4GKQA

Structure of the neck and c-terminal motor homology domain of vik1 from candida glabrata
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
283
structure length
242
Chain Sequence
HMTLGEELSRRRRLLNSITELKGCARLFANIIEDEISEKLIVNYSDESIEDMKNHKTYKFTKLIQNDLFKEDLHVYIDFCLKRRENFNLFSVGSSNITFEKLLAFFKNNYFDKFVITLQYVMLSDSQDLLSNIKLKIEESTISLGSTLITLDENGIGLSKFQFFCLQDIEPIPIDFYFIEIYQPSIYPILKRSTGLNSPLEIVLKKIFHDTKSAFVFQIDHSAEVYDILKLSSHLSFIRNPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords SPINDLE POLE BODY-ASSOCIATED PROTEIN VIK1
publication title Neck Rotation and Neck Mimic Docking in the Noncatalytic Kar3-associated Protein Vik1.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Structural protein
total genus 65
structure length 242
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16796 Microtub_bd Microtubule binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 4gkqA00
2O0AA 4GKQA 4GKPA 4ETPB
chains in the Genus database with same CATH superfamily
1MNEA 3COBA 1VFXA 2Y65A 4GKQA 1MKJA 1F9VA 1BR1A 2ZFMA 4ZCAA 4PFOA 1VFWA 3U06A 1D1AA 1G8XA 4PJLA 3WPNA 4H1GA 2X51A 4FRZA 2GM1A 4Y05A 3PXNA 3H4SA 1MMGA 2ZFKA 1LKXA 1V8JA 2FL6A 4A50A 5LT4A 3NWNA 1Q0BA 2GRYA 4PJJA 2KINA 1D1BA 2Q2YA 4A14A 3X2TA 2XAEA 2VVGA 1X88A 2V26A 1II6A 2ZFLA 3BFNA 4E7ZA 4A5YA 4BXNA 3KINA 3LREA 4E7SA 2X7DA 4ETPB 4LNUK 1KK7A 4HNAK 4DBQA 1D1CA 5LT2A 2UYIA 1T5CA 1VFVA 2VASA 1MMDA 2MYSA 3CJOA 3DCBA 2ZFIA 1MMAA 1I5SA 3L1CA 4PJMA 4AP0A 1FMVA 4GKRA 2PG2A 2FKYA 5LT3A 1D0ZA 1V8KA 3K5EA 5LT0A 2Q2ZA 3B6UA 4GKPA 1LVKA 1BR2A 2Y5WA 3CNZA 2FMEA 3T0QA 4ANJA 5GSZA 2UYMA 4DBRA 2X2RA 3ZCWA 4PFPA 1F9UA 1D0XA 3KENA 3K3BA 4UBFA 2O0AA 1RY6A 5HLEA 2G1QA 2XT3A 3DC4A 1BR4A 2HEHA 1SDMA 1VOMA 2X7CA 1F9TA 3L9HA 2X7EA 4AS7A 4ETPA 3GBJA 4A51A 1GOJA 1CZ7A 1MMNA 4B7BA 4A1ZA 2ZFJA 1I6IA 1N6MA 1D0YA 4BN2A 2IEHA 3HQDA 4PK4A 4A28A 2VB6A 4ZHIA 2NCDA 1BG2A 3ZFCA 1YRSA 3WRDA 1FMWA 4PJNA 3ZFDA 2FL2A 1F9WA 3KARA 5LT1A 2WOGA 1VFZA 4BBGA 2OWMA 3B6VA
chains in the Genus database with same CATH topology
2O0AA 4GKQA 4GKPA 4ETPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O0A A;  4GKQ A;  4GKP A;  4ETP B; 
#chains in the Genus database with same CATH topology
 1MNE A;  3COB A;  1VFX A;  2Y65 A;  4GKQ A;  1MKJ A;  1F9V A;  1BR1 A;  2ZFM A;  4ZCA A;  4PFO A;  1VFW A;  3U06 A;  1D1A A;  1G8X A;  4PJL A;  3WPN A;  4H1G A;  2X51 A;  4FRZ A;  2GM1 A;  4Y05 A;  3PXN A;  3H4S A;  1MMG A;  2ZFK A;  1LKX A;  1V8J A;  2FL6 A;  4A50 A;  5LT4 A;  3NWN A;  1Q0B A;  2GRY A;  4PJJ A;  2KIN A;  1D1B A;  2Q2Y A;  4A14 A;  3X2T A;  2XAE A;  2VVG A;  1X88 A;  2V26 A;  1II6 A;  2ZFL A;  3BFN A;  4E7Z A;  4A5Y A;  4BXN A;  3KIN A;  3LRE A;  4E7S A;  2X7D A;  4ETP B;  4LNU K;  1KK7 A;  4HNA K;  4DBQ A;  1D1C A;  5LT2 A;  2UYI A;  1T5C A;  1VFV A;  2VAS A;  1MMD A;  2MYS A;  3CJO A;  3DCB A;  2ZFI A;  1MMA A;  1I5S A;  3L1C A;  4PJM A;  4AP0 A;  1FMV A;  4GKR A;  2PG2 A;  2FKY A;  5LT3 A;  1D0Z A;  1V8K A;  3K5E A;  5LT0 A;  2Q2Z A;  3B6U A;  4GKP A;  1LVK A;  1BR2 A;  2Y5W A;  3CNZ A;  2FME A;  3T0Q A;  4ANJ A;  5GSZ A;  2UYM A;  4DBR A;  2X2R A;  3ZCW A;  4PFP A;  1F9U A;  1D0X A;  3KEN A;  3K3B A;  4UBF A;  2O0A A;  1RY6 A;  5HLE A;  2G1Q A;  2XT3 A;  3DC4 A;  1BR4 A;  2HEH A;  1SDM A;  1VOM A;  2X7C A;  1F9T A;  3L9H A;  2X7E A;  4AS7 A;  4ETP A;  3GBJ A;  4A51 A;  1GOJ A;  1CZ7 A;  1MMN A;  4B7B A;  4A1Z A;  2ZFJ A;  1I6I A;  1N6M A;  1D0Y A;  4BN2 A;  2IEH A;  3HQD A;  4PK4 A;  4A28 A;  2VB6 A;  4ZHI A;  2NCD A;  1BG2 A;  3ZFC A;  1YRS A;  3WRD A;  1FMW A;  4PJN A;  3ZFD A;  2FL2 A;  1F9W A;  3KAR A;  5LT1 A;  2WOG A;  1VFZ A;  4BBG A;  2OWM A;  3B6V A; 
#chains in the Genus database with same CATH homology
 2O0A A;  4GKQ A;  4GKP A;  4ETP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...