2O0AA

The structure of the c-terminal domain of vik1 has a motor domain fold but lacks a nucleotide-binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
290
structure length
269
Chain Sequence
b'ASTVEKELLRSRRLENSIIEQKGTMRCYAYVMEQNLPENLLFDYENGVITQGLSEHVYKFNRVIPHLKVSEDKFFTQEYSVYHDMCLNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDYSIKLKFEKHSISLDSKLVIIENGLEDLPLNFSCDSGMGIIKVQFFPRDSPVPVDFYFIELNNLKSIEQFDKSIFKKSCETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQLC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S.cerevisiae chromosome XVI reading frame ORF YPL253c
publication title Vik1 modulates microtubule-Kar3 interactions through a motor domain that lacks an active site.
pubmed doi rcsb
molecule tags Cell cycle/transport protein
total genus 100
structure length 269
sequence length 290
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16796 Microtub_bd Microtubule binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 2o0aA00
4ETPB 4GKQA 4GKPA 2O0AA
chains in the Genus database with same CATH superfamily
4LNUK 4PJJA 2ZFMA 2Y65A 4ETPB 1I6IA 4E7SA 3CJOA 3L9HA 1V8KA 2Q2ZA 1LVKA 1GOJA 3B6UA 2UYMA 2PG2A 4AS7A 2VB6A 1D0YA 1BG2A 1T5CA 4BXNA 4A5YA 3WRDA 5LT4A 4AP0A 2FL2A 2IEHA 2ZFLA 2XT3A 3K3BA 2GM1A 2MYSA 3K5EA 1D0XA 2ZFJA 5HLEA 5LT2A 3WPNA 1FMVA 1VFWA 4A1ZA 1BR2A 1VOMA 3B6VA 3ZFDA 2X2RA 2X51A 4PFPA 4BBGA 4UBFA 4A50A 3H4SA 1FMWA 2WOGA 1Q0BA 4GKQA 4ETPA 1D1BA 5GSZA 2VASA 1VFXA 3NWNA 5LT0A 1F9WA 2X7CA 1LKXA 1MMGA 1D0ZA 4E7ZA 2G1QA 4DBQA 2UYIA 4BN2A 1BR4A 1G8XA 1KK7A 2KINA 2X7EA 3ZCWA 4DBRA 3DC4A 2GRYA 4A51A 2V26A 2HEHA 1II6A 4PK4A 2OWMA 1MMNA 4PJMA 4ZCAA 1N6MA 1MKJA 4ANJA 2VVGA 4PFOA 3KENA 1MMAA 1VFVA 3PXNA 2NCDA 4Y05A 2O0AA 2XAEA 1D1CA 2ZFIA 3CNZA 2FKYA 1I5SA 3DCBA 4PJNA 2Y5WA 4GKPA 3T0QA 1MNEA 2FL6A 2ZFKA 3X2TA 3COBA 1V8JA 4A14A 3HQDA 1F9TA 1F9UA 3GBJA 1VFZA 1SDMA 3ZFCA 4HNAK 4GKRA 3U06A 1D1AA 5LT1A 1RY6A 2Q2YA 4A28A 4ZHIA 3L1CA 1YRSA 1MMDA 1CZ7A 4H1GA 4PJLA 1F9VA 2X7DA 3KINA 3BFNA 4FRZA 1X88A 2FMEA 5LT3A 1BR1A 3KARA 4B7BA 3LREA
chains in the Genus database with same CATH topology
4ETPB 4GKQA 4GKPA 2O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ETP B;  4GKQ A;  4GKP A;  2O0A A; 
#chains in the Genus database with same CATH topology
 4LNU K;  4PJJ A;  2ZFM A;  2Y65 A;  4ETP B;  1I6I A;  4E7S A;  3CJO A;  3L9H A;  1V8K A;  2Q2Z A;  1LVK A;  1GOJ A;  3B6U A;  2UYM A;  2PG2 A;  4AS7 A;  2VB6 A;  1D0Y A;  1BG2 A;  1T5C A;  4BXN A;  4A5Y A;  3WRD A;  5LT4 A;  4AP0 A;  2FL2 A;  2IEH A;  2ZFL A;  2XT3 A;  3K3B A;  2GM1 A;  2MYS A;  3K5E A;  1D0X A;  2ZFJ A;  5HLE A;  5LT2 A;  3WPN A;  1FMV A;  1VFW A;  4A1Z A;  1BR2 A;  1VOM A;  3B6V A;  3ZFD A;  2X2R A;  2X51 A;  4PFP A;  4BBG A;  4UBF A;  4A50 A;  3H4S A;  1FMW A;  2WOG A;  1Q0B A;  4GKQ A;  4ETP A;  1D1B A;  5GSZ A;  2VAS A;  1VFX A;  3NWN A;  5LT0 A;  1F9W A;  2X7C A;  1LKX A;  1MMG A;  1D0Z A;  4E7Z A;  2G1Q A;  4DBQ A;  2UYI A;  4BN2 A;  1BR4 A;  1G8X A;  1KK7 A;  2KIN A;  2X7E A;  3ZCW A;  4DBR A;  3DC4 A;  2GRY A;  4A51 A;  2V26 A;  2HEH A;  1II6 A;  4PK4 A;  2OWM A;  1MMN A;  4PJM A;  4ZCA A;  1N6M A;  1MKJ A;  4ANJ A;  2VVG A;  4PFO A;  3KEN A;  1MMA A;  1VFV A;  3PXN A;  2NCD A;  4Y05 A;  2O0A A;  2XAE A;  1D1C A;  2ZFI A;  3CNZ A;  2FKY A;  1I5S A;  3DCB A;  4PJN A;  2Y5W A;  4GKP A;  3T0Q A;  1MNE A;  2FL6 A;  2ZFK A;  3X2T A;  3COB A;  1V8J A;  4A14 A;  3HQD A;  1F9T A;  1F9U A;  3GBJ A;  1VFZ A;  1SDM A;  3ZFC A;  4HNA K;  4GKR A;  3U06 A;  1D1A A;  5LT1 A;  1RY6 A;  2Q2Y A;  4A28 A;  4ZHI A;  3L1C A;  1YRS A;  1MMD A;  1CZ7 A;  4H1G A;  4PJL A;  1F9V A;  2X7D A;  3KIN A;  3BFN A;  4FRZ A;  1X88 A;  2FME A;  5LT3 A;  1BR1 A;  3KAR A;  4B7B A;  3LRE A; 
#chains in the Genus database with same CATH homology
 4ETP B;  4GKQ A;  4GKP A;  2O0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...