2O0AA

The structure of the c-terminal domain of vik1 has a motor domain fold but lacks a nucleotide-binding site.
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
290
structure length
269
Chain Sequence
ASTVEKELLRSRRLENSIIEQKGTMRCYAYVMEQNLPENLLFDYENGVITQGLSEHVYKFNRVIPHLKVSEDKFFTQEYSVYHDMCLNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDYSIKLKFEKHSISLDSKLVIIENGLEDLPLNFSCDSGMGIIKVQFFPRDSPVPVDFYFIELNNLKSIEQFDKSIFKKSCETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQLC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords S.cerevisiae chromosome XVI reading frame ORF YPL253c
publication title Vik1 modulates microtubule-Kar3 interactions through a motor domain that lacks an active site.
pubmed doi rcsb
molecule tags Cell cycle/transport protein
total genus 100
structure length 269
sequence length 290
ec nomenclature
pdb deposition date 2006-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16796 Microtub_bd Microtubule binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.20 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin 2o0aA00
4GKQA 4GKPA 4ETPB 2O0AA
chains in the Genus database with same CATH superfamily
2ZFKA 3ZCWA 3B6VA 1Q0BA 3COBA 1MMNA 4A14A 2FKYA 4ETPA 5LT4A 4E7SA 4ZHIA 5GSZA 1CZ7A 4PJNA 4A5YA 4BN2A 1F9UA 3GBJA 4B7BA 2NCDA 1F9TA 2KINA 3ZFCA 2VB6A 4PK4A 4A51A 2HEHA 4HNAK 3H4SA 2XAEA 1VFWA 2GRYA 1RY6A 2IEHA 2ZFLA 3KENA 4PFOA 2X7DA 4BXNA 1X88A 2X51A 2V26A 1MKJA 1BR1A 2VVGA 1II6A 2ZFMA 5LT3A 1T5CA 2Y65A 2Y5WA 4H1GA 3T0QA 1F9WA 4GKRA 4PJJA 1MNEA 3B6UA 4A28A 2O0AA 1V8KA 4DBRA 3DC4A 5LT2A 3KINA 1I6IA 2Q2YA 1VFVA 1KK7A 2VASA 4ZCAA 1LKXA 3K5EA 3L1CA 4UBFA 4BBGA 1N6MA 3WRDA 3WPNA 1VOMA 1D1CA 5HLEA 2MYSA 4PJMA 2FL6A 4FRZA 4PJLA 1BR4A 2Q2ZA 3X2TA 1F9VA 2FL2A 2X2RA 1FMVA 2FMEA 1G8XA 1MMDA 2OWMA 1BR2A 3K3BA 1D0XA 3HQDA 3CJOA 3U06A 3CNZA 4ETPB 2ZFIA 2X7CA 1SDMA 1D0ZA 4LNUK 1D1BA 4GKQA 1BG2A 2WOGA 3ZFDA 2GM1A 4PFPA 1FMWA 1VFZA 4A1ZA 4E7ZA 2PG2A 1YRSA 2XT3A 4ANJA 3L9HA 1I5SA 4GKPA 1MMAA 4AS7A 2ZFJA 1GOJA 4AP0A 1MMGA 5LT1A 1D0YA 5LT0A 3KARA 4DBQA 3PXNA 1LVKA 1D1AA 2G1QA 2X7EA 4A50A 3BFNA 1V8JA 3DCBA 3LREA 2UYIA 2UYMA 1VFXA 4Y05A 3NWNA
chains in the Genus database with same CATH topology
4GKQA 4GKPA 4ETPB 2O0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKQ A;  4GKP A;  4ETP B;  2O0A A; 
#chains in the Genus database with same CATH topology
 2ZFK A;  3ZCW A;  3B6V A;  1Q0B A;  3COB A;  1MMN A;  4A14 A;  2FKY A;  4ETP A;  5LT4 A;  4E7S A;  4ZHI A;  5GSZ A;  1CZ7 A;  4PJN A;  4A5Y A;  4BN2 A;  1F9U A;  3GBJ A;  4B7B A;  2NCD A;  1F9T A;  2KIN A;  3ZFC A;  2VB6 A;  4PK4 A;  4A51 A;  2HEH A;  4HNA K;  3H4S A;  2XAE A;  1VFW A;  2GRY A;  1RY6 A;  2IEH A;  2ZFL A;  3KEN A;  4PFO A;  2X7D A;  4BXN A;  1X88 A;  2X51 A;  2V26 A;  1MKJ A;  1BR1 A;  2VVG A;  1II6 A;  2ZFM A;  5LT3 A;  1T5C A;  2Y65 A;  2Y5W A;  4H1G A;  3T0Q A;  1F9W A;  4GKR A;  4PJJ A;  1MNE A;  3B6U A;  4A28 A;  2O0A A;  1V8K A;  4DBR A;  3DC4 A;  5LT2 A;  3KIN A;  1I6I A;  2Q2Y A;  1VFV A;  1KK7 A;  2VAS A;  4ZCA A;  1LKX A;  3K5E A;  3L1C A;  4UBF A;  4BBG A;  1N6M A;  3WRD A;  3WPN A;  1VOM A;  1D1C A;  5HLE A;  2MYS A;  4PJM A;  2FL6 A;  4FRZ A;  4PJL A;  1BR4 A;  2Q2Z A;  3X2T A;  1F9V A;  2FL2 A;  2X2R A;  1FMV A;  2FME A;  1G8X A;  1MMD A;  2OWM A;  1BR2 A;  3K3B A;  1D0X A;  3HQD A;  3CJO A;  3U06 A;  3CNZ A;  4ETP B;  2ZFI A;  2X7C A;  1SDM A;  1D0Z A;  4LNU K;  1D1B A;  4GKQ A;  1BG2 A;  2WOG A;  3ZFD A;  2GM1 A;  4PFP A;  1FMW A;  1VFZ A;  4A1Z A;  4E7Z A;  2PG2 A;  1YRS A;  2XT3 A;  4ANJ A;  3L9H A;  1I5S A;  4GKP A;  1MMA A;  4AS7 A;  2ZFJ A;  1GOJ A;  4AP0 A;  1MMG A;  5LT1 A;  1D0Y A;  5LT0 A;  3KAR A;  4DBQ A;  3PXN A;  1LVK A;  1D1A A;  2G1Q A;  2X7E A;  4A50 A;  3BFN A;  1V8J A;  3DCB A;  3LRE A;  2UYI A;  2UYM A;  1VFX A;  4Y05 A;  3NWN A; 
#chains in the Genus database with same CATH homology
 4GKQ A;  4GKP A;  4ETP B;  2O0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...