2KINA

Kinesin (monomeric) from rattus norvegicus
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
238
structure length
238
Chain Sequence
b'ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN
publication title X-ray structure of motor and neck domains from rat brain kinesin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 63
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1997-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2kinA00
1FMVA 1I5SA 4AP0A 2XT3A 2ZFIA 4AS7A 1RY6A 1BR4A 2KINA 3BFNA 2X2RA 2NCDA 1D1BA 4A1ZA 1D0XA 1SDMA 1VFVA 4A51A 1BR2A 2IEHA 3KENA 3U06A 4PK4A 3CJOA 2FL6A 4BN2A 3LREA 1CZ7A 4ZCAA 4FRZA 5LT4A 1F9TA 4BBGA 2HEHA 4DBQA 2X7CA 4PJMA 2ZFMA 2ZFJA 3WRDA 4B7BA 4LNUK 2GM1A 5GSZA 4PJLA 2FL2A 3DC4A 4GKRA 1F9VA 1LKXA 2X7DA 4PJJA 3ZCWA 1MNEA 3CNZA 1MMGA 2VB6A 1D1AA 2G1QA 1VFXA 1BG2A 2WOGA 3T0QA 1YRSA 4H1GA 1II6A 4DBRA 4A28A 1F9WA 5LT1A 1BR1A 2Y65A 2ZFKA 1MMDA 2MYSA 3B6VA 1MMNA 2Q2ZA 2Y5WA 1KK7A 3K3BA 1VOMA 2FKYA 4ETPA 2OWMA 1V8KA 2V26A 3H4SA 4UBFA 3COBA 3ZFDA 2XAEA 1F9UA 2VASA 1D0ZA 3NWNA 1VFWA 1MMAA 1D1CA 2PG2A 4ANJA 4E7ZA 2ZFLA 3GBJA 5HLEA 3ZFCA 2X7EA 4E7SA 1T5CA 4PJNA 4Y05A 4PFOA 5LT2A 1I6IA 4A14A 1Q0BA 2VVGA 1MKJA 2X51A 1X88A 3KARA 1D0YA 1VFZA 1N6MA 3PXNA 4PFPA 3X2TA 3KINA 3L1CA 5LT0A 1V8JA 3B6UA 1LVKA 3K5EA 4HNAK 1GOJA 2GRYA 5LT3A 4ZHIA 2Q2YA 1FMWA 3HQDA 3WPNA 4A50A 1G8XA 2UYIA 4A5YA 2FMEA 3L9HA 4BXNA 3DCBA 2UYMA
chains in the Genus database with same CATH superfamily
1FMVA 1I5SA 4AP0A 2XT3A 2ZFIA 4AS7A 1RY6A 1BR4A 2KINA 3BFNA 2X2RA 2NCDA 1D1BA 4A1ZA 1D0XA 1SDMA 1VFVA 4A51A 1BR2A 2IEHA 3KENA 3U06A 4PK4A 3CJOA 2FL6A 4BN2A 3LREA 4GKPA 1CZ7A 4ZCAA 4FRZA 5LT4A 1F9TA 4BBGA 2HEHA 4DBQA 2X7CA 4PJMA 2ZFMA 2ZFJA 3WRDA 4B7BA 4LNUK 2GM1A 4ETPB 5GSZA 4PJLA 2FL2A 3DC4A 4GKRA 1F9VA 1LKXA 2X7DA 4PJJA 3ZCWA 1MNEA 3CNZA 1MMGA 2VB6A 1D1AA 2G1QA 1VFXA 1BG2A 4GKQA 2WOGA 3T0QA 1YRSA 4H1GA 1II6A 4DBRA 4A28A 1F9WA 5LT1A 1BR1A 2Y65A 2ZFKA 1MMDA 2MYSA 3B6VA 1MMNA 2Q2ZA 2Y5WA 1KK7A 3K3BA 1VOMA 2FKYA 4ETPA 2OWMA 1V8KA 2V26A 3H4SA 4UBFA 3COBA 3ZFDA 2XAEA 1F9UA 2VASA 1D0ZA 3NWNA 1VFWA 1MMAA 1D1CA 2PG2A 4ANJA 4E7ZA 2ZFLA 3GBJA 5HLEA 3ZFCA 2X7EA 4E7SA 1T5CA 4PJNA 4Y05A 4PFOA 5LT2A 1I6IA 4A14A 1Q0BA 2VVGA 1MKJA 2X51A 1X88A 3KARA 1D0YA 1VFZA 1N6MA 3PXNA 4PFPA 3X2TA 3KINA 3L1CA 2O0AA 5LT0A 1V8JA 3B6UA 1LVKA 3K5EA 4HNAK 1GOJA 2GRYA 5LT3A 4ZHIA 2Q2YA 1FMWA 3HQDA 3WPNA 4A50A 1G8XA 2UYIA 4A5YA 2FMEA 3L9HA 4BXNA 3DCBA 2UYMA
chains in the Genus database with same CATH topology
1FMVA 1I5SA 4AP0A 2XT3A 2ZFIA 4AS7A 1RY6A 1BR4A 2KINA 3BFNA 2X2RA 2NCDA 1D1BA 4A1ZA 1D0XA 1SDMA 1VFVA 4A51A 1BR2A 2IEHA 3KENA 3U06A 4PK4A 3CJOA 2FL6A 4BN2A 3LREA 1CZ7A 4ZCAA 4FRZA 5LT4A 1F9TA 4BBGA 2HEHA 4DBQA 2X7CA 4PJMA 2ZFMA 2ZFJA 3WRDA 4B7BA 4LNUK 2GM1A 5GSZA 4PJLA 2FL2A 3DC4A 4GKRA 1F9VA 1LKXA 2X7DA 4PJJA 3ZCWA 1MNEA 3CNZA 1MMGA 2VB6A 1D1AA 2G1QA 1VFXA 1BG2A 2WOGA 3T0QA 1YRSA 4H1GA 1II6A 4DBRA 4A28A 1F9WA 5LT1A 1BR1A 2Y65A 2ZFKA 1MMDA 2MYSA 3B6VA 1MMNA 2Q2ZA 2Y5WA 1KK7A 3K3BA 1VOMA 2FKYA 4ETPA 2OWMA 1V8KA 2V26A 3H4SA 4UBFA 3COBA 3ZFDA 2XAEA 1F9UA 2VASA 1D0ZA 3NWNA 1VFWA 1MMAA 1D1CA 2PG2A 4ANJA 4E7ZA 2ZFLA 3GBJA 5HLEA 3ZFCA 2X7EA 4E7SA 1T5CA 4PJNA 4Y05A 4PFOA 5LT2A 1I6IA 4A14A 1Q0BA 2VVGA 1MKJA 2X51A 1X88A 3KARA 1D0YA 1VFZA 1N6MA 3PXNA 4PFPA 3X2TA 3KINA 3L1CA 5LT0A 1V8JA 3B6UA 1LVKA 3K5EA 4HNAK 1GOJA 2GRYA 5LT3A 4ZHIA 2Q2YA 1FMWA 3HQDA 3WPNA 4A50A 1G8XA 2UYIA 4A5YA 2FMEA 3L9HA 4BXNA 3DCBA 2UYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FMV A;  1I5S A;  4AP0 A;  2XT3 A;  2ZFI A;  4AS7 A;  1RY6 A;  1BR4 A;  2KIN A;  3BFN A;  2X2R A;  2NCD A;  1D1B A;  4A1Z A;  1D0X A;  1SDM A;  1VFV A;  4A51 A;  1BR2 A;  2IEH A;  3KEN A;  3U06 A;  4PK4 A;  3CJO A;  2FL6 A;  4BN2 A;  3LRE A;  1CZ7 A;  4ZCA A;  4FRZ A;  5LT4 A;  1F9T A;  4BBG A;  2HEH A;  4DBQ A;  2X7C A;  4PJM A;  2ZFM A;  2ZFJ A;  3WRD A;  4B7B A;  4LNU K;  2GM1 A;  5GSZ A;  4PJL A;  2FL2 A;  3DC4 A;  4GKR A;  1F9V A;  1LKX A;  2X7D A;  4PJJ A;  3ZCW A;  1MNE A;  3CNZ A;  1MMG A;  2VB6 A;  1D1A A;  2G1Q A;  1VFX A;  1BG2 A;  2WOG A;  3T0Q A;  1YRS A;  4H1G A;  1II6 A;  4DBR A;  4A28 A;  1F9W A;  5LT1 A;  1BR1 A;  2Y65 A;  2ZFK A;  1MMD A;  2MYS A;  3B6V A;  1MMN A;  2Q2Z A;  2Y5W A;  1KK7 A;  3K3B A;  1VOM A;  2FKY A;  4ETP A;  2OWM A;  1V8K A;  2V26 A;  3H4S A;  4UBF A;  3COB A;  3ZFD A;  2XAE A;  1F9U A;  2VAS A;  1D0Z A;  3NWN A;  1VFW A;  1MMA A;  1D1C A;  2PG2 A;  4ANJ A;  4E7Z A;  2ZFL A;  3GBJ A;  5HLE A;  3ZFC A;  2X7E A;  4E7S A;  1T5C A;  4PJN A;  4Y05 A;  4PFO A;  5LT2 A;  1I6I A;  4A14 A;  1Q0B A;  2VVG A;  1MKJ A;  2X51 A;  1X88 A;  3KAR A;  1D0Y A;  1VFZ A;  1N6M A;  3PXN A;  4PFP A;  3X2T A;  3KIN A;  3L1C A;  5LT0 A;  1V8J A;  3B6U A;  1LVK A;  3K5E A;  4HNA K;  1GOJ A;  2GRY A;  5LT3 A;  4ZHI A;  2Q2Y A;  1FMW A;  3HQD A;  3WPN A;  4A50 A;  1G8X A;  2UYI A;  4A5Y A;  2FME A;  3L9H A;  4BXN A;  3DCB A;  2UYM A; 
#chains in the Genus database with same CATH topology
 1FMV A;  1I5S A;  4AP0 A;  2XT3 A;  2ZFI A;  4AS7 A;  1RY6 A;  1BR4 A;  2KIN A;  3BFN A;  2X2R A;  2NCD A;  1D1B A;  4A1Z A;  1D0X A;  1SDM A;  1VFV A;  4A51 A;  1BR2 A;  2IEH A;  3KEN A;  3U06 A;  4PK4 A;  3CJO A;  2FL6 A;  4BN2 A;  3LRE A;  4GKP A;  1CZ7 A;  4ZCA A;  4FRZ A;  5LT4 A;  1F9T A;  4BBG A;  2HEH A;  4DBQ A;  2X7C A;  4PJM A;  2ZFM A;  2ZFJ A;  3WRD A;  4B7B A;  4LNU K;  2GM1 A;  4ETP B;  5GSZ A;  4PJL A;  2FL2 A;  3DC4 A;  4GKR A;  1F9V A;  1LKX A;  2X7D A;  4PJJ A;  3ZCW A;  1MNE A;  3CNZ A;  1MMG A;  2VB6 A;  1D1A A;  2G1Q A;  1VFX A;  1BG2 A;  4GKQ A;  2WOG A;  3T0Q A;  1YRS A;  4H1G A;  1II6 A;  4DBR A;  4A28 A;  1F9W A;  5LT1 A;  1BR1 A;  2Y65 A;  2ZFK A;  1MMD A;  2MYS A;  3B6V A;  1MMN A;  2Q2Z A;  2Y5W A;  1KK7 A;  3K3B A;  1VOM A;  2FKY A;  4ETP A;  2OWM A;  1V8K A;  2V26 A;  3H4S A;  4UBF A;  3COB A;  3ZFD A;  2XAE A;  1F9U A;  2VAS A;  1D0Z A;  3NWN A;  1VFW A;  1MMA A;  1D1C A;  2PG2 A;  4ANJ A;  4E7Z A;  2ZFL A;  3GBJ A;  5HLE A;  3ZFC A;  2X7E A;  4E7S A;  1T5C A;  4PJN A;  4Y05 A;  4PFO A;  5LT2 A;  1I6I A;  4A14 A;  1Q0B A;  2VVG A;  1MKJ A;  2X51 A;  1X88 A;  3KAR A;  1D0Y A;  1VFZ A;  1N6M A;  3PXN A;  4PFP A;  3X2T A;  3KIN A;  3L1C A;  2O0A A;  5LT0 A;  1V8J A;  3B6U A;  1LVK A;  3K5E A;  4HNA K;  1GOJ A;  2GRY A;  5LT3 A;  4ZHI A;  2Q2Y A;  1FMW A;  3HQD A;  3WPN A;  4A50 A;  1G8X A;  2UYI A;  4A5Y A;  2FME A;  3L9H A;  4BXN A;  3DCB A;  2UYM A; 
#chains in the Genus database with same CATH homology
 1FMV A;  1I5S A;  4AP0 A;  2XT3 A;  2ZFI A;  4AS7 A;  1RY6 A;  1BR4 A;  2KIN A;  3BFN A;  2X2R A;  2NCD A;  1D1B A;  4A1Z A;  1D0X A;  1SDM A;  1VFV A;  4A51 A;  1BR2 A;  2IEH A;  3KEN A;  3U06 A;  4PK4 A;  3CJO A;  2FL6 A;  4BN2 A;  3LRE A;  1CZ7 A;  4ZCA A;  4FRZ A;  5LT4 A;  1F9T A;  4BBG A;  2HEH A;  4DBQ A;  2X7C A;  4PJM A;  2ZFM A;  2ZFJ A;  3WRD A;  4B7B A;  4LNU K;  2GM1 A;  5GSZ A;  4PJL A;  2FL2 A;  3DC4 A;  4GKR A;  1F9V A;  1LKX A;  2X7D A;  4PJJ A;  3ZCW A;  1MNE A;  3CNZ A;  1MMG A;  2VB6 A;  1D1A A;  2G1Q A;  1VFX A;  1BG2 A;  2WOG A;  3T0Q A;  1YRS A;  4H1G A;  1II6 A;  4DBR A;  4A28 A;  1F9W A;  5LT1 A;  1BR1 A;  2Y65 A;  2ZFK A;  1MMD A;  2MYS A;  3B6V A;  1MMN A;  2Q2Z A;  2Y5W A;  1KK7 A;  3K3B A;  1VOM A;  2FKY A;  4ETP A;  2OWM A;  1V8K A;  2V26 A;  3H4S A;  4UBF A;  3COB A;  3ZFD A;  2XAE A;  1F9U A;  2VAS A;  1D0Z A;  3NWN A;  1VFW A;  1MMA A;  1D1C A;  2PG2 A;  4ANJ A;  4E7Z A;  2ZFL A;  3GBJ A;  5HLE A;  3ZFC A;  2X7E A;  4E7S A;  1T5C A;  4PJN A;  4Y05 A;  4PFO A;  5LT2 A;  1I6I A;  4A14 A;  1Q0B A;  2VVG A;  1MKJ A;  2X51 A;  1X88 A;  3KAR A;  1D0Y A;  1VFZ A;  1N6M A;  3PXN A;  4PFP A;  3X2T A;  3KIN A;  3L1C A;  5LT0 A;  1V8J A;  3B6U A;  1LVK A;  3K5E A;  4HNA K;  1GOJ A;  2GRY A;  5LT3 A;  4ZHI A;  2Q2Y A;  1FMW A;  3HQD A;  3WPN A;  4A50 A;  1G8X A;  2UYI A;  4A5Y A;  2FME A;  3L9H A;  4BXN A;  3DCB A;  2UYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...