Structure of the truncated neck and c-terminal motor homology domain of vik1 from candida glabrata
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
258
structure length
229
Chain Sequence
b'RLFANIIEDEISEKLIVNYSDESIEDMKNHKTYKFTKLIQNFSHQNKDLFKEDLHVYIDFCLKRRENFNLFSVGSSNIPNTFEKLLAFFKNNYFDKFVITLQYVMLSSQDLLSNKLKIEESTISLGSTLITLDEITDKLKKKYSNGIGLSKFQFFCLQDIEPIPIDFYFIEIYQPSIYPILKRSSPLEIVLKKIFHDTKSAFVFQIDHSAEVYDILKLSSHLSFIRNPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spindle pole body-associated protein VIK1
publication title Neck Rotation and Neck Mimic Docking in the Noncatalytic Kar3-associated Protein Vik1.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Structural protein
total genus 64
structure length 229
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 4gkpA00
2O0AA 4GKPA 4ETPB 4GKQA
chains in the Genus database with same CATH superfamily
4UBFA 2VB6A 4ZCAA 1FMWA 4ETPB 2IEHA 1BG2A 4PJNA 4BBGA 4FRZA 2G1QA 1VOMA 1MMDA 4GKQA 2FL6A 2UYMA 2GRYA 1GOJA 5GSZA 2VASA 3COBA 3HQDA 1MMGA 4A51A 3H4SA 1BR1A 2O0AA 4A50A 3GBJA 3L1CA 1RY6A 3U06A 4PFOA 4AS7A 2NCDA 4LNUK 3X2TA 1F9WA 4PFPA 1CZ7A 4Y05A 1BR2A 2ZFIA 1X88A 2Q2YA 3LREA 2X7CA 4E7ZA 2X7DA 4DBQA 4PK4A 2Q2ZA 1D1CA 1Q0BA 2XT3A 1I6IA 1VFVA 2X51A 4A14A 1D0YA 4BN2A 4DBRA 1MNEA 1D0ZA 1D1AA 2OWMA 1G8XA 1MMAA 3CJOA 4B7BA 3WRDA 2MYSA 2FL2A 1YRSA 1VFXA 1VFWA 2X7EA 3KARA 1LVKA 3ZCWA 3K5EA 5LT3A 2WOGA 1KK7A 1II6A 4ETPA 1I5SA 2UYIA 3L9HA 4BXNA 5LT1A 2V26A 1FMVA 2VVGA 4A5YA 1F9VA 4GKRA 3CNZA 4AP0A 4PJMA 1V8KA 2ZFKA 1BR4A 4GKPA 2Y65A 2ZFJA 1D1BA 3ZFCA 1VFZA 4HNAK 3KINA 3BFNA 3DC4A 1MMNA 1V8JA 4E7SA 1D0XA 4A28A 2KINA 2GM1A 2ZFLA 1SDMA 1T5CA 4H1GA 2FKYA 4PJLA 2PG2A 5LT2A 1F9TA 4PJJA 3NWNA 3B6VA 4A1ZA 3DCBA 4ANJA 1N6MA 1MKJA 3ZFDA 2XAEA 1F9UA 3B6UA 4ZHIA 1LKXA 5HLEA 2Y5WA 3T0QA 3K3BA 2HEHA 3PXNA 5LT4A 2X2RA 5LT0A 3WPNA 2FMEA 2ZFMA 3KENA
chains in the Genus database with same CATH topology
2O0AA 4GKPA 4ETPB 4GKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0A A;  4GKP A;  4ETP B;  4GKQ A; 
#chains in the Genus database with same CATH topology
 4UBF A;  2VB6 A;  4ZCA A;  1FMW A;  4ETP B;  2IEH A;  1BG2 A;  4PJN A;  4BBG A;  4FRZ A;  2G1Q A;  1VOM A;  1MMD A;  4GKQ A;  2FL6 A;  2UYM A;  2GRY A;  1GOJ A;  5GSZ A;  2VAS A;  3COB A;  3HQD A;  1MMG A;  4A51 A;  3H4S A;  1BR1 A;  2O0A A;  4A50 A;  3GBJ A;  3L1C A;  1RY6 A;  3U06 A;  4PFO A;  4AS7 A;  2NCD A;  4LNU K;  3X2T A;  1F9W A;  4PFP A;  1CZ7 A;  4Y05 A;  1BR2 A;  2ZFI A;  1X88 A;  2Q2Y A;  3LRE A;  2X7C A;  4E7Z A;  2X7D A;  4DBQ A;  4PK4 A;  2Q2Z A;  1D1C A;  1Q0B A;  2XT3 A;  1I6I A;  1VFV A;  2X51 A;  4A14 A;  1D0Y A;  4BN2 A;  4DBR A;  1MNE A;  1D0Z A;  1D1A A;  2OWM A;  1G8X A;  1MMA A;  3CJO A;  4B7B A;  3WRD A;  2MYS A;  2FL2 A;  1YRS A;  1VFX A;  1VFW A;  2X7E A;  3KAR A;  1LVK A;  3ZCW A;  3K5E A;  5LT3 A;  2WOG A;  1KK7 A;  1II6 A;  4ETP A;  1I5S A;  2UYI A;  3L9H A;  4BXN A;  5LT1 A;  2V26 A;  1FMV A;  2VVG A;  4A5Y A;  1F9V A;  4GKR A;  3CNZ A;  4AP0 A;  4PJM A;  1V8K A;  2ZFK A;  1BR4 A;  4GKP A;  2Y65 A;  2ZFJ A;  1D1B A;  3ZFC A;  1VFZ A;  4HNA K;  3KIN A;  3BFN A;  3DC4 A;  1MMN A;  1V8J A;  4E7S A;  1D0X A;  4A28 A;  2KIN A;  2GM1 A;  2ZFL A;  1SDM A;  1T5C A;  4H1G A;  2FKY A;  4PJL A;  2PG2 A;  5LT2 A;  1F9T A;  4PJJ A;  3NWN A;  3B6V A;  4A1Z A;  3DCB A;  4ANJ A;  1N6M A;  1MKJ A;  3ZFD A;  2XAE A;  1F9U A;  3B6U A;  4ZHI A;  1LKX A;  5HLE A;  2Y5W A;  3T0Q A;  3K3B A;  2HEH A;  3PXN A;  5LT4 A;  2X2R A;  5LT0 A;  3WPN A;  2FME A;  2ZFM A;  3KEN A; 
#chains in the Genus database with same CATH homology
 2O0A A;  4GKP A;  4ETP B;  4GKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...