2ZFJA

Crystal structure of the kif1a motor domain during mg release: mg-releasing transition-1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
348
structure length
309
Chain Sequence
b'SVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEKEGANINKSLTTLGKVISALAIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 88
structure length 309
sequence length 348
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfjA00
3BFNA 4GKRA 2PG2A 1X88A 3H4SA 1MMAA 3L1CA 4PK4A 1T5CA 2ZFLA 4PJMA 4ZHIA 1V8KA 4A5YA 3GBJA 1LKXA 1MNEA 4H1GA 2HEHA 2MYSA 4DBQA 1F9WA 1FMVA 1V8JA 2XAEA 1D1CA 1LVKA 5LT2A 2Q2ZA 3X2TA 1BR4A 4E7SA 3B6UA 3L9HA 1FMWA 2VASA 4BXNA 1I6IA 4A1ZA 4A50A 2WOGA 1D1BA 4LNUK 3ZFCA 2X2RA 1D0ZA 1MMNA 4FRZA 3WPNA 4HNAK 1GOJA 3LREA 2FMEA 3K5EA 1VFZA 1MKJA 3KINA 1D0XA 1VFVA 3KENA 4ETPA 2IEHA 2UYMA 1VFWA 4B7BA 1G8XA 1RY6A 4PJLA 1SDMA 1D0YA 2UYIA 2X7EA 2Y5WA 2V26A 4BN2A 5LT0A 5HLEA 4PFOA 1CZ7A 2X7DA 4ZCAA 2Y65A 2VB6A 1VOMA 2VVGA 2X51A 4Y05A 3WRDA 3DCBA 1Q0BA 3CNZA 1D1AA 1KK7A 4BBGA 3DC4A 4AP0A 4A14A 4AS7A 3U06A 4PJNA 3KARA 3ZFDA 4A51A 4E7ZA 2GRYA 1F9VA 5LT3A 1YRSA 5LT1A 1BR2A 3K3BA 1II6A 2Q2YA 3CJOA 3B6VA 2KINA 2ZFIA 2ZFKA 1VFXA 1MMDA 1BG2A 2XT3A 4ANJA 1I5SA 3COBA 2ZFMA 2ZFJA 2X7CA 2GM1A 4A28A 4UBFA 2FL2A 3T0QA 2OWMA 4PFPA 2FKYA 5LT4A 2G1QA 3ZCWA 4DBRA 1N6MA 2NCDA 3NWNA 4PJJA 1MMGA 3PXNA 3HQDA 5GSZA 2FL6A 1BR1A 1F9TA 1F9UA
chains in the Genus database with same CATH superfamily
3BFNA 4GKRA 2PG2A 1X88A 3H4SA 1MMAA 3L1CA 4PK4A 1T5CA 2ZFLA 4PJMA 4ZHIA 1V8KA 4A5YA 3GBJA 1LKXA 1MNEA 4H1GA 2HEHA 2MYSA 4DBQA 1F9WA 1FMVA 1V8JA 2XAEA 1D1CA 1LVKA 5LT2A 2Q2ZA 3X2TA 1BR4A 4E7SA 3B6UA 3L9HA 1FMWA 2VASA 4BXNA 1I6IA 4A1ZA 4A50A 2WOGA 1D1BA 4LNUK 3ZFCA 2X2RA 1D0ZA 1MMNA 4FRZA 3WPNA 4HNAK 1GOJA 3LREA 2FMEA 3K5EA 1VFZA 1MKJA 3KINA 1D0XA 1VFVA 3KENA 4ETPA 2IEHA 2UYMA 1VFWA 4GKQA 1G8XA 1RY6A 4PJLA 1SDMA 1D0YA 2UYIA 4B7BA 2X7EA 2Y5WA 2V26A 4BN2A 5LT0A 5HLEA 4PFOA 1CZ7A 2X7DA 4ZCAA 2Y65A 2VB6A 1VOMA 2VVGA 2X51A 4Y05A 3WRDA 3DCBA 1Q0BA 3CNZA 1D1AA 1KK7A 4BBGA 3DC4A 4ETPB 4GKPA 4AP0A 4A14A 4AS7A 3U06A 4PJNA 3KARA 3ZFDA 4A51A 4E7ZA 2GRYA 1F9VA 2O0AA 5LT3A 1YRSA 5LT1A 1BR2A 3K3BA 1II6A 2Q2YA 3CJOA 3B6VA 2KINA 2ZFIA 2ZFKA 1VFXA 1MMDA 1BG2A 2XT3A 4ANJA 1I5SA 3COBA 2ZFMA 2ZFJA 2X7CA 2GM1A 4A28A 4UBFA 2FL2A 3T0QA 2OWMA 4PFPA 2FKYA 5LT4A 2G1QA 3ZCWA 4DBRA 1N6MA 2NCDA 3NWNA 4PJJA 1MMGA 3PXNA 3HQDA 5GSZA 2FL6A 1BR1A 1F9TA 1F9UA
chains in the Genus database with same CATH topology
3BFNA 4GKRA 2PG2A 1X88A 3H4SA 1MMAA 3L1CA 4PK4A 1T5CA 2ZFLA 4PJMA 4ZHIA 1V8KA 4A5YA 3GBJA 1LKXA 1MNEA 4H1GA 2HEHA 2MYSA 4DBQA 1F9WA 1FMVA 1V8JA 2XAEA 1D1CA 1LVKA 5LT2A 2Q2ZA 3X2TA 1BR4A 4E7SA 3B6UA 3L9HA 1FMWA 2VASA 4BXNA 1I6IA 4A1ZA 4A50A 2WOGA 1D1BA 4LNUK 3ZFCA 2X2RA 1D0ZA 1MMNA 4FRZA 3WPNA 4HNAK 1GOJA 3LREA 2FMEA 3K5EA 1VFZA 1MKJA 3KINA 1D0XA 1VFVA 3KENA 4ETPA 2IEHA 2UYMA 1VFWA 4B7BA 1G8XA 1RY6A 4PJLA 1SDMA 1D0YA 2UYIA 2X7EA 2Y5WA 2V26A 4BN2A 5LT0A 5HLEA 4PFOA 1CZ7A 2X7DA 4ZCAA 2Y65A 2VB6A 1VOMA 2VVGA 2X51A 4Y05A 3WRDA 3DCBA 1Q0BA 3CNZA 1D1AA 1KK7A 4BBGA 3DC4A 4AP0A 4A14A 4AS7A 3U06A 4PJNA 3KARA 3ZFDA 4A51A 4E7ZA 2GRYA 1F9VA 5LT3A 1YRSA 5LT1A 1BR2A 3K3BA 1II6A 2Q2YA 3CJOA 3B6VA 2KINA 2ZFIA 2ZFKA 1VFXA 1MMDA 1BG2A 2XT3A 4ANJA 1I5SA 3COBA 2ZFMA 2ZFJA 2X7CA 2GM1A 4A28A 4UBFA 2FL2A 3T0QA 2OWMA 4PFPA 2FKYA 5LT4A 2G1QA 3ZCWA 4DBRA 1N6MA 2NCDA 3NWNA 4PJJA 1MMGA 3PXNA 3HQDA 5GSZA 2FL6A 1BR1A 1F9TA 1F9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFN A;  4GKR A;  2PG2 A;  1X88 A;  3H4S A;  1MMA A;  3L1C A;  4PK4 A;  1T5C A;  2ZFL A;  4PJM A;  4ZHI A;  1V8K A;  4A5Y A;  3GBJ A;  1LKX A;  1MNE A;  4H1G A;  2HEH A;  2MYS A;  4DBQ A;  1F9W A;  1FMV A;  1V8J A;  2XAE A;  1D1C A;  1LVK A;  5LT2 A;  2Q2Z A;  3X2T A;  1BR4 A;  4E7S A;  3B6U A;  3L9H A;  1FMW A;  2VAS A;  4BXN A;  1I6I A;  4A1Z A;  4A50 A;  2WOG A;  1D1B A;  4LNU K;  3ZFC A;  2X2R A;  1D0Z A;  1MMN A;  4FRZ A;  3WPN A;  4HNA K;  1GOJ A;  3LRE A;  2FME A;  3K5E A;  1VFZ A;  1MKJ A;  3KIN A;  1D0X A;  1VFV A;  3KEN A;  4ETP A;  2IEH A;  2UYM A;  1VFW A;  4B7B A;  1G8X A;  1RY6 A;  4PJL A;  1SDM A;  1D0Y A;  2UYI A;  2X7E A;  2Y5W A;  2V26 A;  4BN2 A;  5LT0 A;  5HLE A;  4PFO A;  1CZ7 A;  2X7D A;  4ZCA A;  2Y65 A;  2VB6 A;  1VOM A;  2VVG A;  2X51 A;  4Y05 A;  3WRD A;  3DCB A;  1Q0B A;  3CNZ A;  1D1A A;  1KK7 A;  4BBG A;  3DC4 A;  4AP0 A;  4A14 A;  4AS7 A;  3U06 A;  4PJN A;  3KAR A;  3ZFD A;  4A51 A;  4E7Z A;  2GRY A;  1F9V A;  5LT3 A;  1YRS A;  5LT1 A;  1BR2 A;  3K3B A;  1II6 A;  2Q2Y A;  3CJO A;  3B6V A;  2KIN A;  2ZFI A;  2ZFK A;  1VFX A;  1MMD A;  1BG2 A;  2XT3 A;  4ANJ A;  1I5S A;  3COB A;  2ZFM A;  2ZFJ A;  2X7C A;  2GM1 A;  4A28 A;  4UBF A;  2FL2 A;  3T0Q A;  2OWM A;  4PFP A;  2FKY A;  5LT4 A;  2G1Q A;  3ZCW A;  4DBR A;  1N6M A;  2NCD A;  3NWN A;  4PJJ A;  1MMG A;  3PXN A;  3HQD A;  5GSZ A;  2FL6 A;  1BR1 A;  1F9T A;  1F9U A; 
#chains in the Genus database with same CATH topology
 3BFN A;  4GKR A;  2PG2 A;  1X88 A;  3H4S A;  1MMA A;  3L1C A;  4PK4 A;  1T5C A;  2ZFL A;  4PJM A;  4ZHI A;  1V8K A;  4A5Y A;  3GBJ A;  1LKX A;  1MNE A;  4H1G A;  2HEH A;  2MYS A;  4DBQ A;  1F9W A;  1FMV A;  1V8J A;  2XAE A;  1D1C A;  1LVK A;  5LT2 A;  2Q2Z A;  3X2T A;  1BR4 A;  4E7S A;  3B6U A;  3L9H A;  1FMW A;  2VAS A;  4BXN A;  1I6I A;  4A1Z A;  4A50 A;  2WOG A;  1D1B A;  4LNU K;  3ZFC A;  2X2R A;  1D0Z A;  1MMN A;  4FRZ A;  3WPN A;  4HNA K;  1GOJ A;  3LRE A;  2FME A;  3K5E A;  1VFZ A;  1MKJ A;  3KIN A;  1D0X A;  1VFV A;  3KEN A;  4ETP A;  2IEH A;  2UYM A;  1VFW A;  4GKQ A;  1G8X A;  1RY6 A;  4PJL A;  1SDM A;  1D0Y A;  2UYI A;  4B7B A;  2X7E A;  2Y5W A;  2V26 A;  4BN2 A;  5LT0 A;  5HLE A;  4PFO A;  1CZ7 A;  2X7D A;  4ZCA A;  2Y65 A;  2VB6 A;  1VOM A;  2VVG A;  2X51 A;  4Y05 A;  3WRD A;  3DCB A;  1Q0B A;  3CNZ A;  1D1A A;  1KK7 A;  4BBG A;  3DC4 A;  4ETP B;  4GKP A;  4AP0 A;  4A14 A;  4AS7 A;  3U06 A;  4PJN A;  3KAR A;  3ZFD A;  4A51 A;  4E7Z A;  2GRY A;  1F9V A;  2O0A A;  5LT3 A;  1YRS A;  5LT1 A;  1BR2 A;  3K3B A;  1II6 A;  2Q2Y A;  3CJO A;  3B6V A;  2KIN A;  2ZFI A;  2ZFK A;  1VFX A;  1MMD A;  1BG2 A;  2XT3 A;  4ANJ A;  1I5S A;  3COB A;  2ZFM A;  2ZFJ A;  2X7C A;  2GM1 A;  4A28 A;  4UBF A;  2FL2 A;  3T0Q A;  2OWM A;  4PFP A;  2FKY A;  5LT4 A;  2G1Q A;  3ZCW A;  4DBR A;  1N6M A;  2NCD A;  3NWN A;  4PJJ A;  1MMG A;  3PXN A;  3HQD A;  5GSZ A;  2FL6 A;  1BR1 A;  1F9T A;  1F9U A; 
#chains in the Genus database with same CATH homology
 3BFN A;  4GKR A;  2PG2 A;  1X88 A;  3H4S A;  1MMA A;  3L1C A;  4PK4 A;  1T5C A;  2ZFL A;  4PJM A;  4ZHI A;  1V8K A;  4A5Y A;  3GBJ A;  1LKX A;  1MNE A;  4H1G A;  2HEH A;  2MYS A;  4DBQ A;  1F9W A;  1FMV A;  1V8J A;  2XAE A;  1D1C A;  1LVK A;  5LT2 A;  2Q2Z A;  3X2T A;  1BR4 A;  4E7S A;  3B6U A;  3L9H A;  1FMW A;  2VAS A;  4BXN A;  1I6I A;  4A1Z A;  4A50 A;  2WOG A;  1D1B A;  4LNU K;  3ZFC A;  2X2R A;  1D0Z A;  1MMN A;  4FRZ A;  3WPN A;  4HNA K;  1GOJ A;  3LRE A;  2FME A;  3K5E A;  1VFZ A;  1MKJ A;  3KIN A;  1D0X A;  1VFV A;  3KEN A;  4ETP A;  2IEH A;  2UYM A;  1VFW A;  4B7B A;  1G8X A;  1RY6 A;  4PJL A;  1SDM A;  1D0Y A;  2UYI A;  2X7E A;  2Y5W A;  2V26 A;  4BN2 A;  5LT0 A;  5HLE A;  4PFO A;  1CZ7 A;  2X7D A;  4ZCA A;  2Y65 A;  2VB6 A;  1VOM A;  2VVG A;  2X51 A;  4Y05 A;  3WRD A;  3DCB A;  1Q0B A;  3CNZ A;  1D1A A;  1KK7 A;  4BBG A;  3DC4 A;  4AP0 A;  4A14 A;  4AS7 A;  3U06 A;  4PJN A;  3KAR A;  3ZFD A;  4A51 A;  4E7Z A;  2GRY A;  1F9V A;  5LT3 A;  1YRS A;  5LT1 A;  1BR2 A;  3K3B A;  1II6 A;  2Q2Y A;  3CJO A;  3B6V A;  2KIN A;  2ZFI A;  2ZFK A;  1VFX A;  1MMD A;  1BG2 A;  2XT3 A;  4ANJ A;  1I5S A;  3COB A;  2ZFM A;  2ZFJ A;  2X7C A;  2GM1 A;  4A28 A;  4UBF A;  2FL2 A;  3T0Q A;  2OWM A;  4PFP A;  2FKY A;  5LT4 A;  2G1Q A;  3ZCW A;  4DBR A;  1N6M A;  2NCD A;  3NWN A;  4PJJ A;  1MMG A;  3PXN A;  3HQD A;  5GSZ A;  2FL6 A;  1BR1 A;  1F9T A;  1F9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...