4ETPA

C-terminal motor and motor homology domain of kar3vik1 fused to a synthetic heterodimeric coiled coil
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
393
structure length
379
Chain Sequence
b'IAALKEKIAALKEKIAALKEKIKDTELGMKELNEILIKEETVRRTLHNELQELRGNIRVYLRIRPALKNLENSDTSLINVNEFDDNSGVQSMEVTKIQNTAQVHEFKFDKIFDQQDTNVDVFKEVGQLVQSSLDGYNVAIFAYGQTGSGKTFTMLNPGDGIIPSTISHIFNWINKLKTKGWDYKVNAEFIEIYNENIVDLLRSSIGLKHEIRHDQETKTTTITNVTSVKLESEEMVEIILKKANRTASNEHSSRSHSIFIIHLSGSNAKTGAHSYGTLNLVDLAGSERINVSQVVGDRLRETQNINKSLSALGDVIHALGQPDSTKRHIPFRNSKLTYLLQYSLTGDSKTLMFVNISPSSSHINETLNSLRFASKVNST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KAR3
publication title Kar3Vik1, a member of the kinesin-14 superfamily, shows a novel kinesin microtubule binding pattern.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Motor protein
total genus 130
structure length 379
sequence length 393
ec nomenclature
pdb deposition date 2012-04-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 4etpA00
2ZFKA 3T0QA 4B7BA 1MNEA 4ANJA 5LT2A 1MKJA 2X51A 3U06A 1VFVA 1RY6A 2ZFIA 3HQDA 1MMDA 3ZCWA 4A51A 4A28A 1GOJA 2XAEA 1G8XA 2X7EA 2OWMA 2Q2YA 2V26A 2IEHA 1MMAA 2VASA 3X2TA 4PJNA 3KARA 3LREA 3K5EA 1D1CA 4PJJA 4AS7A 2ZFMA 2ZFLA 3KENA 3PXNA 3CNZA 3H4SA 1D0XA 2GM1A 1D1BA 1MMGA 1VFZA 1LKXA 1I6IA 4LNUK 3BFNA 4H1GA 4UBFA 1D0ZA 1F9VA 2G1QA 4FRZA 1D1AA 5LT1A 3DCBA 4HNAK 3CJOA 4E7SA 2MYSA 1T5CA 1Q0BA 2Q2ZA 2VVGA 2UYMA 2GRYA 3DC4A 2UYIA 4ETPA 3ZFCA 5HLEA 4A14A 5LT4A 2WOGA 1FMVA 4BN2A 4A50A 2FMEA 4ZHIA 4A1ZA 2KINA 1X88A 5LT0A 2XT3A 4ZCAA 5LT3A 2Y65A 2VB6A 2HEHA 2X2RA 1I5SA 4BXNA 2ZFJA 3NWNA 1VFWA 2FKYA 1F9WA 1BR2A 1D0YA 1V8JA 3COBA 3ZFDA 5GSZA 1F9UA 1KK7A 4PJMA 4E7ZA 1N6MA 2PG2A 3B6UA 4PJLA 3K3BA 3L1CA 3GBJA 1SDMA 4BBGA 1FMWA 1BR1A 1VFXA 2X7CA 3WRDA 4PK4A 4AP0A 2FL2A 1YRSA 1F9TA 1II6A 1VOMA 1LVKA 1BR4A 1V8KA 3L9HA 1CZ7A 2NCDA 3B6VA 4PFPA 3WPNA 1BG2A 4A5YA 4PFOA 2FL6A 4Y05A 4DBRA 1MMNA 2Y5WA 2X7DA 4GKRA 4DBQA 3KINA
chains in the Genus database with same CATH superfamily
2ZFKA 3T0QA 4B7BA 1MNEA 4ANJA 5LT2A 1MKJA 2X51A 3U06A 1VFVA 4ETPB 1RY6A 2ZFIA 3HQDA 1MMDA 3ZCWA 4A51A 4A28A 4GKQA 1GOJA 2XAEA 1G8XA 2X7EA 2OWMA 2Q2YA 2V26A 2IEHA 1MMAA 4GKPA 2VASA 3X2TA 4PJNA 3KARA 3LREA 3K5EA 1D1CA 4PJJA 4AS7A 2ZFMA 2ZFLA 3KENA 3PXNA 3CNZA 3H4SA 2O0AA 1D0XA 2GM1A 1D1BA 1MMGA 1VFZA 1LKXA 1I6IA 4LNUK 3BFNA 4H1GA 4UBFA 1D0ZA 1F9VA 2G1QA 4FRZA 1D1AA 5LT1A 3DCBA 4HNAK 3CJOA 4E7SA 2MYSA 1T5CA 1Q0BA 2Q2ZA 2VVGA 2UYMA 2GRYA 3DC4A 2UYIA 4ETPA 3ZFCA 5HLEA 4A14A 5LT4A 2WOGA 1FMVA 4BN2A 4A50A 2FMEA 4ZHIA 4A1ZA 2KINA 1X88A 5LT0A 2XT3A 4ZCAA 5LT3A 2Y65A 2VB6A 2HEHA 2X2RA 1I5SA 4BXNA 2ZFJA 3NWNA 1VFWA 2FKYA 1F9WA 1BR2A 1D0YA 1V8JA 3COBA 3ZFDA 5GSZA 1F9UA 1KK7A 4PJMA 4E7ZA 1N6MA 2PG2A 3B6UA 4PJLA 3K3BA 3L1CA 3GBJA 1SDMA 4BBGA 1FMWA 1BR1A 1VFXA 2X7CA 3WRDA 4PK4A 4AP0A 2FL2A 1YRSA 1F9TA 1II6A 1VOMA 1LVKA 1BR4A 1V8KA 3L9HA 1CZ7A 2NCDA 3B6VA 4PFPA 3WPNA 1BG2A 4A5YA 4PFOA 2FL6A 4Y05A 4DBRA 1MMNA 2Y5WA 2X7DA 4GKRA 4DBQA 3KINA
chains in the Genus database with same CATH topology
2ZFKA 3T0QA 4B7BA 1MNEA 4ANJA 5LT2A 1MKJA 2X51A 3U06A 1VFVA 1RY6A 2ZFIA 3HQDA 1MMDA 3ZCWA 4A51A 4A28A 1GOJA 2XAEA 1G8XA 2X7EA 2OWMA 2Q2YA 2V26A 2IEHA 1MMAA 2VASA 3X2TA 4PJNA 3KARA 3LREA 3K5EA 1D1CA 4PJJA 4AS7A 2ZFMA 2ZFLA 3KENA 3PXNA 3CNZA 3H4SA 1D0XA 2GM1A 1D1BA 1MMGA 1VFZA 1LKXA 1I6IA 4LNUK 3BFNA 4H1GA 4UBFA 1D0ZA 1F9VA 2G1QA 4FRZA 1D1AA 5LT1A 3DCBA 4HNAK 3CJOA 4E7SA 2MYSA 1T5CA 1Q0BA 2Q2ZA 2VVGA 2UYMA 2GRYA 3DC4A 2UYIA 4ETPA 3ZFCA 5HLEA 4A14A 5LT4A 2WOGA 1FMVA 4BN2A 4A50A 2FMEA 4ZHIA 4A1ZA 2KINA 1X88A 5LT0A 2XT3A 4ZCAA 5LT3A 2Y65A 2VB6A 2HEHA 2X2RA 1I5SA 4BXNA 2ZFJA 3NWNA 1VFWA 2FKYA 1F9WA 1BR2A 1D0YA 1V8JA 3COBA 3ZFDA 5GSZA 1F9UA 1KK7A 4PJMA 4E7ZA 1N6MA 2PG2A 3B6UA 4PJLA 3K3BA 3L1CA 3GBJA 1SDMA 4BBGA 1FMWA 1BR1A 1VFXA 2X7CA 3WRDA 4PK4A 4AP0A 2FL2A 1YRSA 1F9TA 1II6A 1VOMA 1LVKA 1BR4A 1V8KA 3L9HA 1CZ7A 2NCDA 3B6VA 4PFPA 3WPNA 1BG2A 4A5YA 4PFOA 2FL6A 4Y05A 4DBRA 1MMNA 2Y5WA 2X7DA 4GKRA 4DBQA 3KINA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFK A;  3T0Q A;  4B7B A;  1MNE A;  4ANJ A;  5LT2 A;  1MKJ A;  2X51 A;  3U06 A;  1VFV A;  1RY6 A;  2ZFI A;  3HQD A;  1MMD A;  3ZCW A;  4A51 A;  4A28 A;  1GOJ A;  2XAE A;  1G8X A;  2X7E A;  2OWM A;  2Q2Y A;  2V26 A;  2IEH A;  1MMA A;  2VAS A;  3X2T A;  4PJN A;  3KAR A;  3LRE A;  3K5E A;  1D1C A;  4PJJ A;  4AS7 A;  2ZFM A;  2ZFL A;  3KEN A;  3PXN A;  3CNZ A;  3H4S A;  1D0X A;  2GM1 A;  1D1B A;  1MMG A;  1VFZ A;  1LKX A;  1I6I A;  4LNU K;  3BFN A;  4H1G A;  4UBF A;  1D0Z A;  1F9V A;  2G1Q A;  4FRZ A;  1D1A A;  5LT1 A;  3DCB A;  4HNA K;  3CJO A;  4E7S A;  2MYS A;  1T5C A;  1Q0B A;  2Q2Z A;  2VVG A;  2UYM A;  2GRY A;  3DC4 A;  2UYI A;  4ETP A;  3ZFC A;  5HLE A;  4A14 A;  5LT4 A;  2WOG A;  1FMV A;  4BN2 A;  4A50 A;  2FME A;  4ZHI A;  4A1Z A;  2KIN A;  1X88 A;  5LT0 A;  2XT3 A;  4ZCA A;  5LT3 A;  2Y65 A;  2VB6 A;  2HEH A;  2X2R A;  1I5S A;  4BXN A;  2ZFJ A;  3NWN A;  1VFW A;  2FKY A;  1F9W A;  1BR2 A;  1D0Y A;  1V8J A;  3COB A;  3ZFD A;  5GSZ A;  1F9U A;  1KK7 A;  4PJM A;  4E7Z A;  1N6M A;  2PG2 A;  3B6U A;  4PJL A;  3K3B A;  3L1C A;  3GBJ A;  1SDM A;  4BBG A;  1FMW A;  1BR1 A;  1VFX A;  2X7C A;  3WRD A;  4PK4 A;  4AP0 A;  2FL2 A;  1YRS A;  1F9T A;  1II6 A;  1VOM A;  1LVK A;  1BR4 A;  1V8K A;  3L9H A;  1CZ7 A;  2NCD A;  3B6V A;  4PFP A;  3WPN A;  1BG2 A;  4A5Y A;  4PFO A;  2FL6 A;  4Y05 A;  4DBR A;  1MMN A;  2Y5W A;  2X7D A;  4GKR A;  4DBQ A;  3KIN A; 
#chains in the Genus database with same CATH topology
 2ZFK A;  3T0Q A;  4B7B A;  1MNE A;  4ANJ A;  5LT2 A;  1MKJ A;  2X51 A;  3U06 A;  1VFV A;  4ETP B;  1RY6 A;  2ZFI A;  3HQD A;  1MMD A;  3ZCW A;  4A51 A;  4A28 A;  4GKQ A;  1GOJ A;  2XAE A;  1G8X A;  2X7E A;  2OWM A;  2Q2Y A;  2V26 A;  2IEH A;  1MMA A;  4GKP A;  2VAS A;  3X2T A;  4PJN A;  3KAR A;  3LRE A;  3K5E A;  1D1C A;  4PJJ A;  4AS7 A;  2ZFM A;  2ZFL A;  3KEN A;  3PXN A;  3CNZ A;  3H4S A;  2O0A A;  1D0X A;  2GM1 A;  1D1B A;  1MMG A;  1VFZ A;  1LKX A;  1I6I A;  4LNU K;  3BFN A;  4H1G A;  4UBF A;  1D0Z A;  1F9V A;  2G1Q A;  4FRZ A;  1D1A A;  5LT1 A;  3DCB A;  4HNA K;  3CJO A;  4E7S A;  2MYS A;  1T5C A;  1Q0B A;  2Q2Z A;  2VVG A;  2UYM A;  2GRY A;  3DC4 A;  2UYI A;  4ETP A;  3ZFC A;  5HLE A;  4A14 A;  5LT4 A;  2WOG A;  1FMV A;  4BN2 A;  4A50 A;  2FME A;  4ZHI A;  4A1Z A;  2KIN A;  1X88 A;  5LT0 A;  2XT3 A;  4ZCA A;  5LT3 A;  2Y65 A;  2VB6 A;  2HEH A;  2X2R A;  1I5S A;  4BXN A;  2ZFJ A;  3NWN A;  1VFW A;  2FKY A;  1F9W A;  1BR2 A;  1D0Y A;  1V8J A;  3COB A;  3ZFD A;  5GSZ A;  1F9U A;  1KK7 A;  4PJM A;  4E7Z A;  1N6M A;  2PG2 A;  3B6U A;  4PJL A;  3K3B A;  3L1C A;  3GBJ A;  1SDM A;  4BBG A;  1FMW A;  1BR1 A;  1VFX A;  2X7C A;  3WRD A;  4PK4 A;  4AP0 A;  2FL2 A;  1YRS A;  1F9T A;  1II6 A;  1VOM A;  1LVK A;  1BR4 A;  1V8K A;  3L9H A;  1CZ7 A;  2NCD A;  3B6V A;  4PFP A;  3WPN A;  1BG2 A;  4A5Y A;  4PFO A;  2FL6 A;  4Y05 A;  4DBR A;  1MMN A;  2Y5W A;  2X7D A;  4GKR A;  4DBQ A;  3KIN A; 
#chains in the Genus database with same CATH homology
 2ZFK A;  3T0Q A;  4B7B A;  1MNE A;  4ANJ A;  5LT2 A;  1MKJ A;  2X51 A;  3U06 A;  1VFV A;  1RY6 A;  2ZFI A;  3HQD A;  1MMD A;  3ZCW A;  4A51 A;  4A28 A;  1GOJ A;  2XAE A;  1G8X A;  2X7E A;  2OWM A;  2Q2Y A;  2V26 A;  2IEH A;  1MMA A;  2VAS A;  3X2T A;  4PJN A;  3KAR A;  3LRE A;  3K5E A;  1D1C A;  4PJJ A;  4AS7 A;  2ZFM A;  2ZFL A;  3KEN A;  3PXN A;  3CNZ A;  3H4S A;  1D0X A;  2GM1 A;  1D1B A;  1MMG A;  1VFZ A;  1LKX A;  1I6I A;  4LNU K;  3BFN A;  4H1G A;  4UBF A;  1D0Z A;  1F9V A;  2G1Q A;  4FRZ A;  1D1A A;  5LT1 A;  3DCB A;  4HNA K;  3CJO A;  4E7S A;  2MYS A;  1T5C A;  1Q0B A;  2Q2Z A;  2VVG A;  2UYM A;  2GRY A;  3DC4 A;  2UYI A;  4ETP A;  3ZFC A;  5HLE A;  4A14 A;  5LT4 A;  2WOG A;  1FMV A;  4BN2 A;  4A50 A;  2FME A;  4ZHI A;  4A1Z A;  2KIN A;  1X88 A;  5LT0 A;  2XT3 A;  4ZCA A;  5LT3 A;  2Y65 A;  2VB6 A;  2HEH A;  2X2R A;  1I5S A;  4BXN A;  2ZFJ A;  3NWN A;  1VFW A;  2FKY A;  1F9W A;  1BR2 A;  1D0Y A;  1V8J A;  3COB A;  3ZFD A;  5GSZ A;  1F9U A;  1KK7 A;  4PJM A;  4E7Z A;  1N6M A;  2PG2 A;  3B6U A;  4PJL A;  3K3B A;  3L1C A;  3GBJ A;  1SDM A;  4BBG A;  1FMW A;  1BR1 A;  1VFX A;  2X7C A;  3WRD A;  4PK4 A;  4AP0 A;  2FL2 A;  1YRS A;  1F9T A;  1II6 A;  1VOM A;  1LVK A;  1BR4 A;  1V8K A;  3L9H A;  1CZ7 A;  2NCD A;  3B6V A;  4PFP A;  3WPN A;  1BG2 A;  4A5Y A;  4PFO A;  2FL6 A;  4Y05 A;  4DBR A;  1MMN A;  2Y5W A;  2X7D A;  4GKR A;  4DBQ A;  3KIN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...