2KINA

Kinesin (monomeric) from rattus norvegicus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
238
structure length
238
Chain Sequence
ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN
publication title X-ray structure of motor and neck domains from rat brain kinesin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 63
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2kinA00
2HEHA 4GKRA 4A5YA 2FMEA 1D0YA 2VVGA 2VB6A 1BR1A 2XAEA 4DBQA 2ZFIA 5LT4A 1F9VA 3KINA 3WPNA 4A14A 3B6UA 4ETPA 3L1CA 2FKYA 2VASA 3B6VA 4A28A 1I6IA 1N6MA 4BBGA 2V26A 1KK7A 4PFOA 3CNZA 5LT1A 1LKXA 3CJOA 1BR2A 4E7ZA 3LREA 3NWNA 4PK4A 4E7SA 3U06A 2GM1A 4UBFA 3HQDA 2Q2YA 3KARA 1G8XA 1MMDA 2FL2A 1D1CA 2UYMA 5GSZA 1D1AA 2GRYA 4BXNA 4PFPA 2X7CA 1V8JA 1VFVA 3KENA 2UYIA 2X7EA 4FRZA 1RY6A 1LVKA 3L9HA 3COBA 4BN2A 4Y05A 1T5CA 2MYSA 4B7BA 2ZFLA 5HLEA 2OWMA 2XT3A 1VFWA 2ZFJA 1I5SA 2WOGA 4ZCAA 4DBRA 1BR4A 4AP0A 1VFZA 4HNAK 3X2TA 2FL6A 3BFNA 1VFXA 2X51A 1MNEA 3ZCWA 2G1QA 3WRDA 2IEHA 2PG2A 1D0ZA 1F9UA 1X88A 3GBJA 5LT3A 4PJMA 4LNUK 4PJJA 3ZFCA 2Q2ZA 3T0QA 4A50A 1D1BA 3H4SA 2Y5WA 2X2RA 1BG2A 1SDMA 4AS7A 5LT0A 4ANJA 1MMNA 1FMWA 1VOMA 1GOJA 1MMAA 3DC4A 2Y65A 3K3BA 3ZFDA 1Q0BA 4PJLA 4A1ZA 1D0XA 1F9WA 1II6A 1MMGA 1YRSA 2ZFMA 3PXNA 1CZ7A 4ZHIA 1MKJA 1F9TA 1FMVA 4H1GA 2KINA 4A51A 3DCBA 1V8KA 2NCDA 2ZFKA 4PJNA 3K5EA 5LT2A 2X7DA
chains in the Genus database with same CATH superfamily
2HEHA 4GKRA 4A5YA 2FMEA 1D0YA 2VVGA 2VB6A 1BR1A 2XAEA 4DBQA 2ZFIA 5LT4A 4GKQA 1F9VA 3KINA 3WPNA 4A14A 3B6UA 4ETPA 3L1CA 2FKYA 2VASA 3B6VA 4A28A 1I6IA 1N6MA 4BBGA 2V26A 1KK7A 4PFOA 3CNZA 4ETPB 5LT1A 1LKXA 3CJOA 1BR2A 4E7ZA 3LREA 3NWNA 4PK4A 4E7SA 3U06A 2GM1A 4UBFA 3HQDA 2Q2YA 3KARA 1G8XA 1MMDA 2FL2A 1D1CA 2UYMA 5GSZA 1D1AA 2GRYA 4GKPA 4BXNA 4PFPA 2X7CA 1V8JA 1VFVA 3KENA 2UYIA 2X7EA 4FRZA 1RY6A 1LVKA 3L9HA 3COBA 4BN2A 4Y05A 1T5CA 2MYSA 4B7BA 2ZFLA 5HLEA 2OWMA 2XT3A 1VFWA 2ZFJA 1I5SA 2WOGA 4ZCAA 4DBRA 1BR4A 4AP0A 1VFZA 4HNAK 3X2TA 2FL6A 3BFNA 1VFXA 2X51A 1MNEA 3ZCWA 2G1QA 3WRDA 2IEHA 2PG2A 1D0ZA 1F9UA 1X88A 3GBJA 5LT3A 4PJMA 4LNUK 4PJJA 3ZFCA 2Q2ZA 3T0QA 4A50A 1D1BA 3H4SA 2Y5WA 2X2RA 1BG2A 1SDMA 4AS7A 5LT0A 4ANJA 1MMNA 1FMWA 1VOMA 1GOJA 1MMAA 3DC4A 2Y65A 3K3BA 3ZFDA 1Q0BA 4PJLA 4A1ZA 1D0XA 1F9WA 1II6A 1MMGA 1YRSA 2ZFMA 3PXNA 1CZ7A 4ZHIA 1MKJA 1F9TA 1FMVA 4H1GA 2KINA 4A51A 3DCBA 1V8KA 2NCDA 2ZFKA 4PJNA 2O0AA 3K5EA 5LT2A 2X7DA
chains in the Genus database with same CATH topology
2HEHA 4GKRA 4A5YA 2FMEA 1D0YA 2VVGA 2VB6A 1BR1A 2XAEA 4DBQA 2ZFIA 5LT4A 1F9VA 3KINA 3WPNA 4A14A 3B6UA 4ETPA 3L1CA 2FKYA 2VASA 3B6VA 4A28A 1I6IA 1N6MA 4BBGA 2V26A 1KK7A 4PFOA 3CNZA 5LT1A 1LKXA 3CJOA 1BR2A 4E7ZA 3LREA 3NWNA 4PK4A 4E7SA 3U06A 2GM1A 4UBFA 3HQDA 2Q2YA 3KARA 1G8XA 1MMDA 2FL2A 1D1CA 2UYMA 5GSZA 1D1AA 2GRYA 4BXNA 4PFPA 2X7CA 1V8JA 1VFVA 3KENA 2UYIA 2X7EA 4FRZA 1RY6A 1LVKA 3L9HA 3COBA 4BN2A 4Y05A 1T5CA 2MYSA 4B7BA 2ZFLA 5HLEA 2OWMA 2XT3A 1VFWA 2ZFJA 1I5SA 2WOGA 4ZCAA 4DBRA 1BR4A 4AP0A 1VFZA 4HNAK 3X2TA 2FL6A 3BFNA 1VFXA 2X51A 1MNEA 3ZCWA 2G1QA 3WRDA 2IEHA 2PG2A 1D0ZA 1F9UA 1X88A 3GBJA 5LT3A 4PJMA 4LNUK 4PJJA 3ZFCA 2Q2ZA 3T0QA 4A50A 1D1BA 3H4SA 2Y5WA 2X2RA 1BG2A 1SDMA 4AS7A 5LT0A 4ANJA 1MMNA 1FMWA 1VOMA 1GOJA 1MMAA 3DC4A 2Y65A 3K3BA 3ZFDA 1Q0BA 4PJLA 4A1ZA 1D0XA 1F9WA 1II6A 1MMGA 1YRSA 2ZFMA 3PXNA 1CZ7A 4ZHIA 1MKJA 1F9TA 1FMVA 4H1GA 2KINA 4A51A 3DCBA 1V8KA 2NCDA 2ZFKA 4PJNA 3K5EA 5LT2A 2X7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEH A;  4GKR A;  4A5Y A;  2FME A;  1D0Y A;  2VVG A;  2VB6 A;  1BR1 A;  2XAE A;  4DBQ A;  2ZFI A;  5LT4 A;  1F9V A;  3KIN A;  3WPN A;  4A14 A;  3B6U A;  4ETP A;  3L1C A;  2FKY A;  2VAS A;  3B6V A;  4A28 A;  1I6I A;  1N6M A;  4BBG A;  2V26 A;  1KK7 A;  4PFO A;  3CNZ A;  5LT1 A;  1LKX A;  3CJO A;  1BR2 A;  4E7Z A;  3LRE A;  3NWN A;  4PK4 A;  4E7S A;  3U06 A;  2GM1 A;  4UBF A;  3HQD A;  2Q2Y A;  3KAR A;  1G8X A;  1MMD A;  2FL2 A;  1D1C A;  2UYM A;  5GSZ A;  1D1A A;  2GRY A;  4BXN A;  4PFP A;  2X7C A;  1V8J A;  1VFV A;  3KEN A;  2UYI A;  2X7E A;  4FRZ A;  1RY6 A;  1LVK A;  3L9H A;  3COB A;  4BN2 A;  4Y05 A;  1T5C A;  2MYS A;  4B7B A;  2ZFL A;  5HLE A;  2OWM A;  2XT3 A;  1VFW A;  2ZFJ A;  1I5S A;  2WOG A;  4ZCA A;  4DBR A;  1BR4 A;  4AP0 A;  1VFZ A;  4HNA K;  3X2T A;  2FL6 A;  3BFN A;  1VFX A;  2X51 A;  1MNE A;  3ZCW A;  2G1Q A;  3WRD A;  2IEH A;  2PG2 A;  1D0Z A;  1F9U A;  1X88 A;  3GBJ A;  5LT3 A;  4PJM A;  4LNU K;  4PJJ A;  3ZFC A;  2Q2Z A;  3T0Q A;  4A50 A;  1D1B A;  3H4S A;  2Y5W A;  2X2R A;  1BG2 A;  1SDM A;  4AS7 A;  5LT0 A;  4ANJ A;  1MMN A;  1FMW A;  1VOM A;  1GOJ A;  1MMA A;  3DC4 A;  2Y65 A;  3K3B A;  3ZFD A;  1Q0B A;  4PJL A;  4A1Z A;  1D0X A;  1F9W A;  1II6 A;  1MMG A;  1YRS A;  2ZFM A;  3PXN A;  1CZ7 A;  4ZHI A;  1MKJ A;  1F9T A;  1FMV A;  4H1G A;  2KIN A;  4A51 A;  3DCB A;  1V8K A;  2NCD A;  2ZFK A;  4PJN A;  3K5E A;  5LT2 A;  2X7D A; 
#chains in the Genus database with same CATH topology
 2HEH A;  4GKR A;  4A5Y A;  2FME A;  1D0Y A;  2VVG A;  2VB6 A;  1BR1 A;  2XAE A;  4DBQ A;  2ZFI A;  5LT4 A;  4GKQ A;  1F9V A;  3KIN A;  3WPN A;  4A14 A;  3B6U A;  4ETP A;  3L1C A;  2FKY A;  2VAS A;  3B6V A;  4A28 A;  1I6I A;  1N6M A;  4BBG A;  2V26 A;  1KK7 A;  4PFO A;  3CNZ A;  4ETP B;  5LT1 A;  1LKX A;  3CJO A;  1BR2 A;  4E7Z A;  3LRE A;  3NWN A;  4PK4 A;  4E7S A;  3U06 A;  2GM1 A;  4UBF A;  3HQD A;  2Q2Y A;  3KAR A;  1G8X A;  1MMD A;  2FL2 A;  1D1C A;  2UYM A;  5GSZ A;  1D1A A;  2GRY A;  4GKP A;  4BXN A;  4PFP A;  2X7C A;  1V8J A;  1VFV A;  3KEN A;  2UYI A;  2X7E A;  4FRZ A;  1RY6 A;  1LVK A;  3L9H A;  3COB A;  4BN2 A;  4Y05 A;  1T5C A;  2MYS A;  4B7B A;  2ZFL A;  5HLE A;  2OWM A;  2XT3 A;  1VFW A;  2ZFJ A;  1I5S A;  2WOG A;  4ZCA A;  4DBR A;  1BR4 A;  4AP0 A;  1VFZ A;  4HNA K;  3X2T A;  2FL6 A;  3BFN A;  1VFX A;  2X51 A;  1MNE A;  3ZCW A;  2G1Q A;  3WRD A;  2IEH A;  2PG2 A;  1D0Z A;  1F9U A;  1X88 A;  3GBJ A;  5LT3 A;  4PJM A;  4LNU K;  4PJJ A;  3ZFC A;  2Q2Z A;  3T0Q A;  4A50 A;  1D1B A;  3H4S A;  2Y5W A;  2X2R A;  1BG2 A;  1SDM A;  4AS7 A;  5LT0 A;  4ANJ A;  1MMN A;  1FMW A;  1VOM A;  1GOJ A;  1MMA A;  3DC4 A;  2Y65 A;  3K3B A;  3ZFD A;  1Q0B A;  4PJL A;  4A1Z A;  1D0X A;  1F9W A;  1II6 A;  1MMG A;  1YRS A;  2ZFM A;  3PXN A;  1CZ7 A;  4ZHI A;  1MKJ A;  1F9T A;  1FMV A;  4H1G A;  2KIN A;  4A51 A;  3DCB A;  1V8K A;  2NCD A;  2ZFK A;  4PJN A;  2O0A A;  3K5E A;  5LT2 A;  2X7D A; 
#chains in the Genus database with same CATH homology
 2HEH A;  4GKR A;  4A5Y A;  2FME A;  1D0Y A;  2VVG A;  2VB6 A;  1BR1 A;  2XAE A;  4DBQ A;  2ZFI A;  5LT4 A;  1F9V A;  3KIN A;  3WPN A;  4A14 A;  3B6U A;  4ETP A;  3L1C A;  2FKY A;  2VAS A;  3B6V A;  4A28 A;  1I6I A;  1N6M A;  4BBG A;  2V26 A;  1KK7 A;  4PFO A;  3CNZ A;  5LT1 A;  1LKX A;  3CJO A;  1BR2 A;  4E7Z A;  3LRE A;  3NWN A;  4PK4 A;  4E7S A;  3U06 A;  2GM1 A;  4UBF A;  3HQD A;  2Q2Y A;  3KAR A;  1G8X A;  1MMD A;  2FL2 A;  1D1C A;  2UYM A;  5GSZ A;  1D1A A;  2GRY A;  4BXN A;  4PFP A;  2X7C A;  1V8J A;  1VFV A;  3KEN A;  2UYI A;  2X7E A;  4FRZ A;  1RY6 A;  1LVK A;  3L9H A;  3COB A;  4BN2 A;  4Y05 A;  1T5C A;  2MYS A;  4B7B A;  2ZFL A;  5HLE A;  2OWM A;  2XT3 A;  1VFW A;  2ZFJ A;  1I5S A;  2WOG A;  4ZCA A;  4DBR A;  1BR4 A;  4AP0 A;  1VFZ A;  4HNA K;  3X2T A;  2FL6 A;  3BFN A;  1VFX A;  2X51 A;  1MNE A;  3ZCW A;  2G1Q A;  3WRD A;  2IEH A;  2PG2 A;  1D0Z A;  1F9U A;  1X88 A;  3GBJ A;  5LT3 A;  4PJM A;  4LNU K;  4PJJ A;  3ZFC A;  2Q2Z A;  3T0Q A;  4A50 A;  1D1B A;  3H4S A;  2Y5W A;  2X2R A;  1BG2 A;  1SDM A;  4AS7 A;  5LT0 A;  4ANJ A;  1MMN A;  1FMW A;  1VOM A;  1GOJ A;  1MMA A;  3DC4 A;  2Y65 A;  3K3B A;  3ZFD A;  1Q0B A;  4PJL A;  4A1Z A;  1D0X A;  1F9W A;  1II6 A;  1MMG A;  1YRS A;  2ZFM A;  3PXN A;  1CZ7 A;  4ZHI A;  1MKJ A;  1F9T A;  1FMV A;  4H1G A;  2KIN A;  4A51 A;  3DCB A;  1V8K A;  2NCD A;  2ZFK A;  4PJN A;  3K5E A;  5LT2 A;  2X7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...