2ZFJA

Crystal structure of the kif1a motor domain during mg release: mg-releasing transition-1
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
348
structure length
309
Chain Sequence
SVKVAVRVRPFNSREMSRDSKCIIQMSGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEKEGANINKSLTTLGKVISALAIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 88
structure length 309
sequence length 348
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfjA00
3U06A 1Q0BA 3COBA 3LREA 1X88A 1MMAA 2Q2YA 1I5SA 3K3BA 1LVKA 2WOGA 4FRZA 2XAEA 3X2TA 4PJNA 1VFZA 4PJLA 2Y5WA 2VASA 4PJMA 4H1GA 3DCBA 2X7EA 1G8XA 4GKRA 4A50A 5LT1A 1SDMA 4A5YA 2GRYA 2X7DA 1D0YA 4BN2A 2FKYA 5LT0A 2UYMA 2PG2A 4BBGA 2MYSA 3ZFCA 1II6A 3NWNA 1T5CA 4PFPA 4A28A 1YRSA 2GM1A 3CJOA 1GOJA 4DBRA 2FMEA 5GSZA 4E7SA 1D1BA 1BR2A 1F9TA 1VOMA 3KARA 5LT4A 2VB6A 1F9UA 4ZHIA 2FL2A 1RY6A 4A1ZA 3GBJA 4UBFA 3L9HA 1MNEA 2FL6A 1KK7A 3B6UA 3WPNA 2X51A 4PK4A 1MMNA 2VVGA 1LKXA 1VFWA 4LNUK 3KENA 4PFOA 3ZCWA 3WRDA 1F9VA 3L1CA 1FMWA 4ANJA 1D0ZA 3BFNA 1VFXA 2ZFKA 1D1AA 1I6IA 4B7BA 1D0XA 3DC4A 1F9WA 3PXNA 2Q2ZA 1V8JA 2XT3A 2ZFLA 3HQDA 3K5EA 1VFVA 4ZCAA 1BR4A 3B6VA 3H4SA 2ZFMA 1FMVA 4PJJA 1BR1A 2V26A 2NCDA 5LT3A 2IEHA 1BG2A 4Y05A 1V8KA 1MKJA 2ZFJA 2G1QA 2HEHA 3KINA 4AS7A 4ETPA 3ZFDA 1D1CA 4DBQA 4A51A 4E7ZA 2X2RA 4HNAK 1MMGA 3CNZA 3T0QA 2ZFIA 2X7CA 5LT2A 2KINA 1CZ7A 2Y65A 2UYIA 2OWMA 4BXNA 4A14A 5HLEA 4AP0A 1N6MA 1MMDA
chains in the Genus database with same CATH superfamily
3U06A 1Q0BA 3COBA 3LREA 1X88A 1MMAA 2Q2YA 1I5SA 3K3BA 1LVKA 2WOGA 4FRZA 2XAEA 3X2TA 4PJNA 1VFZA 4PJLA 2Y5WA 2VASA 4PJMA 4H1GA 3DCBA 2X7EA 1G8XA 4GKRA 4A50A 5LT1A 1SDMA 4A5YA 2GRYA 2X7DA 1D0YA 4BN2A 2FKYA 5LT0A 2UYMA 4GKQA 2PG2A 4BBGA 2MYSA 3ZFCA 1II6A 3NWNA 1T5CA 4PFPA 4A28A 1YRSA 2GM1A 4ETPB 3CJOA 1GOJA 4DBRA 2FMEA 5GSZA 4E7SA 1D1BA 4GKPA 1BR2A 1F9TA 1VOMA 3KARA 5LT4A 2VB6A 1F9UA 4ZHIA 2FL2A 1RY6A 4A1ZA 3GBJA 4UBFA 3L9HA 1MNEA 2FL6A 1KK7A 3B6UA 3WPNA 2X51A 4PK4A 1MMNA 2VVGA 1LKXA 1VFWA 4LNUK 3KENA 4PFOA 3ZCWA 3WRDA 1F9VA 3L1CA 1FMWA 4ANJA 1D0ZA 3BFNA 1VFXA 2ZFKA 1D1AA 1I6IA 4B7BA 1D0XA 3DC4A 1F9WA 3PXNA 2Q2ZA 1V8JA 2XT3A 2ZFLA 3HQDA 3K5EA 1VFVA 4ZCAA 1BR4A 3B6VA 3H4SA 2ZFMA 1FMVA 4PJJA 1BR1A 2V26A 2NCDA 5LT3A 2IEHA 1BG2A 4Y05A 1V8KA 1MKJA 2ZFJA 2G1QA 2HEHA 3KINA 4AS7A 4ETPA 3ZFDA 1D1CA 4DBQA 4A51A 4E7ZA 2X2RA 4HNAK 1MMGA 3CNZA 3T0QA 2O0AA 2ZFIA 2X7CA 5LT2A 2KINA 1CZ7A 2Y65A 2UYIA 2OWMA 4BXNA 4A14A 5HLEA 4AP0A 1N6MA 1MMDA
chains in the Genus database with same CATH topology
3U06A 1Q0BA 3COBA 3LREA 1X88A 1MMAA 2Q2YA 1I5SA 3K3BA 1LVKA 2WOGA 4FRZA 2XAEA 3X2TA 4PJNA 1VFZA 4PJLA 2Y5WA 2VASA 4PJMA 4H1GA 3DCBA 2X7EA 1G8XA 4GKRA 4A50A 5LT1A 1SDMA 4A5YA 2GRYA 2X7DA 1D0YA 4BN2A 2FKYA 5LT0A 2UYMA 2PG2A 4BBGA 2MYSA 3ZFCA 1II6A 3NWNA 1T5CA 4PFPA 4A28A 1YRSA 2GM1A 3CJOA 1GOJA 4DBRA 2FMEA 5GSZA 4E7SA 1D1BA 1BR2A 1F9TA 1VOMA 3KARA 5LT4A 2VB6A 1F9UA 4ZHIA 2FL2A 1RY6A 4A1ZA 3GBJA 4UBFA 3L9HA 1MNEA 2FL6A 1KK7A 3B6UA 3WPNA 2X51A 4PK4A 1MMNA 2VVGA 1LKXA 1VFWA 4LNUK 3KENA 4PFOA 3ZCWA 3WRDA 1F9VA 3L1CA 1FMWA 4ANJA 1D0ZA 3BFNA 1VFXA 2ZFKA 1D1AA 1I6IA 4B7BA 1D0XA 3DC4A 1F9WA 3PXNA 2Q2ZA 1V8JA 2XT3A 2ZFLA 3HQDA 3K5EA 1VFVA 4ZCAA 1BR4A 3B6VA 3H4SA 2ZFMA 1FMVA 4PJJA 1BR1A 2V26A 2NCDA 5LT3A 2IEHA 1BG2A 4Y05A 1V8KA 1MKJA 2ZFJA 2G1QA 2HEHA 3KINA 4AS7A 4ETPA 3ZFDA 1D1CA 4DBQA 4A51A 4E7ZA 2X2RA 4HNAK 1MMGA 3CNZA 3T0QA 2ZFIA 2X7CA 5LT2A 2KINA 1CZ7A 2Y65A 2UYIA 2OWMA 4BXNA 4A14A 5HLEA 4AP0A 1N6MA 1MMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U06 A;  1Q0B A;  3COB A;  3LRE A;  1X88 A;  1MMA A;  2Q2Y A;  1I5S A;  3K3B A;  1LVK A;  2WOG A;  4FRZ A;  2XAE A;  3X2T A;  4PJN A;  1VFZ A;  4PJL A;  2Y5W A;  2VAS A;  4PJM A;  4H1G A;  3DCB A;  2X7E A;  1G8X A;  4GKR A;  4A50 A;  5LT1 A;  1SDM A;  4A5Y A;  2GRY A;  2X7D A;  1D0Y A;  4BN2 A;  2FKY A;  5LT0 A;  2UYM A;  2PG2 A;  4BBG A;  2MYS A;  3ZFC A;  1II6 A;  3NWN A;  1T5C A;  4PFP A;  4A28 A;  1YRS A;  2GM1 A;  3CJO A;  1GOJ A;  4DBR A;  2FME A;  5GSZ A;  4E7S A;  1D1B A;  1BR2 A;  1F9T A;  1VOM A;  3KAR A;  5LT4 A;  2VB6 A;  1F9U A;  4ZHI A;  2FL2 A;  1RY6 A;  4A1Z A;  3GBJ A;  4UBF A;  3L9H A;  1MNE A;  2FL6 A;  1KK7 A;  3B6U A;  3WPN A;  2X51 A;  4PK4 A;  1MMN A;  2VVG A;  1LKX A;  1VFW A;  4LNU K;  3KEN A;  4PFO A;  3ZCW A;  3WRD A;  1F9V A;  3L1C A;  1FMW A;  4ANJ A;  1D0Z A;  3BFN A;  1VFX A;  2ZFK A;  1D1A A;  1I6I A;  4B7B A;  1D0X A;  3DC4 A;  1F9W A;  3PXN A;  2Q2Z A;  1V8J A;  2XT3 A;  2ZFL A;  3HQD A;  3K5E A;  1VFV A;  4ZCA A;  1BR4 A;  3B6V A;  3H4S A;  2ZFM A;  1FMV A;  4PJJ A;  1BR1 A;  2V26 A;  2NCD A;  5LT3 A;  2IEH A;  1BG2 A;  4Y05 A;  1V8K A;  1MKJ A;  2ZFJ A;  2G1Q A;  2HEH A;  3KIN A;  4AS7 A;  4ETP A;  3ZFD A;  1D1C A;  4DBQ A;  4A51 A;  4E7Z A;  2X2R A;  4HNA K;  1MMG A;  3CNZ A;  3T0Q A;  2ZFI A;  2X7C A;  5LT2 A;  2KIN A;  1CZ7 A;  2Y65 A;  2UYI A;  2OWM A;  4BXN A;  4A14 A;  5HLE A;  4AP0 A;  1N6M A;  1MMD A; 
#chains in the Genus database with same CATH topology
 3U06 A;  1Q0B A;  3COB A;  3LRE A;  1X88 A;  1MMA A;  2Q2Y A;  1I5S A;  3K3B A;  1LVK A;  2WOG A;  4FRZ A;  2XAE A;  3X2T A;  4PJN A;  1VFZ A;  4PJL A;  2Y5W A;  2VAS A;  4PJM A;  4H1G A;  3DCB A;  2X7E A;  1G8X A;  4GKR A;  4A50 A;  5LT1 A;  1SDM A;  4A5Y A;  2GRY A;  2X7D A;  1D0Y A;  4BN2 A;  2FKY A;  5LT0 A;  2UYM A;  4GKQ A;  2PG2 A;  4BBG A;  2MYS A;  3ZFC A;  1II6 A;  3NWN A;  1T5C A;  4PFP A;  4A28 A;  1YRS A;  2GM1 A;  4ETP B;  3CJO A;  1GOJ A;  4DBR A;  2FME A;  5GSZ A;  4E7S A;  1D1B A;  4GKP A;  1BR2 A;  1F9T A;  1VOM A;  3KAR A;  5LT4 A;  2VB6 A;  1F9U A;  4ZHI A;  2FL2 A;  1RY6 A;  4A1Z A;  3GBJ A;  4UBF A;  3L9H A;  1MNE A;  2FL6 A;  1KK7 A;  3B6U A;  3WPN A;  2X51 A;  4PK4 A;  1MMN A;  2VVG A;  1LKX A;  1VFW A;  4LNU K;  3KEN A;  4PFO A;  3ZCW A;  3WRD A;  1F9V A;  3L1C A;  1FMW A;  4ANJ A;  1D0Z A;  3BFN A;  1VFX A;  2ZFK A;  1D1A A;  1I6I A;  4B7B A;  1D0X A;  3DC4 A;  1F9W A;  3PXN A;  2Q2Z A;  1V8J A;  2XT3 A;  2ZFL A;  3HQD A;  3K5E A;  1VFV A;  4ZCA A;  1BR4 A;  3B6V A;  3H4S A;  2ZFM A;  1FMV A;  4PJJ A;  1BR1 A;  2V26 A;  2NCD A;  5LT3 A;  2IEH A;  1BG2 A;  4Y05 A;  1V8K A;  1MKJ A;  2ZFJ A;  2G1Q A;  2HEH A;  3KIN A;  4AS7 A;  4ETP A;  3ZFD A;  1D1C A;  4DBQ A;  4A51 A;  4E7Z A;  2X2R A;  4HNA K;  1MMG A;  3CNZ A;  3T0Q A;  2O0A A;  2ZFI A;  2X7C A;  5LT2 A;  2KIN A;  1CZ7 A;  2Y65 A;  2UYI A;  2OWM A;  4BXN A;  4A14 A;  5HLE A;  4AP0 A;  1N6M A;  1MMD A; 
#chains in the Genus database with same CATH homology
 3U06 A;  1Q0B A;  3COB A;  3LRE A;  1X88 A;  1MMA A;  2Q2Y A;  1I5S A;  3K3B A;  1LVK A;  2WOG A;  4FRZ A;  2XAE A;  3X2T A;  4PJN A;  1VFZ A;  4PJL A;  2Y5W A;  2VAS A;  4PJM A;  4H1G A;  3DCB A;  2X7E A;  1G8X A;  4GKR A;  4A50 A;  5LT1 A;  1SDM A;  4A5Y A;  2GRY A;  2X7D A;  1D0Y A;  4BN2 A;  2FKY A;  5LT0 A;  2UYM A;  2PG2 A;  4BBG A;  2MYS A;  3ZFC A;  1II6 A;  3NWN A;  1T5C A;  4PFP A;  4A28 A;  1YRS A;  2GM1 A;  3CJO A;  1GOJ A;  4DBR A;  2FME A;  5GSZ A;  4E7S A;  1D1B A;  1BR2 A;  1F9T A;  1VOM A;  3KAR A;  5LT4 A;  2VB6 A;  1F9U A;  4ZHI A;  2FL2 A;  1RY6 A;  4A1Z A;  3GBJ A;  4UBF A;  3L9H A;  1MNE A;  2FL6 A;  1KK7 A;  3B6U A;  3WPN A;  2X51 A;  4PK4 A;  1MMN A;  2VVG A;  1LKX A;  1VFW A;  4LNU K;  3KEN A;  4PFO A;  3ZCW A;  3WRD A;  1F9V A;  3L1C A;  1FMW A;  4ANJ A;  1D0Z A;  3BFN A;  1VFX A;  2ZFK A;  1D1A A;  1I6I A;  4B7B A;  1D0X A;  3DC4 A;  1F9W A;  3PXN A;  2Q2Z A;  1V8J A;  2XT3 A;  2ZFL A;  3HQD A;  3K5E A;  1VFV A;  4ZCA A;  1BR4 A;  3B6V A;  3H4S A;  2ZFM A;  1FMV A;  4PJJ A;  1BR1 A;  2V26 A;  2NCD A;  5LT3 A;  2IEH A;  1BG2 A;  4Y05 A;  1V8K A;  1MKJ A;  2ZFJ A;  2G1Q A;  2HEH A;  3KIN A;  4AS7 A;  4ETP A;  3ZFD A;  1D1C A;  4DBQ A;  4A51 A;  4E7Z A;  2X2R A;  4HNA K;  1MMG A;  3CNZ A;  3T0Q A;  2ZFI A;  2X7C A;  5LT2 A;  2KIN A;  1CZ7 A;  2Y65 A;  2UYI A;  2OWM A;  4BXN A;  4A14 A;  5HLE A;  4AP0 A;  1N6M A;  1MMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...