4GKRA

Structure of the c-terminal motor domain of kar3 from candida glabrata
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
336
structure length
296
Chain Sequence
NIRVYCRIRPPLPHEDDNIEHIKVQPFDDDNGDQGMTINRGNSQVIPFKFDKIFDQQETNDEIFKEVGQLIQSSLDGYNVCIFAYGQTGSGKTYTMLNPGDGIVPATINHIFSWIDKLAARGWSYKVSCEFIEIYNENIVDLLRKHEIRHDQELKTTYITNITTCVLDSRDTVDKVLKRASTAANEHSSRSHSIFIIHLEGKNEGTGEKSQGILNLVDLAGSERLSINKSLSCLGDVIHALNSKRHIPFRNSKLTYLLQYSLIGSSKTLMFVNISPAALHLNETINSLRFASKVNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Neck and C-terminal motor domain of Kar3
publication title Neck Rotation and Neck Mimic Docking in the Noncatalytic Kar3-associated Protein Vik1.
pubmed doi rcsb
source organism Candida glabrata
molecule tags Structural protein
total genus 88
structure length 296
sequence length 336
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 4gkrA00
2WOGA 4ZCAA 4FRZA 1D0ZA 3LREA 4ZHIA 4DBRA 1X88A 3T0QA 4E7SA 3COBA 4PJLA 1V8JA 1D1AA 3ZFDA 1D1CA 4BN2A 3L1CA 1FMWA 2HEHA 5LT3A 3KENA 1LVKA 1F9UA 1F9TA 2FKYA 5LT1A 3KARA 3H4SA 2ZFKA 2VVGA 2ZFIA 1D1BA 3DCBA 3K5EA 1GOJA 4A51A 1VFZA 3CJOA 1YRSA 5GSZA 1VFXA 1N6MA 4PJMA 1MMAA 3ZCWA 4E7ZA 2X2RA 2PG2A 2XT3A 3WPNA 2ZFMA 4A28A 3L9HA 1VFWA 2UYMA 1Q0BA 1D0XA 2Q2ZA 2FL2A 1CZ7A 2X51A 4PJJA 1II6A 2MYSA 1KK7A 1SDMA 4PJNA 1VOMA 1T5CA 1BR4A 1MMDA 1VFVA 4BXNA 4A14A 4A5YA 4AP0A 2VASA 5LT4A 5LT2A 2KINA 2Y5WA 4ETPA 1MMGA 4HNAK 4A1ZA 4PK4A 2GM1A 3BFNA 1BR1A 1MKJA 1V8KA 4Y05A 3WRDA 2OWMA 1BR2A 2Y65A 3KINA 3NWNA 2UYIA 4GKRA 2V26A 3X2TA 3GBJA 1LKXA 1MMNA 2ZFLA 2X7CA 5HLEA 5LT0A 3U06A 4ANJA 2ZFJA 2G1QA 1RY6A 1F9VA 2GRYA 4DBQA 4B7BA 1FMVA 4A50A 2NCDA 2XAEA 3B6UA 3HQDA 3K3BA 1I6IA 1D0YA 2IEHA 3ZFCA 3CNZA 4H1GA 2FL6A 4AS7A 4BBGA 2FMEA 4PFOA 1F9WA 1MNEA 1I5SA 3PXNA 2X7EA 4LNUK 4UBFA 2VB6A 4PFPA 3B6VA 1G8XA 2X7DA 2Q2YA 1BG2A 3DC4A
chains in the Genus database with same CATH superfamily
2WOGA 4ZCAA 4FRZA 1D0ZA 3LREA 4ZHIA 4DBRA 1X88A 3T0QA 4E7SA 3COBA 4PJLA 1V8JA 1D1AA 3ZFDA 1D1CA 4BN2A 3L1CA 1FMWA 2HEHA 5LT3A 3KENA 1LVKA 1F9UA 1F9TA 4GKQA 2FKYA 5LT1A 3KARA 3H4SA 2ZFKA 2VVGA 2ZFIA 1D1BA 3DCBA 3K5EA 1GOJA 4A51A 1VFZA 4ETPB 3CJOA 1YRSA 2O0AA 5GSZA 1VFXA 1N6MA 4PJMA 1MMAA 3ZCWA 4E7ZA 2X2RA 2PG2A 2XT3A 3WPNA 2ZFMA 4A28A 3L9HA 1VFWA 2UYMA 1Q0BA 1D0XA 2Q2ZA 2FL2A 1CZ7A 2X51A 4PJJA 1II6A 2MYSA 1KK7A 1SDMA 4PJNA 1VOMA 1T5CA 1BR4A 1MMDA 1VFVA 4BXNA 4A14A 4A5YA 4AP0A 2VASA 5LT4A 5LT2A 2KINA 2Y5WA 4ETPA 1MMGA 4HNAK 4A1ZA 4PK4A 2GM1A 3BFNA 1BR1A 1MKJA 1V8KA 4Y05A 3WRDA 2OWMA 1BR2A 2Y65A 3KINA 3NWNA 2UYIA 4GKRA 2V26A 3X2TA 3GBJA 1LKXA 1MMNA 2ZFLA 2X7CA 5HLEA 5LT0A 3U06A 4ANJA 2ZFJA 2G1QA 1RY6A 1F9VA 2GRYA 4DBQA 4B7BA 1FMVA 4A50A 2NCDA 2XAEA 3B6UA 3HQDA 3K3BA 1I6IA 1D0YA 2IEHA 4GKPA 3ZFCA 3CNZA 4H1GA 2FL6A 4AS7A 4BBGA 2FMEA 4PFOA 1F9WA 1MNEA 1I5SA 3PXNA 2X7EA 4LNUK 4UBFA 2VB6A 4PFPA 3B6VA 1G8XA 2X7DA 2Q2YA 1BG2A 3DC4A
chains in the Genus database with same CATH topology
2WOGA 4ZCAA 4FRZA 1D0ZA 3LREA 4ZHIA 4DBRA 1X88A 3T0QA 4E7SA 3COBA 4PJLA 1V8JA 1D1AA 3ZFDA 1D1CA 4BN2A 3L1CA 1FMWA 2HEHA 5LT3A 3KENA 1LVKA 1F9UA 1F9TA 2FKYA 5LT1A 3KARA 3H4SA 2ZFKA 2VVGA 2ZFIA 1D1BA 3DCBA 3K5EA 1GOJA 4A51A 1VFZA 3CJOA 1YRSA 5GSZA 1VFXA 1N6MA 4PJMA 1MMAA 3ZCWA 4E7ZA 2X2RA 2PG2A 2XT3A 3WPNA 2ZFMA 4A28A 3L9HA 1VFWA 2UYMA 1Q0BA 1D0XA 2Q2ZA 2FL2A 1CZ7A 2X51A 4PJJA 1II6A 2MYSA 1KK7A 1SDMA 4PJNA 1VOMA 1T5CA 1BR4A 1MMDA 1VFVA 4BXNA 4A14A 4A5YA 4AP0A 2VASA 5LT4A 5LT2A 2KINA 2Y5WA 4ETPA 1MMGA 4HNAK 4A1ZA 4PK4A 2GM1A 3BFNA 1BR1A 1MKJA 1V8KA 4Y05A 3WRDA 2OWMA 1BR2A 2Y65A 3KINA 3NWNA 2UYIA 4GKRA 2V26A 3X2TA 3GBJA 1LKXA 1MMNA 2ZFLA 2X7CA 5HLEA 5LT0A 3U06A 4ANJA 2ZFJA 2G1QA 1RY6A 1F9VA 2GRYA 4DBQA 4B7BA 1FMVA 4A50A 2NCDA 2XAEA 3B6UA 3HQDA 3K3BA 1I6IA 1D0YA 2IEHA 3ZFCA 3CNZA 4H1GA 2FL6A 4AS7A 4BBGA 2FMEA 4PFOA 1F9WA 1MNEA 1I5SA 3PXNA 2X7EA 4LNUK 4UBFA 2VB6A 4PFPA 3B6VA 1G8XA 2X7DA 2Q2YA 1BG2A 3DC4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WOG A;  4ZCA A;  4FRZ A;  1D0Z A;  3LRE A;  4ZHI A;  4DBR A;  1X88 A;  3T0Q A;  4E7S A;  3COB A;  4PJL A;  1V8J A;  1D1A A;  3ZFD A;  1D1C A;  4BN2 A;  3L1C A;  1FMW A;  2HEH A;  5LT3 A;  3KEN A;  1LVK A;  1F9U A;  1F9T A;  2FKY A;  5LT1 A;  3KAR A;  3H4S A;  2ZFK A;  2VVG A;  2ZFI A;  1D1B A;  3DCB A;  3K5E A;  1GOJ A;  4A51 A;  1VFZ A;  3CJO A;  1YRS A;  5GSZ A;  1VFX A;  1N6M A;  4PJM A;  1MMA A;  3ZCW A;  4E7Z A;  2X2R A;  2PG2 A;  2XT3 A;  3WPN A;  2ZFM A;  4A28 A;  3L9H A;  1VFW A;  2UYM A;  1Q0B A;  1D0X A;  2Q2Z A;  2FL2 A;  1CZ7 A;  2X51 A;  4PJJ A;  1II6 A;  2MYS A;  1KK7 A;  1SDM A;  4PJN A;  1VOM A;  1T5C A;  1BR4 A;  1MMD A;  1VFV A;  4BXN A;  4A14 A;  4A5Y A;  4AP0 A;  2VAS A;  5LT4 A;  5LT2 A;  2KIN A;  2Y5W A;  4ETP A;  1MMG A;  4HNA K;  4A1Z A;  4PK4 A;  2GM1 A;  3BFN A;  1BR1 A;  1MKJ A;  1V8K A;  4Y05 A;  3WRD A;  2OWM A;  1BR2 A;  2Y65 A;  3KIN A;  3NWN A;  2UYI A;  4GKR A;  2V26 A;  3X2T A;  3GBJ A;  1LKX A;  1MMN A;  2ZFL A;  2X7C A;  5HLE A;  5LT0 A;  3U06 A;  4ANJ A;  2ZFJ A;  2G1Q A;  1RY6 A;  1F9V A;  2GRY A;  4DBQ A;  4B7B A;  1FMV A;  4A50 A;  2NCD A;  2XAE A;  3B6U A;  3HQD A;  3K3B A;  1I6I A;  1D0Y A;  2IEH A;  3ZFC A;  3CNZ A;  4H1G A;  2FL6 A;  4AS7 A;  4BBG A;  2FME A;  4PFO A;  1F9W A;  1MNE A;  1I5S A;  3PXN A;  2X7E A;  4LNU K;  4UBF A;  2VB6 A;  4PFP A;  3B6V A;  1G8X A;  2X7D A;  2Q2Y A;  1BG2 A;  3DC4 A; 
#chains in the Genus database with same CATH topology
 2WOG A;  4ZCA A;  4FRZ A;  1D0Z A;  3LRE A;  4ZHI A;  4DBR A;  1X88 A;  3T0Q A;  4E7S A;  3COB A;  4PJL A;  1V8J A;  1D1A A;  3ZFD A;  1D1C A;  4BN2 A;  3L1C A;  1FMW A;  2HEH A;  5LT3 A;  3KEN A;  1LVK A;  1F9U A;  1F9T A;  4GKQ A;  2FKY A;  5LT1 A;  3KAR A;  3H4S A;  2ZFK A;  2VVG A;  2ZFI A;  1D1B A;  3DCB A;  3K5E A;  1GOJ A;  4A51 A;  1VFZ A;  4ETP B;  3CJO A;  1YRS A;  2O0A A;  5GSZ A;  1VFX A;  1N6M A;  4PJM A;  1MMA A;  3ZCW A;  4E7Z A;  2X2R A;  2PG2 A;  2XT3 A;  3WPN A;  2ZFM A;  4A28 A;  3L9H A;  1VFW A;  2UYM A;  1Q0B A;  1D0X A;  2Q2Z A;  2FL2 A;  1CZ7 A;  2X51 A;  4PJJ A;  1II6 A;  2MYS A;  1KK7 A;  1SDM A;  4PJN A;  1VOM A;  1T5C A;  1BR4 A;  1MMD A;  1VFV A;  4BXN A;  4A14 A;  4A5Y A;  4AP0 A;  2VAS A;  5LT4 A;  5LT2 A;  2KIN A;  2Y5W A;  4ETP A;  1MMG A;  4HNA K;  4A1Z A;  4PK4 A;  2GM1 A;  3BFN A;  1BR1 A;  1MKJ A;  1V8K A;  4Y05 A;  3WRD A;  2OWM A;  1BR2 A;  2Y65 A;  3KIN A;  3NWN A;  2UYI A;  4GKR A;  2V26 A;  3X2T A;  3GBJ A;  1LKX A;  1MMN A;  2ZFL A;  2X7C A;  5HLE A;  5LT0 A;  3U06 A;  4ANJ A;  2ZFJ A;  2G1Q A;  1RY6 A;  1F9V A;  2GRY A;  4DBQ A;  4B7B A;  1FMV A;  4A50 A;  2NCD A;  2XAE A;  3B6U A;  3HQD A;  3K3B A;  1I6I A;  1D0Y A;  2IEH A;  4GKP A;  3ZFC A;  3CNZ A;  4H1G A;  2FL6 A;  4AS7 A;  4BBG A;  2FME A;  4PFO A;  1F9W A;  1MNE A;  1I5S A;  3PXN A;  2X7E A;  4LNU K;  4UBF A;  2VB6 A;  4PFP A;  3B6V A;  1G8X A;  2X7D A;  2Q2Y A;  1BG2 A;  3DC4 A; 
#chains in the Genus database with same CATH homology
 2WOG A;  4ZCA A;  4FRZ A;  1D0Z A;  3LRE A;  4ZHI A;  4DBR A;  1X88 A;  3T0Q A;  4E7S A;  3COB A;  4PJL A;  1V8J A;  1D1A A;  3ZFD A;  1D1C A;  4BN2 A;  3L1C A;  1FMW A;  2HEH A;  5LT3 A;  3KEN A;  1LVK A;  1F9U A;  1F9T A;  2FKY A;  5LT1 A;  3KAR A;  3H4S A;  2ZFK A;  2VVG A;  2ZFI A;  1D1B A;  3DCB A;  3K5E A;  1GOJ A;  4A51 A;  1VFZ A;  3CJO A;  1YRS A;  5GSZ A;  1VFX A;  1N6M A;  4PJM A;  1MMA A;  3ZCW A;  4E7Z A;  2X2R A;  2PG2 A;  2XT3 A;  3WPN A;  2ZFM A;  4A28 A;  3L9H A;  1VFW A;  2UYM A;  1Q0B A;  1D0X A;  2Q2Z A;  2FL2 A;  1CZ7 A;  2X51 A;  4PJJ A;  1II6 A;  2MYS A;  1KK7 A;  1SDM A;  4PJN A;  1VOM A;  1T5C A;  1BR4 A;  1MMD A;  1VFV A;  4BXN A;  4A14 A;  4A5Y A;  4AP0 A;  2VAS A;  5LT4 A;  5LT2 A;  2KIN A;  2Y5W A;  4ETP A;  1MMG A;  4HNA K;  4A1Z A;  4PK4 A;  2GM1 A;  3BFN A;  1BR1 A;  1MKJ A;  1V8K A;  4Y05 A;  3WRD A;  2OWM A;  1BR2 A;  2Y65 A;  3KIN A;  3NWN A;  2UYI A;  4GKR A;  2V26 A;  3X2T A;  3GBJ A;  1LKX A;  1MMN A;  2ZFL A;  2X7C A;  5HLE A;  5LT0 A;  3U06 A;  4ANJ A;  2ZFJ A;  2G1Q A;  1RY6 A;  1F9V A;  2GRY A;  4DBQ A;  4B7B A;  1FMV A;  4A50 A;  2NCD A;  2XAE A;  3B6U A;  3HQD A;  3K3B A;  1I6I A;  1D0Y A;  2IEH A;  3ZFC A;  3CNZ A;  4H1G A;  2FL6 A;  4AS7 A;  4BBG A;  2FME A;  4PFO A;  1F9W A;  1MNE A;  1I5S A;  3PXN A;  2X7E A;  4LNU K;  4UBF A;  2VB6 A;  4PFP A;  3B6V A;  1G8X A;  2X7D A;  2Q2Y A;  1BG2 A;  3DC4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...