4ETPA

C-terminal motor and motor homology domain of kar3vik1 fused to a synthetic heterodimeric coiled coil
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
393
structure length
379
Chain Sequence
IAALKEKIAALKEKIAALKEKIKDTELGMKELNEILIKEETVRRTLHNELQELRGNIRVYLRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVAIFAYGQTGSGKTFTMLNPGDGIIPSTISHIFNWINKLKTKGWDYKVNAEFIEIYNENIVDLLRSSIGLKHEIRHDQETKTTTITNVTSVKLESEEMVEIILKKANRTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSALGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KAR3
publication title Kar3Vik1, a member of the kinesin-14 superfamily, shows a novel kinesin microtubule binding pattern.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Motor protein
total genus 130
structure length 379
sequence length 393
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 4etpA00
1MMAA 2UYIA 2G1QA 1LVKA 1VFXA 3KENA 2VB6A 3KARA 5LT4A 2IEHA 4UBFA 2X7EA 3BFNA 1FMVA 1F9UA 2FL6A 3ZFCA 2PG2A 2ZFMA 1N6MA 1G8XA 1MNEA 4A14A 2GM1A 4A51A 5LT3A 3U06A 3NWNA 2VASA 2ZFIA 1D0YA 4E7SA 1VFWA 2FL2A 3L1CA 5GSZA 1II6A 4PJNA 1D0ZA 2VVGA 3K5EA 4GKRA 2X7DA 2ZFKA 1CZ7A 3LREA 1D0XA 4A28A 1VOMA 2X51A 4HNAK 1D1BA 1GOJA 3CNZA 2NCDA 5LT1A 2ZFJA 1YRSA 5LT0A 4AS7A 4BXNA 2FMEA 1MMGA 2Q2YA 4B7BA 2Y65A 2Y5WA 2WOGA 3H4SA 2Q2ZA 1T5CA 1X88A 4PJJA 4PFPA 4A5YA 2OWMA 1F9TA 1BR4A 3B6VA 4Y05A 3WPNA 4PJLA 4FRZA 1Q0BA 1V8KA 3ZCWA 1D1CA 5HLEA 3T0QA 1V8JA 3WRDA 1RY6A 1KK7A 2MYSA 4PFOA 4BBGA 4H1GA 2XT3A 1D1AA 3GBJA 4DBRA 1BR1A 3ZFDA 4BN2A 1F9VA 1F9WA 5LT2A 4AP0A 3DC4A 3L9HA 4LNUK 1LKXA 1VFZA 3PXNA 3X2TA 1FMWA 1SDMA 1BR2A 2XAEA 1MMNA 1MMDA 1MKJA 4PJMA 2GRYA 3KINA 4A1ZA 4ANJA 2X2RA 2V26A 4ZCAA 4ZHIA 3K3BA 3B6UA 3DCBA 1I6IA 4ETPA 2KINA 4E7ZA 2HEHA 3HQDA 4A50A 4DBQA 1BG2A 2X7CA 2ZFLA 2FKYA 2UYMA 1VFVA 3CJOA 4PK4A 1I5SA 3COBA
chains in the Genus database with same CATH superfamily
1MMAA 2UYIA 2G1QA 1LVKA 1VFXA 3KENA 2VB6A 3KARA 5LT4A 2IEHA 4UBFA 2X7EA 3BFNA 1FMVA 1F9UA 2FL6A 3ZFCA 2PG2A 2ZFMA 1N6MA 1G8XA 1MNEA 4A14A 2GM1A 4A51A 5LT3A 3U06A 3NWNA 2VASA 2ZFIA 1D0YA 4E7SA 1VFWA 2FL2A 3L1CA 5GSZA 1II6A 4PJNA 1D0ZA 2VVGA 3K5EA 4GKRA 2X7DA 2ZFKA 1CZ7A 3LREA 1D0XA 4A28A 1VOMA 2X51A 4HNAK 2O0AA 1D1BA 1GOJA 3CNZA 2NCDA 5LT1A 2ZFJA 1YRSA 5LT0A 4AS7A 4BXNA 2FMEA 1MMGA 2Q2YA 4GKQA 4B7BA 2Y65A 2Y5WA 2WOGA 3H4SA 2Q2ZA 1T5CA 1X88A 4PJJA 4PFPA 4A5YA 2OWMA 1F9TA 1BR4A 3B6VA 4Y05A 3WPNA 4ETPB 4PJLA 4FRZA 1Q0BA 1V8KA 3ZCWA 1D1CA 5HLEA 3T0QA 1V8JA 3WRDA 1RY6A 1KK7A 2MYSA 4PFOA 4BBGA 4H1GA 2XT3A 1D1AA 3GBJA 4DBRA 1BR1A 3ZFDA 4BN2A 1F9VA 1F9WA 5LT2A 4AP0A 3DC4A 3L9HA 4LNUK 4GKPA 1LKXA 1VFZA 3PXNA 3X2TA 1FMWA 1SDMA 1BR2A 2XAEA 1MMNA 1MMDA 1MKJA 4PJMA 2GRYA 3KINA 4A1ZA 4ANJA 2X2RA 2V26A 4ZCAA 4ZHIA 3K3BA 3B6UA 3DCBA 1I6IA 4ETPA 2KINA 4E7ZA 2HEHA 3HQDA 4A50A 4DBQA 1BG2A 2X7CA 2ZFLA 2FKYA 2UYMA 1VFVA 3CJOA 4PK4A 1I5SA 3COBA
chains in the Genus database with same CATH topology
1MMAA 2UYIA 2G1QA 1LVKA 1VFXA 3KENA 2VB6A 3KARA 5LT4A 2IEHA 4UBFA 2X7EA 3BFNA 1FMVA 1F9UA 2FL6A 3ZFCA 2PG2A 2ZFMA 1N6MA 1G8XA 1MNEA 4A14A 2GM1A 4A51A 5LT3A 3U06A 3NWNA 2VASA 2ZFIA 1D0YA 4E7SA 1VFWA 2FL2A 3L1CA 5GSZA 1II6A 4PJNA 1D0ZA 2VVGA 3K5EA 4GKRA 2X7DA 2ZFKA 1CZ7A 3LREA 1D0XA 4A28A 1VOMA 2X51A 4HNAK 1D1BA 1GOJA 3CNZA 2NCDA 5LT1A 2ZFJA 1YRSA 5LT0A 4AS7A 4BXNA 2FMEA 1MMGA 2Q2YA 4B7BA 2Y65A 2Y5WA 2WOGA 3H4SA 2Q2ZA 1T5CA 1X88A 4PJJA 4PFPA 4A5YA 2OWMA 1F9TA 1BR4A 3B6VA 4Y05A 3WPNA 4PJLA 4FRZA 1Q0BA 1V8KA 3ZCWA 1D1CA 5HLEA 3T0QA 1V8JA 3WRDA 1RY6A 1KK7A 2MYSA 4PFOA 4BBGA 4H1GA 2XT3A 1D1AA 3GBJA 4DBRA 1BR1A 3ZFDA 4BN2A 1F9VA 1F9WA 5LT2A 4AP0A 3DC4A 3L9HA 4LNUK 1LKXA 1VFZA 3PXNA 3X2TA 1FMWA 1SDMA 1BR2A 2XAEA 1MMNA 1MMDA 1MKJA 4PJMA 2GRYA 3KINA 4A1ZA 4ANJA 2X2RA 2V26A 4ZCAA 4ZHIA 3K3BA 3B6UA 3DCBA 1I6IA 4ETPA 2KINA 4E7ZA 2HEHA 3HQDA 4A50A 4DBQA 1BG2A 2X7CA 2ZFLA 2FKYA 2UYMA 1VFVA 3CJOA 4PK4A 1I5SA 3COBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MMA A;  2UYI A;  2G1Q A;  1LVK A;  1VFX A;  3KEN A;  2VB6 A;  3KAR A;  5LT4 A;  2IEH A;  4UBF A;  2X7E A;  3BFN A;  1FMV A;  1F9U A;  2FL6 A;  3ZFC A;  2PG2 A;  2ZFM A;  1N6M A;  1G8X A;  1MNE A;  4A14 A;  2GM1 A;  4A51 A;  5LT3 A;  3U06 A;  3NWN A;  2VAS A;  2ZFI A;  1D0Y A;  4E7S A;  1VFW A;  2FL2 A;  3L1C A;  5GSZ A;  1II6 A;  4PJN A;  1D0Z A;  2VVG A;  3K5E A;  4GKR A;  2X7D A;  2ZFK A;  1CZ7 A;  3LRE A;  1D0X A;  4A28 A;  1VOM A;  2X51 A;  4HNA K;  1D1B A;  1GOJ A;  3CNZ A;  2NCD A;  5LT1 A;  2ZFJ A;  1YRS A;  5LT0 A;  4AS7 A;  4BXN A;  2FME A;  1MMG A;  2Q2Y A;  4B7B A;  2Y65 A;  2Y5W A;  2WOG A;  3H4S A;  2Q2Z A;  1T5C A;  1X88 A;  4PJJ A;  4PFP A;  4A5Y A;  2OWM A;  1F9T A;  1BR4 A;  3B6V A;  4Y05 A;  3WPN A;  4PJL A;  4FRZ A;  1Q0B A;  1V8K A;  3ZCW A;  1D1C A;  5HLE A;  3T0Q A;  1V8J A;  3WRD A;  1RY6 A;  1KK7 A;  2MYS A;  4PFO A;  4BBG A;  4H1G A;  2XT3 A;  1D1A A;  3GBJ A;  4DBR A;  1BR1 A;  3ZFD A;  4BN2 A;  1F9V A;  1F9W A;  5LT2 A;  4AP0 A;  3DC4 A;  3L9H A;  4LNU K;  1LKX A;  1VFZ A;  3PXN A;  3X2T A;  1FMW A;  1SDM A;  1BR2 A;  2XAE A;  1MMN A;  1MMD A;  1MKJ A;  4PJM A;  2GRY A;  3KIN A;  4A1Z A;  4ANJ A;  2X2R A;  2V26 A;  4ZCA A;  4ZHI A;  3K3B A;  3B6U A;  3DCB A;  1I6I A;  4ETP A;  2KIN A;  4E7Z A;  2HEH A;  3HQD A;  4A50 A;  4DBQ A;  1BG2 A;  2X7C A;  2ZFL A;  2FKY A;  2UYM A;  1VFV A;  3CJO A;  4PK4 A;  1I5S A;  3COB A; 
#chains in the Genus database with same CATH topology
 1MMA A;  2UYI A;  2G1Q A;  1LVK A;  1VFX A;  3KEN A;  2VB6 A;  3KAR A;  5LT4 A;  2IEH A;  4UBF A;  2X7E A;  3BFN A;  1FMV A;  1F9U A;  2FL6 A;  3ZFC A;  2PG2 A;  2ZFM A;  1N6M A;  1G8X A;  1MNE A;  4A14 A;  2GM1 A;  4A51 A;  5LT3 A;  3U06 A;  3NWN A;  2VAS A;  2ZFI A;  1D0Y A;  4E7S A;  1VFW A;  2FL2 A;  3L1C A;  5GSZ A;  1II6 A;  4PJN A;  1D0Z A;  2VVG A;  3K5E A;  4GKR A;  2X7D A;  2ZFK A;  1CZ7 A;  3LRE A;  1D0X A;  4A28 A;  1VOM A;  2X51 A;  4HNA K;  2O0A A;  1D1B A;  1GOJ A;  3CNZ A;  2NCD A;  5LT1 A;  2ZFJ A;  1YRS A;  5LT0 A;  4AS7 A;  4BXN A;  2FME A;  1MMG A;  2Q2Y A;  4GKQ A;  4B7B A;  2Y65 A;  2Y5W A;  2WOG A;  3H4S A;  2Q2Z A;  1T5C A;  1X88 A;  4PJJ A;  4PFP A;  4A5Y A;  2OWM A;  1F9T A;  1BR4 A;  3B6V A;  4Y05 A;  3WPN A;  4ETP B;  4PJL A;  4FRZ A;  1Q0B A;  1V8K A;  3ZCW A;  1D1C A;  5HLE A;  3T0Q A;  1V8J A;  3WRD A;  1RY6 A;  1KK7 A;  2MYS A;  4PFO A;  4BBG A;  4H1G A;  2XT3 A;  1D1A A;  3GBJ A;  4DBR A;  1BR1 A;  3ZFD A;  4BN2 A;  1F9V A;  1F9W A;  5LT2 A;  4AP0 A;  3DC4 A;  3L9H A;  4LNU K;  4GKP A;  1LKX A;  1VFZ A;  3PXN A;  3X2T A;  1FMW A;  1SDM A;  1BR2 A;  2XAE A;  1MMN A;  1MMD A;  1MKJ A;  4PJM A;  2GRY A;  3KIN A;  4A1Z A;  4ANJ A;  2X2R A;  2V26 A;  4ZCA A;  4ZHI A;  3K3B A;  3B6U A;  3DCB A;  1I6I A;  4ETP A;  2KIN A;  4E7Z A;  2HEH A;  3HQD A;  4A50 A;  4DBQ A;  1BG2 A;  2X7C A;  2ZFL A;  2FKY A;  2UYM A;  1VFV A;  3CJO A;  4PK4 A;  1I5S A;  3COB A; 
#chains in the Genus database with same CATH homology
 1MMA A;  2UYI A;  2G1Q A;  1LVK A;  1VFX A;  3KEN A;  2VB6 A;  3KAR A;  5LT4 A;  2IEH A;  4UBF A;  2X7E A;  3BFN A;  1FMV A;  1F9U A;  2FL6 A;  3ZFC A;  2PG2 A;  2ZFM A;  1N6M A;  1G8X A;  1MNE A;  4A14 A;  2GM1 A;  4A51 A;  5LT3 A;  3U06 A;  3NWN A;  2VAS A;  2ZFI A;  1D0Y A;  4E7S A;  1VFW A;  2FL2 A;  3L1C A;  5GSZ A;  1II6 A;  4PJN A;  1D0Z A;  2VVG A;  3K5E A;  4GKR A;  2X7D A;  2ZFK A;  1CZ7 A;  3LRE A;  1D0X A;  4A28 A;  1VOM A;  2X51 A;  4HNA K;  1D1B A;  1GOJ A;  3CNZ A;  2NCD A;  5LT1 A;  2ZFJ A;  1YRS A;  5LT0 A;  4AS7 A;  4BXN A;  2FME A;  1MMG A;  2Q2Y A;  4B7B A;  2Y65 A;  2Y5W A;  2WOG A;  3H4S A;  2Q2Z A;  1T5C A;  1X88 A;  4PJJ A;  4PFP A;  4A5Y A;  2OWM A;  1F9T A;  1BR4 A;  3B6V A;  4Y05 A;  3WPN A;  4PJL A;  4FRZ A;  1Q0B A;  1V8K A;  3ZCW A;  1D1C A;  5HLE A;  3T0Q A;  1V8J A;  3WRD A;  1RY6 A;  1KK7 A;  2MYS A;  4PFO A;  4BBG A;  4H1G A;  2XT3 A;  1D1A A;  3GBJ A;  4DBR A;  1BR1 A;  3ZFD A;  4BN2 A;  1F9V A;  1F9W A;  5LT2 A;  4AP0 A;  3DC4 A;  3L9H A;  4LNU K;  1LKX A;  1VFZ A;  3PXN A;  3X2T A;  1FMW A;  1SDM A;  1BR2 A;  2XAE A;  1MMN A;  1MMD A;  1MKJ A;  4PJM A;  2GRY A;  3KIN A;  4A1Z A;  4ANJ A;  2X2R A;  2V26 A;  4ZCA A;  4ZHI A;  3K3B A;  3B6U A;  3DCB A;  1I6I A;  4ETP A;  2KIN A;  4E7Z A;  2HEH A;  3HQD A;  4A50 A;  4DBQ A;  1BG2 A;  2X7C A;  2ZFL A;  2FKY A;  2UYM A;  1VFV A;  3CJO A;  4PK4 A;  1I5S A;  3COB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...