2ZFLA

Crystal structure of the kif1a motor domain during mg release: mg-releasing transition-3
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
353
structure length
313
Chain Sequence
ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTNMNETSSRSHAVFNIIFTQKRHDAENITTEKVSKISLVDLAGSENINKSLTTLGKVISALAFIPYRDSVLTWLLRENGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 88
structure length 313
sequence length 353
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zflA00
2ZFMA 2MYSA 3NWNA 1SDMA 3K3BA 4B7BA 4ANJA 4E7ZA 3H4SA 4FRZA 3T0QA 1I5SA 2XAEA 2FL6A 4A14A 5LT2A 1LKXA 2ZFLA 3WRDA 4ETPA 1D0XA 3PXNA 3ZFDA 3WPNA 1D0ZA 1X88A 2WOGA 4DBRA 2UYMA 2OWMA 4Y05A 2KINA 3KENA 2HEHA 4E7SA 1CZ7A 1BR2A 1MMDA 2PG2A 4PFOA 4PK4A 3ZFCA 3KINA 4PFPA 2GM1A 2Y65A 5LT0A 1YRSA 2IEHA 1D0YA 3L9HA 2X7CA 4A5YA 1VFZA 2VVGA 1BR4A 2Q2ZA 4H1GA 2G1QA 2NCDA 2ZFKA 3DC4A 1MMGA 1BG2A 1MMNA 1D1BA 1Q0BA 2FKYA 2X7EA 1VFXA 3U06A 2ZFJA 2UYIA 3X2TA 2ZFIA 3COBA 4AP0A 4DBQA 1GOJA 4HNAK 4PJMA 1V8JA 2Q2YA 3B6UA 4A28A 2VB6A 5LT3A 3LREA 1V8KA 2FMEA 2VASA 3KARA 3K5EA 3CJOA 3DCBA 3BFNA 4PJLA 1KK7A 1RY6A 4UBFA 1N6MA 1F9WA 4A50A 1VFVA 2X2RA 1BR1A 1MMAA 1VFWA 3CNZA 5HLEA 3ZCWA 4PJNA 5LT4A 5GSZA 4A1ZA 1F9VA 3B6VA 2GRYA 1I6IA 1F9UA 2X7DA 4BN2A 1VOMA 1F9TA 3HQDA 3GBJA 4A51A 1FMVA 1MKJA 2FL2A 4AS7A 4BBGA 1G8XA 2XT3A 3L1CA 4BXNA 1D1CA 1T5CA 1LVKA 1II6A 2V26A 2X51A 1D1AA 4GKRA 4LNUK 4ZHIA 1MNEA 4PJJA 1FMWA 4ZCAA 5LT1A 2Y5WA
chains in the Genus database with same CATH superfamily
2ZFMA 2MYSA 3NWNA 1SDMA 3K3BA 4B7BA 4ANJA 4E7ZA 3H4SA 4FRZA 3T0QA 1I5SA 2XAEA 2FL6A 4A14A 5LT2A 1LKXA 2ZFLA 3WRDA 4ETPA 1D0XA 3PXNA 3ZFDA 3WPNA 1D0ZA 1X88A 2WOGA 4DBRA 2UYMA 2OWMA 4Y05A 4ETPB 2KINA 3KENA 2HEHA 4E7SA 1CZ7A 1BR2A 1MMDA 2PG2A 4PFOA 4PK4A 3ZFCA 3KINA 4PFPA 2GM1A 2Y65A 5LT0A 1YRSA 2IEHA 1D0YA 3L9HA 2X7CA 4A5YA 1VFZA 2VVGA 1BR4A 2Q2ZA 4H1GA 2G1QA 2NCDA 2ZFKA 3DC4A 1MMGA 1BG2A 1MMNA 2O0AA 1D1BA 1Q0BA 2FKYA 2X7EA 1VFXA 3U06A 2ZFJA 2UYIA 3X2TA 2ZFIA 3COBA 4AP0A 4DBQA 1GOJA 4HNAK 4PJMA 1V8JA 2Q2YA 3B6UA 4A28A 2VB6A 5LT3A 3LREA 1V8KA 2FMEA 2VASA 3KARA 3K5EA 3CJOA 3DCBA 3BFNA 4PJLA 1KK7A 1RY6A 4UBFA 1N6MA 1F9WA 4A50A 1VFVA 2X2RA 1BR1A 1MMAA 1VFWA 3CNZA 5HLEA 3ZCWA 4PJNA 5LT4A 5GSZA 4A1ZA 1F9VA 3B6VA 4GKQA 2GRYA 1I6IA 1F9UA 2X7DA 4BN2A 1VOMA 1F9TA 3HQDA 3GBJA 4A51A 1FMVA 1MKJA 2FL2A 4AS7A 4BBGA 1G8XA 2XT3A 3L1CA 4BXNA 1D1CA 1T5CA 1LVKA 4GKPA 1II6A 2V26A 2X51A 1D1AA 4GKRA 4LNUK 4ZHIA 1MNEA 4PJJA 1FMWA 4ZCAA 5LT1A 2Y5WA
chains in the Genus database with same CATH topology
2ZFMA 2MYSA 3NWNA 1SDMA 3K3BA 4B7BA 4ANJA 4E7ZA 3H4SA 4FRZA 3T0QA 1I5SA 2XAEA 2FL6A 4A14A 5LT2A 1LKXA 2ZFLA 3WRDA 4ETPA 1D0XA 3PXNA 3ZFDA 3WPNA 1D0ZA 1X88A 2WOGA 4DBRA 2UYMA 2OWMA 4Y05A 2KINA 3KENA 2HEHA 4E7SA 1CZ7A 1BR2A 1MMDA 2PG2A 4PFOA 4PK4A 3ZFCA 3KINA 4PFPA 2GM1A 2Y65A 5LT0A 1YRSA 2IEHA 1D0YA 3L9HA 2X7CA 4A5YA 1VFZA 2VVGA 1BR4A 2Q2ZA 4H1GA 2G1QA 2NCDA 2ZFKA 3DC4A 1MMGA 1BG2A 1MMNA 1D1BA 1Q0BA 2FKYA 2X7EA 1VFXA 3U06A 2ZFJA 2UYIA 3X2TA 2ZFIA 3COBA 4AP0A 4DBQA 1GOJA 4HNAK 4PJMA 1V8JA 2Q2YA 3B6UA 4A28A 2VB6A 5LT3A 3LREA 1V8KA 2FMEA 2VASA 3KARA 3K5EA 3CJOA 3DCBA 3BFNA 4PJLA 1KK7A 1RY6A 4UBFA 1N6MA 1F9WA 4A50A 1VFVA 2X2RA 1BR1A 1MMAA 1VFWA 3CNZA 5HLEA 3ZCWA 4PJNA 5LT4A 5GSZA 4A1ZA 1F9VA 3B6VA 2GRYA 1I6IA 1F9UA 2X7DA 4BN2A 1VOMA 1F9TA 3HQDA 3GBJA 4A51A 1FMVA 1MKJA 2FL2A 4AS7A 4BBGA 1G8XA 2XT3A 3L1CA 4BXNA 1D1CA 1T5CA 1LVKA 1II6A 2V26A 2X51A 1D1AA 4GKRA 4LNUK 4ZHIA 1MNEA 4PJJA 1FMWA 4ZCAA 5LT1A 2Y5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFM A;  2MYS A;  3NWN A;  1SDM A;  3K3B A;  4B7B A;  4ANJ A;  4E7Z A;  3H4S A;  4FRZ A;  3T0Q A;  1I5S A;  2XAE A;  2FL6 A;  4A14 A;  5LT2 A;  1LKX A;  2ZFL A;  3WRD A;  4ETP A;  1D0X A;  3PXN A;  3ZFD A;  3WPN A;  1D0Z A;  1X88 A;  2WOG A;  4DBR A;  2UYM A;  2OWM A;  4Y05 A;  2KIN A;  3KEN A;  2HEH A;  4E7S A;  1CZ7 A;  1BR2 A;  1MMD A;  2PG2 A;  4PFO A;  4PK4 A;  3ZFC A;  3KIN A;  4PFP A;  2GM1 A;  2Y65 A;  5LT0 A;  1YRS A;  2IEH A;  1D0Y A;  3L9H A;  2X7C A;  4A5Y A;  1VFZ A;  2VVG A;  1BR4 A;  2Q2Z A;  4H1G A;  2G1Q A;  2NCD A;  2ZFK A;  3DC4 A;  1MMG A;  1BG2 A;  1MMN A;  1D1B A;  1Q0B A;  2FKY A;  2X7E A;  1VFX A;  3U06 A;  2ZFJ A;  2UYI A;  3X2T A;  2ZFI A;  3COB A;  4AP0 A;  4DBQ A;  1GOJ A;  4HNA K;  4PJM A;  1V8J A;  2Q2Y A;  3B6U A;  4A28 A;  2VB6 A;  5LT3 A;  3LRE A;  1V8K A;  2FME A;  2VAS A;  3KAR A;  3K5E A;  3CJO A;  3DCB A;  3BFN A;  4PJL A;  1KK7 A;  1RY6 A;  4UBF A;  1N6M A;  1F9W A;  4A50 A;  1VFV A;  2X2R A;  1BR1 A;  1MMA A;  1VFW A;  3CNZ A;  5HLE A;  3ZCW A;  4PJN A;  5LT4 A;  5GSZ A;  4A1Z A;  1F9V A;  3B6V A;  2GRY A;  1I6I A;  1F9U A;  2X7D A;  4BN2 A;  1VOM A;  1F9T A;  3HQD A;  3GBJ A;  4A51 A;  1FMV A;  1MKJ A;  2FL2 A;  4AS7 A;  4BBG A;  1G8X A;  2XT3 A;  3L1C A;  4BXN A;  1D1C A;  1T5C A;  1LVK A;  1II6 A;  2V26 A;  2X51 A;  1D1A A;  4GKR A;  4LNU K;  4ZHI A;  1MNE A;  4PJJ A;  1FMW A;  4ZCA A;  5LT1 A;  2Y5W A; 
#chains in the Genus database with same CATH topology
 2ZFM A;  2MYS A;  3NWN A;  1SDM A;  3K3B A;  4B7B A;  4ANJ A;  4E7Z A;  3H4S A;  4FRZ A;  3T0Q A;  1I5S A;  2XAE A;  2FL6 A;  4A14 A;  5LT2 A;  1LKX A;  2ZFL A;  3WRD A;  4ETP A;  1D0X A;  3PXN A;  3ZFD A;  3WPN A;  1D0Z A;  1X88 A;  2WOG A;  4DBR A;  2UYM A;  2OWM A;  4Y05 A;  4ETP B;  2KIN A;  3KEN A;  2HEH A;  4E7S A;  1CZ7 A;  1BR2 A;  1MMD A;  2PG2 A;  4PFO A;  4PK4 A;  3ZFC A;  3KIN A;  4PFP A;  2GM1 A;  2Y65 A;  5LT0 A;  1YRS A;  2IEH A;  1D0Y A;  3L9H A;  2X7C A;  4A5Y A;  1VFZ A;  2VVG A;  1BR4 A;  2Q2Z A;  4H1G A;  2G1Q A;  2NCD A;  2ZFK A;  3DC4 A;  1MMG A;  1BG2 A;  1MMN A;  2O0A A;  1D1B A;  1Q0B A;  2FKY A;  2X7E A;  1VFX A;  3U06 A;  2ZFJ A;  2UYI A;  3X2T A;  2ZFI A;  3COB A;  4AP0 A;  4DBQ A;  1GOJ A;  4HNA K;  4PJM A;  1V8J A;  2Q2Y A;  3B6U A;  4A28 A;  2VB6 A;  5LT3 A;  3LRE A;  1V8K A;  2FME A;  2VAS A;  3KAR A;  3K5E A;  3CJO A;  3DCB A;  3BFN A;  4PJL A;  1KK7 A;  1RY6 A;  4UBF A;  1N6M A;  1F9W A;  4A50 A;  1VFV A;  2X2R A;  1BR1 A;  1MMA A;  1VFW A;  3CNZ A;  5HLE A;  3ZCW A;  4PJN A;  5LT4 A;  5GSZ A;  4A1Z A;  1F9V A;  3B6V A;  4GKQ A;  2GRY A;  1I6I A;  1F9U A;  2X7D A;  4BN2 A;  1VOM A;  1F9T A;  3HQD A;  3GBJ A;  4A51 A;  1FMV A;  1MKJ A;  2FL2 A;  4AS7 A;  4BBG A;  1G8X A;  2XT3 A;  3L1C A;  4BXN A;  1D1C A;  1T5C A;  1LVK A;  4GKP A;  1II6 A;  2V26 A;  2X51 A;  1D1A A;  4GKR A;  4LNU K;  4ZHI A;  1MNE A;  4PJJ A;  1FMW A;  4ZCA A;  5LT1 A;  2Y5W A; 
#chains in the Genus database with same CATH homology
 2ZFM A;  2MYS A;  3NWN A;  1SDM A;  3K3B A;  4B7B A;  4ANJ A;  4E7Z A;  3H4S A;  4FRZ A;  3T0Q A;  1I5S A;  2XAE A;  2FL6 A;  4A14 A;  5LT2 A;  1LKX A;  2ZFL A;  3WRD A;  4ETP A;  1D0X A;  3PXN A;  3ZFD A;  3WPN A;  1D0Z A;  1X88 A;  2WOG A;  4DBR A;  2UYM A;  2OWM A;  4Y05 A;  2KIN A;  3KEN A;  2HEH A;  4E7S A;  1CZ7 A;  1BR2 A;  1MMD A;  2PG2 A;  4PFO A;  4PK4 A;  3ZFC A;  3KIN A;  4PFP A;  2GM1 A;  2Y65 A;  5LT0 A;  1YRS A;  2IEH A;  1D0Y A;  3L9H A;  2X7C A;  4A5Y A;  1VFZ A;  2VVG A;  1BR4 A;  2Q2Z A;  4H1G A;  2G1Q A;  2NCD A;  2ZFK A;  3DC4 A;  1MMG A;  1BG2 A;  1MMN A;  1D1B A;  1Q0B A;  2FKY A;  2X7E A;  1VFX A;  3U06 A;  2ZFJ A;  2UYI A;  3X2T A;  2ZFI A;  3COB A;  4AP0 A;  4DBQ A;  1GOJ A;  4HNA K;  4PJM A;  1V8J A;  2Q2Y A;  3B6U A;  4A28 A;  2VB6 A;  5LT3 A;  3LRE A;  1V8K A;  2FME A;  2VAS A;  3KAR A;  3K5E A;  3CJO A;  3DCB A;  3BFN A;  4PJL A;  1KK7 A;  1RY6 A;  4UBF A;  1N6M A;  1F9W A;  4A50 A;  1VFV A;  2X2R A;  1BR1 A;  1MMA A;  1VFW A;  3CNZ A;  5HLE A;  3ZCW A;  4PJN A;  5LT4 A;  5GSZ A;  4A1Z A;  1F9V A;  3B6V A;  2GRY A;  1I6I A;  1F9U A;  2X7D A;  4BN2 A;  1VOM A;  1F9T A;  3HQD A;  3GBJ A;  4A51 A;  1FMV A;  1MKJ A;  2FL2 A;  4AS7 A;  4BBG A;  1G8X A;  2XT3 A;  3L1C A;  4BXN A;  1D1C A;  1T5C A;  1LVK A;  1II6 A;  2V26 A;  2X51 A;  1D1A A;  4GKR A;  4LNU K;  4ZHI A;  1MNE A;  4PJJ A;  1FMW A;  4ZCA A;  5LT1 A;  2Y5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...