3B6UA

Crystal structure of the motor domain of human kinesin family member 3b in complex with adp
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
341
structure length
323
Chain Sequence
ESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQFELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIECSEENHIRVGKLNLVDLAGSERLKEATKINLSLSALGNVISALVDGHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF3B
publication title Motor domain of human kinesin family member 3B in complex with ADP.
rcsb
source organism Homo sapiens
molecule tags Motor protein
total genus 111
structure length 323
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-10-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3b6uA00
2IEHA 5LT0A 3CNZA 4DBRA 1D0XA 1FMVA 4LNUK 4HNAK 3WPNA 1CZ7A 1LKXA 4ZCAA 5LT3A 5HLEA 3K3BA 4A14A 4BN2A 3GBJA 1VFZA 4ETPA 2GM1A 3U06A 4ANJA 2VVGA 1LVKA 3WRDA 3COBA 2XAEA 3ZCWA 3KINA 3T0QA 2V26A 3X2TA 4E7SA 4A5YA 4BBGA 2ZFMA 4PFOA 4A50A 4GKRA 1F9VA 2FL2A 3HQDA 2ZFKA 3NWNA 1II6A 2GRYA 1MMAA 2PG2A 2ZFIA 3B6VA 3K5EA 2VB6A 4PJNA 4AS7A 1BR2A 1BR1A 4PFPA 2NCDA 4Y05A 1SDMA 4E7ZA 2X7DA 1MMDA 2Q2ZA 2FL6A 1F9WA 4FRZA 1GOJA 1YRSA 1MMNA 5LT2A 4PK4A 4A1ZA 1FMWA 2X51A 3KENA 2WOGA 3DC4A 1V8KA 3ZFCA 5LT4A 2OWMA 3KARA 4BXNA 4B7BA 1VFVA 3PXNA 4DBQA 1D1CA 4AP0A 3B6UA 2G1QA 3DCBA 1MKJA 1VOMA 1VFXA 4H1GA 1D0ZA 2VASA 2X7CA 2ZFJA 1VFWA 3ZFDA 1MNEA 1KK7A 1Q0BA 2FKYA 3L9HA 2HEHA 5GSZA 2UYIA 2FMEA 1G8XA 2MYSA 1I5SA 1N6MA 1D1AA 1MMGA 1BG2A 2Y65A 1BR4A 1T5CA 3LREA 2X2RA 4PJJA 1F9TA 1D0YA 3BFNA 1X88A 2UYMA 2Q2YA 2ZFLA 1RY6A 1V8JA 3H4SA 2XT3A 1I6IA 1F9UA 2X7EA 3L1CA 3CJOA 4A51A 1D1BA 4PJLA 4ZHIA 4A28A 4PJMA 2KINA 2Y5WA 4UBFA 5LT1A
chains in the Genus database with same CATH superfamily
2IEHA 5LT0A 3CNZA 4DBRA 1D0XA 1FMVA 4LNUK 4HNAK 3WPNA 1CZ7A 1LKXA 4ZCAA 5LT3A 5HLEA 2O0AA 3K3BA 4A14A 4BN2A 3GBJA 1VFZA 4ETPA 2GM1A 3U06A 4ANJA 2VVGA 1LVKA 3WRDA 3COBA 2XAEA 3ZCWA 3KINA 3T0QA 2V26A 3X2TA 4E7SA 4A5YA 4BBGA 2ZFMA 4PFOA 4A50A 4GKPA 4GKRA 1F9VA 2FL2A 3HQDA 2ZFKA 3NWNA 1II6A 2GRYA 1MMAA 2PG2A 2ZFIA 3B6VA 3K5EA 2VB6A 4PJNA 4AS7A 1BR2A 1BR1A 4PFPA 2NCDA 4Y05A 1SDMA 4E7ZA 2X7DA 1MMDA 2Q2ZA 2FL6A 1F9WA 4FRZA 1GOJA 1YRSA 1MMNA 5LT2A 4PK4A 4A1ZA 1FMWA 4ETPB 2X51A 3KENA 2WOGA 3DC4A 1V8KA 3ZFCA 4GKQA 5LT4A 2OWMA 3KARA 4BXNA 4B7BA 1VFVA 3PXNA 4DBQA 1D1CA 4AP0A 3B6UA 2G1QA 3DCBA 1MKJA 1VOMA 1VFXA 4H1GA 1D0ZA 2VASA 2X7CA 2ZFJA 1VFWA 3ZFDA 1MNEA 1KK7A 1Q0BA 2FKYA 3L9HA 2HEHA 5GSZA 2UYIA 2FMEA 1G8XA 2MYSA 1I5SA 1N6MA 1D1AA 1MMGA 1BG2A 2Y65A 1BR4A 1T5CA 3LREA 2X2RA 4PJJA 1F9TA 1D0YA 3BFNA 1X88A 2UYMA 2Q2YA 2ZFLA 1RY6A 1V8JA 3H4SA 2XT3A 1I6IA 1F9UA 2X7EA 3L1CA 3CJOA 4A51A 1D1BA 4PJLA 4ZHIA 4A28A 4PJMA 2KINA 2Y5WA 4UBFA 5LT1A
chains in the Genus database with same CATH topology
2IEHA 5LT0A 3CNZA 4DBRA 1D0XA 1FMVA 4LNUK 4HNAK 3WPNA 1CZ7A 1LKXA 4ZCAA 5LT3A 5HLEA 3K3BA 4A14A 4BN2A 3GBJA 1VFZA 4ETPA 2GM1A 3U06A 4ANJA 2VVGA 1LVKA 3WRDA 3COBA 2XAEA 3ZCWA 3KINA 3T0QA 2V26A 3X2TA 4E7SA 4A5YA 4BBGA 2ZFMA 4PFOA 4A50A 4GKRA 1F9VA 2FL2A 3HQDA 2ZFKA 3NWNA 1II6A 2GRYA 1MMAA 2PG2A 2ZFIA 3B6VA 3K5EA 2VB6A 4PJNA 4AS7A 1BR2A 1BR1A 4PFPA 2NCDA 4Y05A 1SDMA 4E7ZA 2X7DA 1MMDA 2Q2ZA 2FL6A 1F9WA 4FRZA 1GOJA 1YRSA 1MMNA 5LT2A 4PK4A 4A1ZA 1FMWA 2X51A 3KENA 2WOGA 3DC4A 1V8KA 3ZFCA 5LT4A 2OWMA 3KARA 4BXNA 4B7BA 1VFVA 3PXNA 4DBQA 1D1CA 4AP0A 3B6UA 2G1QA 3DCBA 1MKJA 1VOMA 1VFXA 4H1GA 1D0ZA 2VASA 2X7CA 2ZFJA 1VFWA 3ZFDA 1MNEA 1KK7A 1Q0BA 2FKYA 3L9HA 2HEHA 5GSZA 2UYIA 2FMEA 1G8XA 2MYSA 1I5SA 1N6MA 1D1AA 1MMGA 1BG2A 2Y65A 1BR4A 1T5CA 3LREA 2X2RA 4PJJA 1F9TA 1D0YA 3BFNA 1X88A 2UYMA 2Q2YA 2ZFLA 1RY6A 1V8JA 3H4SA 2XT3A 1I6IA 1F9UA 2X7EA 3L1CA 3CJOA 4A51A 1D1BA 4PJLA 4ZHIA 4A28A 4PJMA 2KINA 2Y5WA 4UBFA 5LT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IEH A;  5LT0 A;  3CNZ A;  4DBR A;  1D0X A;  1FMV A;  4LNU K;  4HNA K;  3WPN A;  1CZ7 A;  1LKX A;  4ZCA A;  5LT3 A;  5HLE A;  3K3B A;  4A14 A;  4BN2 A;  3GBJ A;  1VFZ A;  4ETP A;  2GM1 A;  3U06 A;  4ANJ A;  2VVG A;  1LVK A;  3WRD A;  3COB A;  2XAE A;  3ZCW A;  3KIN A;  3T0Q A;  2V26 A;  3X2T A;  4E7S A;  4A5Y A;  4BBG A;  2ZFM A;  4PFO A;  4A50 A;  4GKR A;  1F9V A;  2FL2 A;  3HQD A;  2ZFK A;  3NWN A;  1II6 A;  2GRY A;  1MMA A;  2PG2 A;  2ZFI A;  3B6V A;  3K5E A;  2VB6 A;  4PJN A;  4AS7 A;  1BR2 A;  1BR1 A;  4PFP A;  2NCD A;  4Y05 A;  1SDM A;  4E7Z A;  2X7D A;  1MMD A;  2Q2Z A;  2FL6 A;  1F9W A;  4FRZ A;  1GOJ A;  1YRS A;  1MMN A;  5LT2 A;  4PK4 A;  4A1Z A;  1FMW A;  2X51 A;  3KEN A;  2WOG A;  3DC4 A;  1V8K A;  3ZFC A;  5LT4 A;  2OWM A;  3KAR A;  4BXN A;  4B7B A;  1VFV A;  3PXN A;  4DBQ A;  1D1C A;  4AP0 A;  3B6U A;  2G1Q A;  3DCB A;  1MKJ A;  1VOM A;  1VFX A;  4H1G A;  1D0Z A;  2VAS A;  2X7C A;  2ZFJ A;  1VFW A;  3ZFD A;  1MNE A;  1KK7 A;  1Q0B A;  2FKY A;  3L9H A;  2HEH A;  5GSZ A;  2UYI A;  2FME A;  1G8X A;  2MYS A;  1I5S A;  1N6M A;  1D1A A;  1MMG A;  1BG2 A;  2Y65 A;  1BR4 A;  1T5C A;  3LRE A;  2X2R A;  4PJJ A;  1F9T A;  1D0Y A;  3BFN A;  1X88 A;  2UYM A;  2Q2Y A;  2ZFL A;  1RY6 A;  1V8J A;  3H4S A;  2XT3 A;  1I6I A;  1F9U A;  2X7E A;  3L1C A;  3CJO A;  4A51 A;  1D1B A;  4PJL A;  4ZHI A;  4A28 A;  4PJM A;  2KIN A;  2Y5W A;  4UBF A;  5LT1 A; 
#chains in the Genus database with same CATH topology
 2IEH A;  5LT0 A;  3CNZ A;  4DBR A;  1D0X A;  1FMV A;  4LNU K;  4HNA K;  3WPN A;  1CZ7 A;  1LKX A;  4ZCA A;  5LT3 A;  5HLE A;  2O0A A;  3K3B A;  4A14 A;  4BN2 A;  3GBJ A;  1VFZ A;  4ETP A;  2GM1 A;  3U06 A;  4ANJ A;  2VVG A;  1LVK A;  3WRD A;  3COB A;  2XAE A;  3ZCW A;  3KIN A;  3T0Q A;  2V26 A;  3X2T A;  4E7S A;  4A5Y A;  4BBG A;  2ZFM A;  4PFO A;  4A50 A;  4GKP A;  4GKR A;  1F9V A;  2FL2 A;  3HQD A;  2ZFK A;  3NWN A;  1II6 A;  2GRY A;  1MMA A;  2PG2 A;  2ZFI A;  3B6V A;  3K5E A;  2VB6 A;  4PJN A;  4AS7 A;  1BR2 A;  1BR1 A;  4PFP A;  2NCD A;  4Y05 A;  1SDM A;  4E7Z A;  2X7D A;  1MMD A;  2Q2Z A;  2FL6 A;  1F9W A;  4FRZ A;  1GOJ A;  1YRS A;  1MMN A;  5LT2 A;  4PK4 A;  4A1Z A;  1FMW A;  4ETP B;  2X51 A;  3KEN A;  2WOG A;  3DC4 A;  1V8K A;  3ZFC A;  4GKQ A;  5LT4 A;  2OWM A;  3KAR A;  4BXN A;  4B7B A;  1VFV A;  3PXN A;  4DBQ A;  1D1C A;  4AP0 A;  3B6U A;  2G1Q A;  3DCB A;  1MKJ A;  1VOM A;  1VFX A;  4H1G A;  1D0Z A;  2VAS A;  2X7C A;  2ZFJ A;  1VFW A;  3ZFD A;  1MNE A;  1KK7 A;  1Q0B A;  2FKY A;  3L9H A;  2HEH A;  5GSZ A;  2UYI A;  2FME A;  1G8X A;  2MYS A;  1I5S A;  1N6M A;  1D1A A;  1MMG A;  1BG2 A;  2Y65 A;  1BR4 A;  1T5C A;  3LRE A;  2X2R A;  4PJJ A;  1F9T A;  1D0Y A;  3BFN A;  1X88 A;  2UYM A;  2Q2Y A;  2ZFL A;  1RY6 A;  1V8J A;  3H4S A;  2XT3 A;  1I6I A;  1F9U A;  2X7E A;  3L1C A;  3CJO A;  4A51 A;  1D1B A;  4PJL A;  4ZHI A;  4A28 A;  4PJM A;  2KIN A;  2Y5W A;  4UBF A;  5LT1 A; 
#chains in the Genus database with same CATH homology
 2IEH A;  5LT0 A;  3CNZ A;  4DBR A;  1D0X A;  1FMV A;  4LNU K;  4HNA K;  3WPN A;  1CZ7 A;  1LKX A;  4ZCA A;  5LT3 A;  5HLE A;  3K3B A;  4A14 A;  4BN2 A;  3GBJ A;  1VFZ A;  4ETP A;  2GM1 A;  3U06 A;  4ANJ A;  2VVG A;  1LVK A;  3WRD A;  3COB A;  2XAE A;  3ZCW A;  3KIN A;  3T0Q A;  2V26 A;  3X2T A;  4E7S A;  4A5Y A;  4BBG A;  2ZFM A;  4PFO A;  4A50 A;  4GKR A;  1F9V A;  2FL2 A;  3HQD A;  2ZFK A;  3NWN A;  1II6 A;  2GRY A;  1MMA A;  2PG2 A;  2ZFI A;  3B6V A;  3K5E A;  2VB6 A;  4PJN A;  4AS7 A;  1BR2 A;  1BR1 A;  4PFP A;  2NCD A;  4Y05 A;  1SDM A;  4E7Z A;  2X7D A;  1MMD A;  2Q2Z A;  2FL6 A;  1F9W A;  4FRZ A;  1GOJ A;  1YRS A;  1MMN A;  5LT2 A;  4PK4 A;  4A1Z A;  1FMW A;  2X51 A;  3KEN A;  2WOG A;  3DC4 A;  1V8K A;  3ZFC A;  5LT4 A;  2OWM A;  3KAR A;  4BXN A;  4B7B A;  1VFV A;  3PXN A;  4DBQ A;  1D1C A;  4AP0 A;  3B6U A;  2G1Q A;  3DCB A;  1MKJ A;  1VOM A;  1VFX A;  4H1G A;  1D0Z A;  2VAS A;  2X7C A;  2ZFJ A;  1VFW A;  3ZFD A;  1MNE A;  1KK7 A;  1Q0B A;  2FKY A;  3L9H A;  2HEH A;  5GSZ A;  2UYI A;  2FME A;  1G8X A;  2MYS A;  1I5S A;  1N6M A;  1D1A A;  1MMG A;  1BG2 A;  2Y65 A;  1BR4 A;  1T5C A;  3LRE A;  2X2R A;  4PJJ A;  1F9T A;  1D0Y A;  3BFN A;  1X88 A;  2UYM A;  2Q2Y A;  2ZFL A;  1RY6 A;  1V8J A;  3H4S A;  2XT3 A;  1I6I A;  1F9U A;  2X7E A;  3L1C A;  3CJO A;  4A51 A;  1D1B A;  4PJL A;  4ZHI A;  4A28 A;  4PJM A;  2KIN A;  2Y5W A;  4UBF A;  5LT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...