1VFWA

Crystal structure of the kif1a motor domain complexed with mg-amppnp
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
359
structure length
329
Chain Sequence
b'ASVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVAATTSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSERGANINKSLTTLGKVISALAEMDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIRNTVSVNH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (Fusion protein consisting of Kinesin-like protein K
publication title KIF1A Alternately Uses Two Loops to Bind Microtubules
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 102
structure length 329
sequence length 359
ec nomenclature
pdb deposition date 2004-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 1vfwA00
1BG2A 5GSZA 4AS7A 2VASA 4A1ZA 3H4SA 2ZFLA 2XT3A 3B6UA 3K5EA 4H1GA 3L1CA 4UBFA 4E7SA 4BXNA 5LT3A 1FMVA 3U06A 2UYIA 3L9HA 4A14A 1SDMA 1CZ7A 2X51A 3CJOA 1LKXA 2FL6A 3LREA 2ZFKA 1F9TA 3HQDA 3X2TA 1VFVA 1FMWA 4BN2A 2X2RA 4Y05A 2V26A 4E7ZA 4A28A 1VFXA 2VVGA 5LT2A 4A5YA 2IEHA 1MMNA 4HNAK 2Q2YA 3DC4A 1D0YA 1YRSA 1I6IA 2KINA 4DBQA 4AP0A 4BBGA 4PK4A 3ZFDA 1BR1A 1V8JA 1V8KA 4B7BA 1N6MA 1KK7A 1BR2A 1BR4A 4ZCAA 1RY6A 5HLEA 3WRDA 2ZFMA 1F9WA 1MMGA 1VFWA 4PJNA 2Q2ZA 3WPNA 2GM1A 3KARA 3ZFCA 1VFZA 1II6A 1G8XA 3CNZA 1MKJA 4GKRA 2ZFJA 1D1AA 3NWNA 1D0XA 4PJJA 2NCDA 4FRZA 5LT4A 3PXNA 2HEHA 2G1QA 1MMAA 2X7CA 3KENA 4LNUK 4PJLA 2FL2A 1D1BA 4A51A 2FKYA 1F9UA 4ZHIA 3COBA 1T5CA 1D0ZA 5LT1A 2FMEA 1MMDA 2VB6A 2Y5WA 3B6VA 4PJMA 1LVKA 4DBRA 1VOMA 3T0QA 4PFPA 4PFOA 1MNEA 2Y65A 1F9VA 1GOJA 3DCBA 5LT0A 2OWMA 1I5SA 1Q0BA 3KINA 4A50A 2X7EA 4ANJA 3K3BA 4ETPA 1D1CA 2GRYA 2UYMA 2PG2A 1X88A 2X7DA 2ZFIA 2WOGA 3BFNA 2XAEA 2MYSA 3ZCWA 3GBJA
chains in the Genus database with same CATH superfamily
1BG2A 5GSZA 4AS7A 2VASA 4A1ZA 3H4SA 2ZFLA 2XT3A 3B6UA 3K5EA 4H1GA 3L1CA 4UBFA 4E7SA 4BXNA 5LT3A 1FMVA 3U06A 2UYIA 3L9HA 4A14A 1SDMA 1CZ7A 2X51A 3CJOA 1LKXA 2FL6A 3LREA 2ZFKA 1F9TA 3HQDA 3X2TA 1VFVA 1FMWA 2O0AA 4BN2A 2X2RA 4Y05A 2V26A 4E7ZA 4A28A 1VFXA 2VVGA 5LT2A 4A5YA 2IEHA 1MMNA 4HNAK 2Q2YA 3DC4A 1D0YA 1YRSA 1I6IA 2KINA 4DBQA 4AP0A 4BBGA 4PK4A 3ZFDA 1BR1A 1V8JA 1V8KA 4B7BA 1N6MA 1KK7A 1BR2A 1BR4A 4GKPA 4ZCAA 1RY6A 5HLEA 3WRDA 2ZFMA 1F9WA 1MMGA 1VFWA 4PJNA 2Q2ZA 3WPNA 2GM1A 3KARA 3ZFCA 1VFZA 1II6A 1G8XA 3CNZA 1MKJA 4GKRA 2ZFJA 1D1AA 3NWNA 1D0XA 4PJJA 2NCDA 4FRZA 5LT4A 3PXNA 2HEHA 2G1QA 1MMAA 2X7CA 3KENA 4GKQA 4LNUK 4PJLA 2FL2A 1D1BA 4A51A 2FKYA 1F9UA 4ZHIA 3COBA 1T5CA 1D0ZA 5LT1A 2FMEA 1MMDA 2VB6A 2Y5WA 3B6VA 4PJMA 1LVKA 4DBRA 4ETPB 1VOMA 3T0QA 4PFPA 4PFOA 1MNEA 2Y65A 1F9VA 1GOJA 3DCBA 5LT0A 2OWMA 1I5SA 1Q0BA 3KINA 4A50A 2X7EA 4ANJA 3K3BA 4ETPA 1D1CA 2GRYA 2UYMA 2PG2A 1X88A 2X7DA 2ZFIA 2WOGA 3BFNA 2XAEA 2MYSA 3ZCWA 3GBJA
chains in the Genus database with same CATH topology
1BG2A 5GSZA 4AS7A 2VASA 4A1ZA 3H4SA 2ZFLA 2XT3A 3B6UA 3K5EA 4H1GA 3L1CA 4UBFA 4E7SA 4BXNA 5LT3A 1FMVA 3U06A 2UYIA 3L9HA 4A14A 1SDMA 1CZ7A 2X51A 3CJOA 1LKXA 2FL6A 3LREA 2ZFKA 1F9TA 3HQDA 3X2TA 1VFVA 1FMWA 4BN2A 2X2RA 4Y05A 2V26A 4E7ZA 4A28A 1VFXA 2VVGA 5LT2A 4A5YA 2IEHA 1MMNA 4HNAK 2Q2YA 3DC4A 1D0YA 1YRSA 1I6IA 2KINA 4DBQA 4AP0A 4BBGA 4PK4A 3ZFDA 1BR1A 1V8JA 1V8KA 4B7BA 1N6MA 1KK7A 1BR2A 1BR4A 4ZCAA 1RY6A 5HLEA 3WRDA 2ZFMA 1F9WA 1MMGA 1VFWA 4PJNA 2Q2ZA 3WPNA 2GM1A 3KARA 3ZFCA 1VFZA 1II6A 1G8XA 3CNZA 1MKJA 4GKRA 2ZFJA 1D1AA 3NWNA 1D0XA 4PJJA 2NCDA 4FRZA 5LT4A 3PXNA 2HEHA 2G1QA 1MMAA 2X7CA 3KENA 4LNUK 4PJLA 2FL2A 1D1BA 4A51A 2FKYA 1F9UA 4ZHIA 3COBA 1T5CA 1D0ZA 5LT1A 2FMEA 1MMDA 2VB6A 2Y5WA 3B6VA 4PJMA 1LVKA 4DBRA 1VOMA 3T0QA 4PFPA 4PFOA 1MNEA 2Y65A 1F9VA 1GOJA 3DCBA 5LT0A 2OWMA 1I5SA 1Q0BA 3KINA 4A50A 2X7EA 4ANJA 3K3BA 4ETPA 1D1CA 2GRYA 2UYMA 2PG2A 1X88A 2X7DA 2ZFIA 2WOGA 3BFNA 2XAEA 2MYSA 3ZCWA 3GBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BG2 A;  5GSZ A;  4AS7 A;  2VAS A;  4A1Z A;  3H4S A;  2ZFL A;  2XT3 A;  3B6U A;  3K5E A;  4H1G A;  3L1C A;  4UBF A;  4E7S A;  4BXN A;  5LT3 A;  1FMV A;  3U06 A;  2UYI A;  3L9H A;  4A14 A;  1SDM A;  1CZ7 A;  2X51 A;  3CJO A;  1LKX A;  2FL6 A;  3LRE A;  2ZFK A;  1F9T A;  3HQD A;  3X2T A;  1VFV A;  1FMW A;  4BN2 A;  2X2R A;  4Y05 A;  2V26 A;  4E7Z A;  4A28 A;  1VFX A;  2VVG A;  5LT2 A;  4A5Y A;  2IEH A;  1MMN A;  4HNA K;  2Q2Y A;  3DC4 A;  1D0Y A;  1YRS A;  1I6I A;  2KIN A;  4DBQ A;  4AP0 A;  4BBG A;  4PK4 A;  3ZFD A;  1BR1 A;  1V8J A;  1V8K A;  4B7B A;  1N6M A;  1KK7 A;  1BR2 A;  1BR4 A;  4ZCA A;  1RY6 A;  5HLE A;  3WRD A;  2ZFM A;  1F9W A;  1MMG A;  1VFW A;  4PJN A;  2Q2Z A;  3WPN A;  2GM1 A;  3KAR A;  3ZFC A;  1VFZ A;  1II6 A;  1G8X A;  3CNZ A;  1MKJ A;  4GKR A;  2ZFJ A;  1D1A A;  3NWN A;  1D0X A;  4PJJ A;  2NCD A;  4FRZ A;  5LT4 A;  3PXN A;  2HEH A;  2G1Q A;  1MMA A;  2X7C A;  3KEN A;  4LNU K;  4PJL A;  2FL2 A;  1D1B A;  4A51 A;  2FKY A;  1F9U A;  4ZHI A;  3COB A;  1T5C A;  1D0Z A;  5LT1 A;  2FME A;  1MMD A;  2VB6 A;  2Y5W A;  3B6V A;  4PJM A;  1LVK A;  4DBR A;  1VOM A;  3T0Q A;  4PFP A;  4PFO A;  1MNE A;  2Y65 A;  1F9V A;  1GOJ A;  3DCB A;  5LT0 A;  2OWM A;  1I5S A;  1Q0B A;  3KIN A;  4A50 A;  2X7E A;  4ANJ A;  3K3B A;  4ETP A;  1D1C A;  2GRY A;  2UYM A;  2PG2 A;  1X88 A;  2X7D A;  2ZFI A;  2WOG A;  3BFN A;  2XAE A;  2MYS A;  3ZCW A;  3GBJ A; 
#chains in the Genus database with same CATH topology
 1BG2 A;  5GSZ A;  4AS7 A;  2VAS A;  4A1Z A;  3H4S A;  2ZFL A;  2XT3 A;  3B6U A;  3K5E A;  4H1G A;  3L1C A;  4UBF A;  4E7S A;  4BXN A;  5LT3 A;  1FMV A;  3U06 A;  2UYI A;  3L9H A;  4A14 A;  1SDM A;  1CZ7 A;  2X51 A;  3CJO A;  1LKX A;  2FL6 A;  3LRE A;  2ZFK A;  1F9T A;  3HQD A;  3X2T A;  1VFV A;  1FMW A;  2O0A A;  4BN2 A;  2X2R A;  4Y05 A;  2V26 A;  4E7Z A;  4A28 A;  1VFX A;  2VVG A;  5LT2 A;  4A5Y A;  2IEH A;  1MMN A;  4HNA K;  2Q2Y A;  3DC4 A;  1D0Y A;  1YRS A;  1I6I A;  2KIN A;  4DBQ A;  4AP0 A;  4BBG A;  4PK4 A;  3ZFD A;  1BR1 A;  1V8J A;  1V8K A;  4B7B A;  1N6M A;  1KK7 A;  1BR2 A;  1BR4 A;  4GKP A;  4ZCA A;  1RY6 A;  5HLE A;  3WRD A;  2ZFM A;  1F9W A;  1MMG A;  1VFW A;  4PJN A;  2Q2Z A;  3WPN A;  2GM1 A;  3KAR A;  3ZFC A;  1VFZ A;  1II6 A;  1G8X A;  3CNZ A;  1MKJ A;  4GKR A;  2ZFJ A;  1D1A A;  3NWN A;  1D0X A;  4PJJ A;  2NCD A;  4FRZ A;  5LT4 A;  3PXN A;  2HEH A;  2G1Q A;  1MMA A;  2X7C A;  3KEN A;  4GKQ A;  4LNU K;  4PJL A;  2FL2 A;  1D1B A;  4A51 A;  2FKY A;  1F9U A;  4ZHI A;  3COB A;  1T5C A;  1D0Z A;  5LT1 A;  2FME A;  1MMD A;  2VB6 A;  2Y5W A;  3B6V A;  4PJM A;  1LVK A;  4DBR A;  4ETP B;  1VOM A;  3T0Q A;  4PFP A;  4PFO A;  1MNE A;  2Y65 A;  1F9V A;  1GOJ A;  3DCB A;  5LT0 A;  2OWM A;  1I5S A;  1Q0B A;  3KIN A;  4A50 A;  2X7E A;  4ANJ A;  3K3B A;  4ETP A;  1D1C A;  2GRY A;  2UYM A;  2PG2 A;  1X88 A;  2X7D A;  2ZFI A;  2WOG A;  3BFN A;  2XAE A;  2MYS A;  3ZCW A;  3GBJ A; 
#chains in the Genus database with same CATH homology
 1BG2 A;  5GSZ A;  4AS7 A;  2VAS A;  4A1Z A;  3H4S A;  2ZFL A;  2XT3 A;  3B6U A;  3K5E A;  4H1G A;  3L1C A;  4UBF A;  4E7S A;  4BXN A;  5LT3 A;  1FMV A;  3U06 A;  2UYI A;  3L9H A;  4A14 A;  1SDM A;  1CZ7 A;  2X51 A;  3CJO A;  1LKX A;  2FL6 A;  3LRE A;  2ZFK A;  1F9T A;  3HQD A;  3X2T A;  1VFV A;  1FMW A;  4BN2 A;  2X2R A;  4Y05 A;  2V26 A;  4E7Z A;  4A28 A;  1VFX A;  2VVG A;  5LT2 A;  4A5Y A;  2IEH A;  1MMN A;  4HNA K;  2Q2Y A;  3DC4 A;  1D0Y A;  1YRS A;  1I6I A;  2KIN A;  4DBQ A;  4AP0 A;  4BBG A;  4PK4 A;  3ZFD A;  1BR1 A;  1V8J A;  1V8K A;  4B7B A;  1N6M A;  1KK7 A;  1BR2 A;  1BR4 A;  4ZCA A;  1RY6 A;  5HLE A;  3WRD A;  2ZFM A;  1F9W A;  1MMG A;  1VFW A;  4PJN A;  2Q2Z A;  3WPN A;  2GM1 A;  3KAR A;  3ZFC A;  1VFZ A;  1II6 A;  1G8X A;  3CNZ A;  1MKJ A;  4GKR A;  2ZFJ A;  1D1A A;  3NWN A;  1D0X A;  4PJJ A;  2NCD A;  4FRZ A;  5LT4 A;  3PXN A;  2HEH A;  2G1Q A;  1MMA A;  2X7C A;  3KEN A;  4LNU K;  4PJL A;  2FL2 A;  1D1B A;  4A51 A;  2FKY A;  1F9U A;  4ZHI A;  3COB A;  1T5C A;  1D0Z A;  5LT1 A;  2FME A;  1MMD A;  2VB6 A;  2Y5W A;  3B6V A;  4PJM A;  1LVK A;  4DBR A;  1VOM A;  3T0Q A;  4PFP A;  4PFO A;  1MNE A;  2Y65 A;  1F9V A;  1GOJ A;  3DCB A;  5LT0 A;  2OWM A;  1I5S A;  1Q0B A;  3KIN A;  4A50 A;  2X7E A;  4ANJ A;  3K3B A;  4ETP A;  1D1C A;  2GRY A;  2UYM A;  2PG2 A;  1X88 A;  2X7D A;  2ZFI A;  2WOG A;  3BFN A;  2XAE A;  2MYS A;  3ZCW A;  3GBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...