4GKPA

Structure of the truncated neck and c-terminal motor homology domain of vik1 from candida glabrata
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
258
structure length
229
Chain Sequence
RLFANIIEDEISEKLIVNYSDESIEDMKNHKTYKFTKLIQNFSHQNKDLFKEDLHVYIDFCLKRRENFNLFSVGSSNIPNTFEKLLAFFKNNYFDKFVITLQYVMLSSQDLLSNKLKIEESTISLGSTLITLDEITDKLKKKYSNGIGLSKFQFFCLQDIEPIPIDFYFIEIYQPSIYPILKRSSPLEIVLKKIFHDTKSAFVFQIDHSAEVYDILKLSSHLSFIRNPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Spindle pole body-associated protein VIK1
publication title Neck Rotation and Neck Mimic Docking in the Noncatalytic Kar3-associated Protein Vik1.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Structural protein
total genus 64
structure length 229
sequence length 258
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 4gkpA00
4ETPB 2O0AA 4GKPA 4GKQA
chains in the Genus database with same CATH superfamily
4PJNA 3PXNA 2WOGA 4FRZA 1VFVA 4LNUK 4PK4A 4PFPA 4HNAK 1F9WA 1D1CA 2Q2ZA 4BBGA 2XAEA 2ZFJA 3WRDA 2V26A 1SDMA 2GRYA 4A51A 2UYIA 5HLEA 3T0QA 2ZFMA 1BR2A 2FL2A 1CZ7A 3K3BA 2O0AA 3DC4A 4A28A 1MMGA 1BR1A 3KARA 3CNZA 2X51A 2FL6A 1N6MA 4AS7A 2ZFKA 4DBRA 3BFNA 1F9UA 2ZFIA 4PJMA 1FMVA 1G8XA 4BXNA 4GKRA 4B7BA 3L1CA 3B6UA 3U06A 4ETPB 2PG2A 3L9HA 2Q2YA 2HEHA 1LKXA 1LVKA 2NCDA 1T5CA 3CJOA 4ANJA 1KK7A 1D1BA 3NWNA 1Q0BA 1V8KA 1MMAA 4E7ZA 4GKQA 1D0XA 4BN2A 2MYSA 2X2RA 2VASA 1RY6A 4PJJA 1MMDA 3WPNA 3K5EA 3LREA 4A14A 2X7CA 1BG2A 2X7EA 4DBQA 2KINA 2Y5WA 1V8JA 2IEHA 4PJLA 5LT2A 2FMEA 3HQDA 2XT3A 2ZFLA 2G1QA 5GSZA 4A1ZA 4PFOA 1YRSA 5LT0A 1F9VA 1FMWA 2Y65A 1VFWA 1MNEA 3COBA 3B6VA 1D0ZA 5LT3A 5LT1A 4H1GA 4UBFA 1D1AA 1I6IA 1GOJA 2OWMA 3GBJA 1MKJA 1MMNA 4ETPA 2GM1A 1VFXA 3ZFCA 5LT4A 1X88A 3H4SA 4ZHIA 2VB6A 4Y05A 4AP0A 4A50A 3KENA 1II6A 3ZCWA 4ZCAA 4E7SA 2X7DA 3DCBA 3X2TA 1VFZA 3ZFDA 3KINA 1F9TA 2VVGA 1BR4A 2FKYA 4A5YA 1VOMA 1I5SA 1D0YA 2UYMA 4GKPA
chains in the Genus database with same CATH topology
4ETPB 2O0AA 4GKPA 4GKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETP B;  2O0A A;  4GKP A;  4GKQ A; 
#chains in the Genus database with same CATH topology
 4PJN A;  3PXN A;  2WOG A;  4FRZ A;  1VFV A;  4LNU K;  4PK4 A;  4PFP A;  4HNA K;  1F9W A;  1D1C A;  2Q2Z A;  4BBG A;  2XAE A;  2ZFJ A;  3WRD A;  2V26 A;  1SDM A;  2GRY A;  4A51 A;  2UYI A;  5HLE A;  3T0Q A;  2ZFM A;  1BR2 A;  2FL2 A;  1CZ7 A;  3K3B A;  2O0A A;  3DC4 A;  4A28 A;  1MMG A;  1BR1 A;  3KAR A;  3CNZ A;  2X51 A;  2FL6 A;  1N6M A;  4AS7 A;  2ZFK A;  4DBR A;  3BFN A;  1F9U A;  2ZFI A;  4PJM A;  1FMV A;  1G8X A;  4BXN A;  4GKR A;  4B7B A;  3L1C A;  3B6U A;  3U06 A;  4ETP B;  2PG2 A;  3L9H A;  2Q2Y A;  2HEH A;  1LKX A;  1LVK A;  2NCD A;  1T5C A;  3CJO A;  4ANJ A;  1KK7 A;  1D1B A;  3NWN A;  1Q0B A;  1V8K A;  1MMA A;  4E7Z A;  4GKQ A;  1D0X A;  4BN2 A;  2MYS A;  2X2R A;  2VAS A;  1RY6 A;  4PJJ A;  1MMD A;  3WPN A;  3K5E A;  3LRE A;  4A14 A;  2X7C A;  1BG2 A;  2X7E A;  4DBQ A;  2KIN A;  2Y5W A;  1V8J A;  2IEH A;  4PJL A;  5LT2 A;  2FME A;  3HQD A;  2XT3 A;  2ZFL A;  2G1Q A;  5GSZ A;  4A1Z A;  4PFO A;  1YRS A;  5LT0 A;  1F9V A;  1FMW A;  2Y65 A;  1VFW A;  1MNE A;  3COB A;  3B6V A;  1D0Z A;  5LT3 A;  5LT1 A;  4H1G A;  4UBF A;  1D1A A;  1I6I A;  1GOJ A;  2OWM A;  3GBJ A;  1MKJ A;  1MMN A;  4ETP A;  2GM1 A;  1VFX A;  3ZFC A;  5LT4 A;  1X88 A;  3H4S A;  4ZHI A;  2VB6 A;  4Y05 A;  4AP0 A;  4A50 A;  3KEN A;  1II6 A;  3ZCW A;  4ZCA A;  4E7S A;  2X7D A;  3DCB A;  3X2T A;  1VFZ A;  3ZFD A;  3KIN A;  1F9T A;  2VVG A;  1BR4 A;  2FKY A;  4A5Y A;  1VOM A;  1I5S A;  1D0Y A;  2UYM A;  4GKP A; 
#chains in the Genus database with same CATH homology
 4ETP B;  2O0A A;  4GKP A;  4GKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...