3DCBA

Crystal structure of the drosophila kinesin family member nod in complex with amppnp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
317
structure length
299
Chain Sequence
b'KLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADLHHILELGTRNRRVSSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVRRTVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein Nod
publication title ATPase cycle of the nonmotile kinesin NOD allows microtubule end tracking and drives chromosome movement.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Motor protein
total genus 85
structure length 299
sequence length 317
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3dcbA00
2XT3A 2G1QA 2XAEA 1CZ7A 2V26A 2X2RA 4FRZA 1MMDA 4A50A 3COBA 1BG2A 1D1CA 4ANJA 3DC4A 4AS7A 2WOGA 4BBGA 2ZFLA 1BR4A 1VFVA 2PG2A 4PK4A 5LT4A 3CJOA 2X7CA 5HLEA 4HNAK 1D1BA 3LREA 1VFWA 3KENA 1KK7A 1MKJA 4ZHIA 4DBQA 2KINA 3B6VA 4E7SA 2VASA 4PFOA 1YRSA 2X51A 4A28A 3KINA 1F9TA 1D0YA 5LT0A 4E7ZA 3K3BA 4GKRA 4A14A 5GSZA 4BN2A 4A1ZA 2IEHA 1RY6A 3T0QA 1Q0BA 1LKXA 1F9UA 3K5EA 3NWNA 1BR2A 3B6UA 1MMNA 1N6MA 4ETPA 1LVKA 1VOMA 3ZFDA 5LT1A 3DCBA 3ZFCA 5LT2A 1F9VA 3PXNA 2GRYA 4PJMA 3WPNA 3U06A 1VFZA 1VFXA 2NCDA 5LT3A 4A51A 4A5YA 4PFPA 4LNUK 2MYSA 3X2TA 3H4SA 2GM1A 4ZCAA 1F9WA 2UYIA 2X7EA 2HEHA 3CNZA 4BXNA 3GBJA 1SDMA 1G8XA 2ZFJA 2X7DA 4UBFA 2FL6A 2OWMA 4PJLA 1MMAA 2VVGA 4H1GA 1II6A 2Q2ZA 2FKYA 1I6IA 1T5CA 2ZFMA 3L9HA 3WRDA 3KARA 2ZFIA 1BR1A 1GOJA 1D0XA 2Q2YA 4DBRA 1D0ZA 4AP0A 2ZFKA 2FMEA 3HQDA 3L1CA 1FMWA 2UYMA 2FL2A 2Y65A 1V8KA 2Y5WA 4PJJA 4Y05A 2VB6A 3BFNA 3ZCWA 1V8JA 1I5SA 1X88A 1FMVA 4B7BA 1MNEA 1D1AA 4PJNA 1MMGA
chains in the Genus database with same CATH superfamily
2XT3A 2G1QA 2XAEA 1CZ7A 2V26A 2X2RA 4FRZA 1MMDA 4A50A 4ETPB 3COBA 1BG2A 1D1CA 4ANJA 3DC4A 4AS7A 2WOGA 4BBGA 2ZFLA 1BR4A 1VFVA 2PG2A 4PK4A 5LT4A 3CJOA 2O0AA 2X7CA 5HLEA 4HNAK 1D1BA 3LREA 1VFWA 3KENA 1KK7A 1MKJA 4ZHIA 4DBQA 2KINA 3B6VA 4E7SA 2VASA 4PFOA 1YRSA 2X51A 4A28A 3KINA 1F9TA 1D0YA 5LT0A 4E7ZA 3K3BA 4GKRA 4A14A 5GSZA 4BN2A 4A1ZA 2IEHA 1RY6A 3T0QA 1Q0BA 1LKXA 1F9UA 3K5EA 3NWNA 1BR2A 3B6UA 1MMNA 1N6MA 4ETPA 1LVKA 1VOMA 3ZFDA 5LT1A 3DCBA 3ZFCA 5LT2A 1F9VA 3PXNA 2GRYA 4PJMA 3WPNA 3U06A 1VFZA 1VFXA 2NCDA 5LT3A 4A51A 4A5YA 4GKPA 4PFPA 4LNUK 2MYSA 3X2TA 3H4SA 2GM1A 4ZCAA 1F9WA 2UYIA 2X7EA 2HEHA 3CNZA 4BXNA 3GBJA 1SDMA 1G8XA 2ZFJA 2X7DA 4UBFA 2FL6A 2OWMA 4PJLA 1MMAA 2VVGA 4H1GA 1II6A 2Q2ZA 2FKYA 1I6IA 1T5CA 2ZFMA 3L9HA 3WRDA 3KARA 2ZFIA 1BR1A 1GOJA 1D0XA 4GKQA 2Q2YA 4DBRA 1D0ZA 4AP0A 2ZFKA 2FMEA 3HQDA 3L1CA 1FMWA 2UYMA 2FL2A 2Y65A 1V8KA 2Y5WA 4PJJA 4Y05A 2VB6A 3BFNA 3ZCWA 1V8JA 1I5SA 1X88A 1FMVA 4B7BA 1MNEA 1D1AA 4PJNA 1MMGA
chains in the Genus database with same CATH topology
2XT3A 2G1QA 2XAEA 1CZ7A 2V26A 2X2RA 4FRZA 1MMDA 4A50A 3COBA 1BG2A 1D1CA 4ANJA 3DC4A 4AS7A 2WOGA 4BBGA 2ZFLA 1BR4A 1VFVA 2PG2A 4PK4A 5LT4A 3CJOA 2X7CA 5HLEA 4HNAK 1D1BA 3LREA 1VFWA 3KENA 1KK7A 1MKJA 4ZHIA 4DBQA 2KINA 3B6VA 4E7SA 2VASA 4PFOA 1YRSA 2X51A 4A28A 3KINA 1F9TA 1D0YA 5LT0A 4E7ZA 3K3BA 4GKRA 4A14A 5GSZA 4BN2A 4A1ZA 2IEHA 1RY6A 3T0QA 1Q0BA 1LKXA 1F9UA 3K5EA 3NWNA 1BR2A 3B6UA 1MMNA 1N6MA 4ETPA 1LVKA 1VOMA 3ZFDA 5LT1A 3DCBA 3ZFCA 5LT2A 1F9VA 3PXNA 2GRYA 4PJMA 3WPNA 3U06A 1VFZA 1VFXA 2NCDA 5LT3A 4A51A 4A5YA 4PFPA 4LNUK 2MYSA 3X2TA 3H4SA 2GM1A 4ZCAA 1F9WA 2UYIA 2X7EA 2HEHA 3CNZA 4BXNA 3GBJA 1SDMA 1G8XA 2ZFJA 2X7DA 4UBFA 2FL6A 2OWMA 4PJLA 1MMAA 2VVGA 4H1GA 1II6A 2Q2ZA 2FKYA 1I6IA 1T5CA 2ZFMA 3L9HA 3WRDA 3KARA 2ZFIA 1BR1A 1GOJA 1D0XA 2Q2YA 4DBRA 1D0ZA 4AP0A 2ZFKA 2FMEA 3HQDA 3L1CA 1FMWA 2UYMA 2FL2A 2Y65A 1V8KA 2Y5WA 4PJJA 4Y05A 2VB6A 3BFNA 3ZCWA 1V8JA 1I5SA 1X88A 1FMVA 4B7BA 1MNEA 1D1AA 4PJNA 1MMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT3 A;  2G1Q A;  2XAE A;  1CZ7 A;  2V26 A;  2X2R A;  4FRZ A;  1MMD A;  4A50 A;  3COB A;  1BG2 A;  1D1C A;  4ANJ A;  3DC4 A;  4AS7 A;  2WOG A;  4BBG A;  2ZFL A;  1BR4 A;  1VFV A;  2PG2 A;  4PK4 A;  5LT4 A;  3CJO A;  2X7C A;  5HLE A;  4HNA K;  1D1B A;  3LRE A;  1VFW A;  3KEN A;  1KK7 A;  1MKJ A;  4ZHI A;  4DBQ A;  2KIN A;  3B6V A;  4E7S A;  2VAS A;  4PFO A;  1YRS A;  2X51 A;  4A28 A;  3KIN A;  1F9T A;  1D0Y A;  5LT0 A;  4E7Z A;  3K3B A;  4GKR A;  4A14 A;  5GSZ A;  4BN2 A;  4A1Z A;  2IEH A;  1RY6 A;  3T0Q A;  1Q0B A;  1LKX A;  1F9U A;  3K5E A;  3NWN A;  1BR2 A;  3B6U A;  1MMN A;  1N6M A;  4ETP A;  1LVK A;  1VOM A;  3ZFD A;  5LT1 A;  3DCB A;  3ZFC A;  5LT2 A;  1F9V A;  3PXN A;  2GRY A;  4PJM A;  3WPN A;  3U06 A;  1VFZ A;  1VFX A;  2NCD A;  5LT3 A;  4A51 A;  4A5Y A;  4PFP A;  4LNU K;  2MYS A;  3X2T A;  3H4S A;  2GM1 A;  4ZCA A;  1F9W A;  2UYI A;  2X7E A;  2HEH A;  3CNZ A;  4BXN A;  3GBJ A;  1SDM A;  1G8X A;  2ZFJ A;  2X7D A;  4UBF A;  2FL6 A;  2OWM A;  4PJL A;  1MMA A;  2VVG A;  4H1G A;  1II6 A;  2Q2Z A;  2FKY A;  1I6I A;  1T5C A;  2ZFM A;  3L9H A;  3WRD A;  3KAR A;  2ZFI A;  1BR1 A;  1GOJ A;  1D0X A;  2Q2Y A;  4DBR A;  1D0Z A;  4AP0 A;  2ZFK A;  2FME A;  3HQD A;  3L1C A;  1FMW A;  2UYM A;  2FL2 A;  2Y65 A;  1V8K A;  2Y5W A;  4PJJ A;  4Y05 A;  2VB6 A;  3BFN A;  3ZCW A;  1V8J A;  1I5S A;  1X88 A;  1FMV A;  4B7B A;  1MNE A;  1D1A A;  4PJN A;  1MMG A; 
#chains in the Genus database with same CATH topology
 2XT3 A;  2G1Q A;  2XAE A;  1CZ7 A;  2V26 A;  2X2R A;  4FRZ A;  1MMD A;  4A50 A;  4ETP B;  3COB A;  1BG2 A;  1D1C A;  4ANJ A;  3DC4 A;  4AS7 A;  2WOG A;  4BBG A;  2ZFL A;  1BR4 A;  1VFV A;  2PG2 A;  4PK4 A;  5LT4 A;  3CJO A;  2O0A A;  2X7C A;  5HLE A;  4HNA K;  1D1B A;  3LRE A;  1VFW A;  3KEN A;  1KK7 A;  1MKJ A;  4ZHI A;  4DBQ A;  2KIN A;  3B6V A;  4E7S A;  2VAS A;  4PFO A;  1YRS A;  2X51 A;  4A28 A;  3KIN A;  1F9T A;  1D0Y A;  5LT0 A;  4E7Z A;  3K3B A;  4GKR A;  4A14 A;  5GSZ A;  4BN2 A;  4A1Z A;  2IEH A;  1RY6 A;  3T0Q A;  1Q0B A;  1LKX A;  1F9U A;  3K5E A;  3NWN A;  1BR2 A;  3B6U A;  1MMN A;  1N6M A;  4ETP A;  1LVK A;  1VOM A;  3ZFD A;  5LT1 A;  3DCB A;  3ZFC A;  5LT2 A;  1F9V A;  3PXN A;  2GRY A;  4PJM A;  3WPN A;  3U06 A;  1VFZ A;  1VFX A;  2NCD A;  5LT3 A;  4A51 A;  4A5Y A;  4GKP A;  4PFP A;  4LNU K;  2MYS A;  3X2T A;  3H4S A;  2GM1 A;  4ZCA A;  1F9W A;  2UYI A;  2X7E A;  2HEH A;  3CNZ A;  4BXN A;  3GBJ A;  1SDM A;  1G8X A;  2ZFJ A;  2X7D A;  4UBF A;  2FL6 A;  2OWM A;  4PJL A;  1MMA A;  2VVG A;  4H1G A;  1II6 A;  2Q2Z A;  2FKY A;  1I6I A;  1T5C A;  2ZFM A;  3L9H A;  3WRD A;  3KAR A;  2ZFI A;  1BR1 A;  1GOJ A;  1D0X A;  4GKQ A;  2Q2Y A;  4DBR A;  1D0Z A;  4AP0 A;  2ZFK A;  2FME A;  3HQD A;  3L1C A;  1FMW A;  2UYM A;  2FL2 A;  2Y65 A;  1V8K A;  2Y5W A;  4PJJ A;  4Y05 A;  2VB6 A;  3BFN A;  3ZCW A;  1V8J A;  1I5S A;  1X88 A;  1FMV A;  4B7B A;  1MNE A;  1D1A A;  4PJN A;  1MMG A; 
#chains in the Genus database with same CATH homology
 2XT3 A;  2G1Q A;  2XAE A;  1CZ7 A;  2V26 A;  2X2R A;  4FRZ A;  1MMD A;  4A50 A;  3COB A;  1BG2 A;  1D1C A;  4ANJ A;  3DC4 A;  4AS7 A;  2WOG A;  4BBG A;  2ZFL A;  1BR4 A;  1VFV A;  2PG2 A;  4PK4 A;  5LT4 A;  3CJO A;  2X7C A;  5HLE A;  4HNA K;  1D1B A;  3LRE A;  1VFW A;  3KEN A;  1KK7 A;  1MKJ A;  4ZHI A;  4DBQ A;  2KIN A;  3B6V A;  4E7S A;  2VAS A;  4PFO A;  1YRS A;  2X51 A;  4A28 A;  3KIN A;  1F9T A;  1D0Y A;  5LT0 A;  4E7Z A;  3K3B A;  4GKR A;  4A14 A;  5GSZ A;  4BN2 A;  4A1Z A;  2IEH A;  1RY6 A;  3T0Q A;  1Q0B A;  1LKX A;  1F9U A;  3K5E A;  3NWN A;  1BR2 A;  3B6U A;  1MMN A;  1N6M A;  4ETP A;  1LVK A;  1VOM A;  3ZFD A;  5LT1 A;  3DCB A;  3ZFC A;  5LT2 A;  1F9V A;  3PXN A;  2GRY A;  4PJM A;  3WPN A;  3U06 A;  1VFZ A;  1VFX A;  2NCD A;  5LT3 A;  4A51 A;  4A5Y A;  4PFP A;  4LNU K;  2MYS A;  3X2T A;  3H4S A;  2GM1 A;  4ZCA A;  1F9W A;  2UYI A;  2X7E A;  2HEH A;  3CNZ A;  4BXN A;  3GBJ A;  1SDM A;  1G8X A;  2ZFJ A;  2X7D A;  4UBF A;  2FL6 A;  2OWM A;  4PJL A;  1MMA A;  2VVG A;  4H1G A;  1II6 A;  2Q2Z A;  2FKY A;  1I6I A;  1T5C A;  2ZFM A;  3L9H A;  3WRD A;  3KAR A;  2ZFI A;  1BR1 A;  1GOJ A;  1D0X A;  2Q2Y A;  4DBR A;  1D0Z A;  4AP0 A;  2ZFK A;  2FME A;  3HQD A;  3L1C A;  1FMW A;  2UYM A;  2FL2 A;  2Y65 A;  1V8K A;  2Y5W A;  4PJJ A;  4Y05 A;  2VB6 A;  3BFN A;  3ZCW A;  1V8J A;  1I5S A;  1X88 A;  1FMV A;  4B7B A;  1MNE A;  1D1A A;  4PJN A;  1MMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...