2ZFIA

Crystal structure of the kif1a motor domain before mg release
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
329
Chain Sequence
b'ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATNMNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERAGTRLKEGANINKSLTTLGKVISALAEMDIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 110
structure length 329
sequence length 349
ec nomenclature
pdb deposition date 2008-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfiA00
4ANJA 1G8XA 1I5SA 3KENA 2IEHA 3KINA 4BN2A 3KARA 4PFPA 1LVKA 1CZ7A 2VB6A 4PJNA 1SDMA 4A28A 1VFVA 1F9UA 4A14A 1YRSA 3PXNA 1D1CA 2G1QA 3X2TA 4FRZA 3GBJA 3WRDA 1D1BA 3NWNA 1V8JA 1VFWA 4H1GA 2KINA 4ZCAA 3T0QA 2PG2A 5GSZA 2UYMA 3ZFDA 1D0YA 5LT3A 2GRYA 1BR1A 1FMVA 2UYIA 3CJOA 1VOMA 2V26A 4A51A 4DBRA 4PJJA 4PFOA 4HNAK 1MNEA 3BFNA 2GM1A 2VASA 4PK4A 4B7BA 3DCBA 2Y65A 4BBGA 3B6UA 1V8KA 1D0XA 4BXNA 2ZFKA 1F9TA 1MMNA 1KK7A 4GKRA 4AS7A 4DBQA 2X7DA 5LT1A 2ZFMA 2Y5WA 4LNUK 1VFXA 1II6A 4PJMA 4UBFA 3K5EA 1X88A 3CNZA 1Q0BA 2ZFIA 5LT0A 3LREA 2ZFJA 2WOGA 1T5CA 1MMDA 2FL2A 4A50A 2Q2YA 1MKJA 3L1CA 2XT3A 1MMAA 5LT2A 4PJLA 3COBA 3K3BA 1F9VA 5LT4A 2OWMA 2X2RA 1GOJA 2NCDA 1LKXA 3B6VA 1D0ZA 2VVGA 4ETPA 3U06A 4E7SA 3ZFCA 1F9WA 3WPNA 2XAEA 3DC4A 1I6IA 1FMWA 1D1AA 3L9HA 4ZHIA 1VFZA 4A5YA 1BR4A 1N6MA 4AP0A 2FMEA 5HLEA 2X7EA 3H4SA 1BG2A 4A1ZA 3HQDA 1RY6A 3ZCWA 1BR2A 2ZFLA 4Y05A 2Q2ZA 2X51A 2FKYA 1MMGA 2HEHA 2X7CA 2FL6A 2MYSA 4E7ZA
chains in the Genus database with same CATH superfamily
4ANJA 1G8XA 1I5SA 3KENA 2IEHA 3KINA 4BN2A 3KARA 4PFPA 1LVKA 1CZ7A 2VB6A 4PJNA 1SDMA 4A28A 1VFVA 1F9UA 4A14A 1YRSA 3PXNA 1D1CA 2G1QA 3X2TA 4FRZA 3GBJA 3WRDA 1D1BA 3NWNA 1V8JA 1VFWA 4H1GA 2KINA 4ZCAA 3T0QA 2PG2A 4ETPB 5GSZA 2UYMA 3ZFDA 1D0YA 5LT3A 2GRYA 1BR1A 1FMVA 2UYIA 3CJOA 1VOMA 2V26A 4A51A 4DBRA 4PJJA 4PFOA 4HNAK 1MNEA 3BFNA 2GM1A 2VASA 4PK4A 4GKQA 4B7BA 3DCBA 2Y65A 4BBGA 3B6UA 1V8KA 1D0XA 4BXNA 2ZFKA 1F9TA 2O0AA 1MMNA 1KK7A 4GKRA 4AS7A 4DBQA 2X7DA 5LT1A 2ZFMA 2Y5WA 4LNUK 1VFXA 1II6A 4PJMA 4UBFA 3K5EA 1X88A 3CNZA 1Q0BA 2ZFIA 5LT0A 3LREA 2ZFJA 2WOGA 1T5CA 1MMDA 2FL2A 4A50A 2Q2YA 1MKJA 3L1CA 2XT3A 1MMAA 5LT2A 4PJLA 3COBA 3K3BA 1F9VA 4GKPA 5LT4A 2OWMA 2X2RA 1GOJA 2NCDA 1LKXA 3B6VA 1D0ZA 2VVGA 4ETPA 3U06A 4E7SA 3ZFCA 1F9WA 3WPNA 2XAEA 3DC4A 1I6IA 1FMWA 1D1AA 3L9HA 4ZHIA 1VFZA 4A5YA 1BR4A 1N6MA 4AP0A 2FMEA 5HLEA 2X7EA 3H4SA 1BG2A 4A1ZA 3HQDA 1RY6A 3ZCWA 1BR2A 2ZFLA 4Y05A 2Q2ZA 2X51A 2FKYA 1MMGA 2HEHA 2X7CA 2FL6A 2MYSA 4E7ZA
chains in the Genus database with same CATH topology
4ANJA 1G8XA 1I5SA 3KENA 2IEHA 3KINA 4BN2A 3KARA 4PFPA 1LVKA 1CZ7A 2VB6A 4PJNA 1SDMA 4A28A 1VFVA 1F9UA 4A14A 1YRSA 3PXNA 1D1CA 2G1QA 3X2TA 4FRZA 3GBJA 3WRDA 1D1BA 3NWNA 1V8JA 1VFWA 4H1GA 2KINA 4ZCAA 3T0QA 2PG2A 5GSZA 2UYMA 3ZFDA 1D0YA 5LT3A 2GRYA 1BR1A 1FMVA 2UYIA 3CJOA 1VOMA 2V26A 4A51A 4DBRA 4PJJA 4PFOA 4HNAK 1MNEA 3BFNA 2GM1A 2VASA 4PK4A 4B7BA 3DCBA 2Y65A 4BBGA 3B6UA 1V8KA 1D0XA 4BXNA 2ZFKA 1F9TA 1MMNA 1KK7A 4GKRA 4AS7A 4DBQA 2X7DA 5LT1A 2ZFMA 2Y5WA 4LNUK 1VFXA 1II6A 4PJMA 4UBFA 3K5EA 1X88A 3CNZA 1Q0BA 2ZFIA 5LT0A 3LREA 2ZFJA 2WOGA 1T5CA 1MMDA 2FL2A 4A50A 2Q2YA 1MKJA 3L1CA 2XT3A 1MMAA 5LT2A 4PJLA 3COBA 3K3BA 1F9VA 5LT4A 2OWMA 2X2RA 1GOJA 2NCDA 1LKXA 3B6VA 1D0ZA 2VVGA 4ETPA 3U06A 4E7SA 3ZFCA 1F9WA 3WPNA 2XAEA 3DC4A 1I6IA 1FMWA 1D1AA 3L9HA 4ZHIA 1VFZA 4A5YA 1BR4A 1N6MA 4AP0A 2FMEA 5HLEA 2X7EA 3H4SA 1BG2A 4A1ZA 3HQDA 1RY6A 3ZCWA 1BR2A 2ZFLA 4Y05A 2Q2ZA 2X51A 2FKYA 1MMGA 2HEHA 2X7CA 2FL6A 2MYSA 4E7ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ANJ A;  1G8X A;  1I5S A;  3KEN A;  2IEH A;  3KIN A;  4BN2 A;  3KAR A;  4PFP A;  1LVK A;  1CZ7 A;  2VB6 A;  4PJN A;  1SDM A;  4A28 A;  1VFV A;  1F9U A;  4A14 A;  1YRS A;  3PXN A;  1D1C A;  2G1Q A;  3X2T A;  4FRZ A;  3GBJ A;  3WRD A;  1D1B A;  3NWN A;  1V8J A;  1VFW A;  4H1G A;  2KIN A;  4ZCA A;  3T0Q A;  2PG2 A;  5GSZ A;  2UYM A;  3ZFD A;  1D0Y A;  5LT3 A;  2GRY A;  1BR1 A;  1FMV A;  2UYI A;  3CJO A;  1VOM A;  2V26 A;  4A51 A;  4DBR A;  4PJJ A;  4PFO A;  4HNA K;  1MNE A;  3BFN A;  2GM1 A;  2VAS A;  4PK4 A;  4B7B A;  3DCB A;  2Y65 A;  4BBG A;  3B6U A;  1V8K A;  1D0X A;  4BXN A;  2ZFK A;  1F9T A;  1MMN A;  1KK7 A;  4GKR A;  4AS7 A;  4DBQ A;  2X7D A;  5LT1 A;  2ZFM A;  2Y5W A;  4LNU K;  1VFX A;  1II6 A;  4PJM A;  4UBF A;  3K5E A;  1X88 A;  3CNZ A;  1Q0B A;  2ZFI A;  5LT0 A;  3LRE A;  2ZFJ A;  2WOG A;  1T5C A;  1MMD A;  2FL2 A;  4A50 A;  2Q2Y A;  1MKJ A;  3L1C A;  2XT3 A;  1MMA A;  5LT2 A;  4PJL A;  3COB A;  3K3B A;  1F9V A;  5LT4 A;  2OWM A;  2X2R A;  1GOJ A;  2NCD A;  1LKX A;  3B6V A;  1D0Z A;  2VVG A;  4ETP A;  3U06 A;  4E7S A;  3ZFC A;  1F9W A;  3WPN A;  2XAE A;  3DC4 A;  1I6I A;  1FMW A;  1D1A A;  3L9H A;  4ZHI A;  1VFZ A;  4A5Y A;  1BR4 A;  1N6M A;  4AP0 A;  2FME A;  5HLE A;  2X7E A;  3H4S A;  1BG2 A;  4A1Z A;  3HQD A;  1RY6 A;  3ZCW A;  1BR2 A;  2ZFL A;  4Y05 A;  2Q2Z A;  2X51 A;  2FKY A;  1MMG A;  2HEH A;  2X7C A;  2FL6 A;  2MYS A;  4E7Z A; 
#chains in the Genus database with same CATH topology
 4ANJ A;  1G8X A;  1I5S A;  3KEN A;  2IEH A;  3KIN A;  4BN2 A;  3KAR A;  4PFP A;  1LVK A;  1CZ7 A;  2VB6 A;  4PJN A;  1SDM A;  4A28 A;  1VFV A;  1F9U A;  4A14 A;  1YRS A;  3PXN A;  1D1C A;  2G1Q A;  3X2T A;  4FRZ A;  3GBJ A;  3WRD A;  1D1B A;  3NWN A;  1V8J A;  1VFW A;  4H1G A;  2KIN A;  4ZCA A;  3T0Q A;  2PG2 A;  4ETP B;  5GSZ A;  2UYM A;  3ZFD A;  1D0Y A;  5LT3 A;  2GRY A;  1BR1 A;  1FMV A;  2UYI A;  3CJO A;  1VOM A;  2V26 A;  4A51 A;  4DBR A;  4PJJ A;  4PFO A;  4HNA K;  1MNE A;  3BFN A;  2GM1 A;  2VAS A;  4PK4 A;  4GKQ A;  4B7B A;  3DCB A;  2Y65 A;  4BBG A;  3B6U A;  1V8K A;  1D0X A;  4BXN A;  2ZFK A;  1F9T A;  2O0A A;  1MMN A;  1KK7 A;  4GKR A;  4AS7 A;  4DBQ A;  2X7D A;  5LT1 A;  2ZFM A;  2Y5W A;  4LNU K;  1VFX A;  1II6 A;  4PJM A;  4UBF A;  3K5E A;  1X88 A;  3CNZ A;  1Q0B A;  2ZFI A;  5LT0 A;  3LRE A;  2ZFJ A;  2WOG A;  1T5C A;  1MMD A;  2FL2 A;  4A50 A;  2Q2Y A;  1MKJ A;  3L1C A;  2XT3 A;  1MMA A;  5LT2 A;  4PJL A;  3COB A;  3K3B A;  1F9V A;  4GKP A;  5LT4 A;  2OWM A;  2X2R A;  1GOJ A;  2NCD A;  1LKX A;  3B6V A;  1D0Z A;  2VVG A;  4ETP A;  3U06 A;  4E7S A;  3ZFC A;  1F9W A;  3WPN A;  2XAE A;  3DC4 A;  1I6I A;  1FMW A;  1D1A A;  3L9H A;  4ZHI A;  1VFZ A;  4A5Y A;  1BR4 A;  1N6M A;  4AP0 A;  2FME A;  5HLE A;  2X7E A;  3H4S A;  1BG2 A;  4A1Z A;  3HQD A;  1RY6 A;  3ZCW A;  1BR2 A;  2ZFL A;  4Y05 A;  2Q2Z A;  2X51 A;  2FKY A;  1MMG A;  2HEH A;  2X7C A;  2FL6 A;  2MYS A;  4E7Z A; 
#chains in the Genus database with same CATH homology
 4ANJ A;  1G8X A;  1I5S A;  3KEN A;  2IEH A;  3KIN A;  4BN2 A;  3KAR A;  4PFP A;  1LVK A;  1CZ7 A;  2VB6 A;  4PJN A;  1SDM A;  4A28 A;  1VFV A;  1F9U A;  4A14 A;  1YRS A;  3PXN A;  1D1C A;  2G1Q A;  3X2T A;  4FRZ A;  3GBJ A;  3WRD A;  1D1B A;  3NWN A;  1V8J A;  1VFW A;  4H1G A;  2KIN A;  4ZCA A;  3T0Q A;  2PG2 A;  5GSZ A;  2UYM A;  3ZFD A;  1D0Y A;  5LT3 A;  2GRY A;  1BR1 A;  1FMV A;  2UYI A;  3CJO A;  1VOM A;  2V26 A;  4A51 A;  4DBR A;  4PJJ A;  4PFO A;  4HNA K;  1MNE A;  3BFN A;  2GM1 A;  2VAS A;  4PK4 A;  4B7B A;  3DCB A;  2Y65 A;  4BBG A;  3B6U A;  1V8K A;  1D0X A;  4BXN A;  2ZFK A;  1F9T A;  1MMN A;  1KK7 A;  4GKR A;  4AS7 A;  4DBQ A;  2X7D A;  5LT1 A;  2ZFM A;  2Y5W A;  4LNU K;  1VFX A;  1II6 A;  4PJM A;  4UBF A;  3K5E A;  1X88 A;  3CNZ A;  1Q0B A;  2ZFI A;  5LT0 A;  3LRE A;  2ZFJ A;  2WOG A;  1T5C A;  1MMD A;  2FL2 A;  4A50 A;  2Q2Y A;  1MKJ A;  3L1C A;  2XT3 A;  1MMA A;  5LT2 A;  4PJL A;  3COB A;  3K3B A;  1F9V A;  5LT4 A;  2OWM A;  2X2R A;  1GOJ A;  2NCD A;  1LKX A;  3B6V A;  1D0Z A;  2VVG A;  4ETP A;  3U06 A;  4E7S A;  3ZFC A;  1F9W A;  3WPN A;  2XAE A;  3DC4 A;  1I6I A;  1FMW A;  1D1A A;  3L9H A;  4ZHI A;  1VFZ A;  4A5Y A;  1BR4 A;  1N6M A;  4AP0 A;  2FME A;  5HLE A;  2X7E A;  3H4S A;  1BG2 A;  4A1Z A;  3HQD A;  1RY6 A;  3ZCW A;  1BR2 A;  2ZFL A;  4Y05 A;  2Q2Z A;  2X51 A;  2FKY A;  1MMG A;  2HEH A;  2X7C A;  2FL6 A;  2MYS A;  4E7Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...