3DCBA

Crystal structure of the drosophila kinesin family member nod in complex with amppnp
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
317
structure length
299
Chain Sequence
KLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADLHHILELGTRNRRVSSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVRRTVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein Nod
publication title ATPase cycle of the nonmotile kinesin NOD allows microtubule end tracking and drives chromosome movement.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Motor protein
total genus 85
structure length 299
sequence length 317
ec nomenclature
pdb deposition date 2008-06-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3dcbA00
4FRZA 2FMEA 2GM1A 1MMAA 3NWNA 2X7EA 3CJOA 3PXNA 3ZCWA 1D1CA 2X51A 3ZFCA 2KINA 4HNAK 2V26A 4BXNA 1BR4A 4PJLA 2PG2A 1V8JA 4Y05A 2Q2ZA 1II6A 4PJNA 2GRYA 2UYIA 2VB6A 2ZFIA 2XT3A 2WOGA 4A14A 1Q0BA 2Q2YA 4A28A 5LT0A 3L1CA 4UBFA 2XAEA 2X7DA 3T0QA 3KINA 5LT1A 1D1AA 3COBA 1VOMA 2FL6A 4BN2A 1F9VA 4GKRA 3B6VA 4BBGA 2FKYA 2ZFJA 4PK4A 1RY6A 2ZFLA 2X2RA 3BFNA 4PJMA 4PJJA 2VVGA 4A1ZA 2VASA 1KK7A 1F9WA 3B6UA 4PFPA 3KENA 1F9UA 5LT4A 1N6MA 1MKJA 1YRSA 4ETPA 1G8XA 2ZFKA 3L9HA 2HEHA 1D0ZA 4AP0A 4E7ZA 1BR1A 3H4SA 1MMGA 1VFVA 1CZ7A 1LKXA 3K5EA 3LREA 1BR2A 3WPNA 3HQDA 1LVKA 2Y65A 4E7SA 1MMNA 3U06A 2UYMA 4H1GA 4ZCAA 1VFWA 1F9TA 1I6IA 4LNUK 5LT2A 4A50A 4ANJA 3WRDA 1T5CA 3K3BA 5GSZA 1D0XA 1MNEA 2MYSA 2Y5WA 1GOJA 1X88A 2FL2A 4A5YA 2ZFMA 5LT3A 4AS7A 1D1BA 1I5SA 1FMWA 1VFZA 3X2TA 1SDMA 3KARA 3DC4A 1V8KA 4A51A 1FMVA 4DBRA 1VFXA 3CNZA 3GBJA 4ZHIA 3ZFDA 2OWMA 4DBQA 2IEHA 3DCBA 1MMDA 1D0YA 2X7CA 2G1QA 1BG2A 4B7BA 2NCDA 4PFOA 5HLEA
chains in the Genus database with same CATH superfamily
4FRZA 2FMEA 2GM1A 1MMAA 3NWNA 2X7EA 3CJOA 3PXNA 3ZCWA 1D1CA 2X51A 3ZFCA 2KINA 4HNAK 2V26A 4BXNA 4GKPA 1BR4A 4PJLA 2PG2A 1V8JA 4Y05A 2Q2ZA 1II6A 4PJNA 2GRYA 2UYIA 2VB6A 2ZFIA 4ETPB 2XT3A 2WOGA 4A14A 1Q0BA 2Q2YA 4A28A 5LT0A 3L1CA 4UBFA 2XAEA 2X7DA 3T0QA 3KINA 5LT1A 1D1AA 3COBA 1VOMA 2FL6A 4BN2A 1F9VA 4GKRA 3B6VA 4BBGA 2FKYA 2ZFJA 4GKQA 4PK4A 1RY6A 2ZFLA 2X2RA 3BFNA 4PJMA 4PJJA 2VVGA 4A1ZA 2VASA 1KK7A 1F9WA 3B6UA 4PFPA 3KENA 1F9UA 5LT4A 1N6MA 1MKJA 1YRSA 4ETPA 1G8XA 2ZFKA 3L9HA 2HEHA 1D0ZA 4AP0A 4E7ZA 1BR1A 3H4SA 1MMGA 1VFVA 1CZ7A 1LKXA 3K5EA 3LREA 1BR2A 3WPNA 3HQDA 1LVKA 2Y65A 4E7SA 1MMNA 3U06A 2UYMA 4H1GA 4ZCAA 1VFWA 1F9TA 1I6IA 4LNUK 5LT2A 4A50A 4ANJA 3WRDA 1T5CA 3K3BA 5GSZA 1D0XA 1MNEA 2O0AA 2MYSA 2Y5WA 1GOJA 1X88A 2FL2A 4A5YA 2ZFMA 5LT3A 4AS7A 1D1BA 1I5SA 1FMWA 1VFZA 3X2TA 1SDMA 3KARA 3DC4A 1V8KA 4A51A 1FMVA 4DBRA 1VFXA 3CNZA 3GBJA 4ZHIA 3ZFDA 2OWMA 4DBQA 2IEHA 3DCBA 1MMDA 1D0YA 2X7CA 2G1QA 1BG2A 4B7BA 2NCDA 4PFOA 5HLEA
chains in the Genus database with same CATH topology
4FRZA 2FMEA 2GM1A 1MMAA 3NWNA 2X7EA 3CJOA 3PXNA 3ZCWA 1D1CA 2X51A 3ZFCA 2KINA 4HNAK 2V26A 4BXNA 1BR4A 4PJLA 2PG2A 1V8JA 4Y05A 2Q2ZA 1II6A 4PJNA 2GRYA 2UYIA 2VB6A 2ZFIA 2XT3A 2WOGA 4A14A 1Q0BA 2Q2YA 4A28A 5LT0A 3L1CA 4UBFA 2XAEA 2X7DA 3T0QA 3KINA 5LT1A 1D1AA 3COBA 1VOMA 2FL6A 4BN2A 1F9VA 4GKRA 3B6VA 4BBGA 2FKYA 2ZFJA 4PK4A 1RY6A 2ZFLA 2X2RA 3BFNA 4PJMA 4PJJA 2VVGA 4A1ZA 2VASA 1KK7A 1F9WA 3B6UA 4PFPA 3KENA 1F9UA 5LT4A 1N6MA 1MKJA 1YRSA 4ETPA 1G8XA 2ZFKA 3L9HA 2HEHA 1D0ZA 4AP0A 4E7ZA 1BR1A 3H4SA 1MMGA 1VFVA 1CZ7A 1LKXA 3K5EA 3LREA 1BR2A 3WPNA 3HQDA 1LVKA 2Y65A 4E7SA 1MMNA 3U06A 2UYMA 4H1GA 4ZCAA 1VFWA 1F9TA 1I6IA 4LNUK 5LT2A 4A50A 4ANJA 3WRDA 1T5CA 3K3BA 5GSZA 1D0XA 1MNEA 2MYSA 2Y5WA 1GOJA 1X88A 2FL2A 4A5YA 2ZFMA 5LT3A 4AS7A 1D1BA 1I5SA 1FMWA 1VFZA 3X2TA 1SDMA 3KARA 3DC4A 1V8KA 4A51A 1FMVA 4DBRA 1VFXA 3CNZA 3GBJA 4ZHIA 3ZFDA 2OWMA 4DBQA 2IEHA 3DCBA 1MMDA 1D0YA 2X7CA 2G1QA 1BG2A 4B7BA 2NCDA 4PFOA 5HLEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FRZ A;  2FME A;  2GM1 A;  1MMA A;  3NWN A;  2X7E A;  3CJO A;  3PXN A;  3ZCW A;  1D1C A;  2X51 A;  3ZFC A;  2KIN A;  4HNA K;  2V26 A;  4BXN A;  1BR4 A;  4PJL A;  2PG2 A;  1V8J A;  4Y05 A;  2Q2Z A;  1II6 A;  4PJN A;  2GRY A;  2UYI A;  2VB6 A;  2ZFI A;  2XT3 A;  2WOG A;  4A14 A;  1Q0B A;  2Q2Y A;  4A28 A;  5LT0 A;  3L1C A;  4UBF A;  2XAE A;  2X7D A;  3T0Q A;  3KIN A;  5LT1 A;  1D1A A;  3COB A;  1VOM A;  2FL6 A;  4BN2 A;  1F9V A;  4GKR A;  3B6V A;  4BBG A;  2FKY A;  2ZFJ A;  4PK4 A;  1RY6 A;  2ZFL A;  2X2R A;  3BFN A;  4PJM A;  4PJJ A;  2VVG A;  4A1Z A;  2VAS A;  1KK7 A;  1F9W A;  3B6U A;  4PFP A;  3KEN A;  1F9U A;  5LT4 A;  1N6M A;  1MKJ A;  1YRS A;  4ETP A;  1G8X A;  2ZFK A;  3L9H A;  2HEH A;  1D0Z A;  4AP0 A;  4E7Z A;  1BR1 A;  3H4S A;  1MMG A;  1VFV A;  1CZ7 A;  1LKX A;  3K5E A;  3LRE A;  1BR2 A;  3WPN A;  3HQD A;  1LVK A;  2Y65 A;  4E7S A;  1MMN A;  3U06 A;  2UYM A;  4H1G A;  4ZCA A;  1VFW A;  1F9T A;  1I6I A;  4LNU K;  5LT2 A;  4A50 A;  4ANJ A;  3WRD A;  1T5C A;  3K3B A;  5GSZ A;  1D0X A;  1MNE A;  2MYS A;  2Y5W A;  1GOJ A;  1X88 A;  2FL2 A;  4A5Y A;  2ZFM A;  5LT3 A;  4AS7 A;  1D1B A;  1I5S A;  1FMW A;  1VFZ A;  3X2T A;  1SDM A;  3KAR A;  3DC4 A;  1V8K A;  4A51 A;  1FMV A;  4DBR A;  1VFX A;  3CNZ A;  3GBJ A;  4ZHI A;  3ZFD A;  2OWM A;  4DBQ A;  2IEH A;  3DCB A;  1MMD A;  1D0Y A;  2X7C A;  2G1Q A;  1BG2 A;  4B7B A;  2NCD A;  4PFO A;  5HLE A; 
#chains in the Genus database with same CATH topology
 4FRZ A;  2FME A;  2GM1 A;  1MMA A;  3NWN A;  2X7E A;  3CJO A;  3PXN A;  3ZCW A;  1D1C A;  2X51 A;  3ZFC A;  2KIN A;  4HNA K;  2V26 A;  4BXN A;  4GKP A;  1BR4 A;  4PJL A;  2PG2 A;  1V8J A;  4Y05 A;  2Q2Z A;  1II6 A;  4PJN A;  2GRY A;  2UYI A;  2VB6 A;  2ZFI A;  4ETP B;  2XT3 A;  2WOG A;  4A14 A;  1Q0B A;  2Q2Y A;  4A28 A;  5LT0 A;  3L1C A;  4UBF A;  2XAE A;  2X7D A;  3T0Q A;  3KIN A;  5LT1 A;  1D1A A;  3COB A;  1VOM A;  2FL6 A;  4BN2 A;  1F9V A;  4GKR A;  3B6V A;  4BBG A;  2FKY A;  2ZFJ A;  4GKQ A;  4PK4 A;  1RY6 A;  2ZFL A;  2X2R A;  3BFN A;  4PJM A;  4PJJ A;  2VVG A;  4A1Z A;  2VAS A;  1KK7 A;  1F9W A;  3B6U A;  4PFP A;  3KEN A;  1F9U A;  5LT4 A;  1N6M A;  1MKJ A;  1YRS A;  4ETP A;  1G8X A;  2ZFK A;  3L9H A;  2HEH A;  1D0Z A;  4AP0 A;  4E7Z A;  1BR1 A;  3H4S A;  1MMG A;  1VFV A;  1CZ7 A;  1LKX A;  3K5E A;  3LRE A;  1BR2 A;  3WPN A;  3HQD A;  1LVK A;  2Y65 A;  4E7S A;  1MMN A;  3U06 A;  2UYM A;  4H1G A;  4ZCA A;  1VFW A;  1F9T A;  1I6I A;  4LNU K;  5LT2 A;  4A50 A;  4ANJ A;  3WRD A;  1T5C A;  3K3B A;  5GSZ A;  1D0X A;  1MNE A;  2O0A A;  2MYS A;  2Y5W A;  1GOJ A;  1X88 A;  2FL2 A;  4A5Y A;  2ZFM A;  5LT3 A;  4AS7 A;  1D1B A;  1I5S A;  1FMW A;  1VFZ A;  3X2T A;  1SDM A;  3KAR A;  3DC4 A;  1V8K A;  4A51 A;  1FMV A;  4DBR A;  1VFX A;  3CNZ A;  3GBJ A;  4ZHI A;  3ZFD A;  2OWM A;  4DBQ A;  2IEH A;  3DCB A;  1MMD A;  1D0Y A;  2X7C A;  2G1Q A;  1BG2 A;  4B7B A;  2NCD A;  4PFO A;  5HLE A; 
#chains in the Genus database with same CATH homology
 4FRZ A;  2FME A;  2GM1 A;  1MMA A;  3NWN A;  2X7E A;  3CJO A;  3PXN A;  3ZCW A;  1D1C A;  2X51 A;  3ZFC A;  2KIN A;  4HNA K;  2V26 A;  4BXN A;  1BR4 A;  4PJL A;  2PG2 A;  1V8J A;  4Y05 A;  2Q2Z A;  1II6 A;  4PJN A;  2GRY A;  2UYI A;  2VB6 A;  2ZFI A;  2XT3 A;  2WOG A;  4A14 A;  1Q0B A;  2Q2Y A;  4A28 A;  5LT0 A;  3L1C A;  4UBF A;  2XAE A;  2X7D A;  3T0Q A;  3KIN A;  5LT1 A;  1D1A A;  3COB A;  1VOM A;  2FL6 A;  4BN2 A;  1F9V A;  4GKR A;  3B6V A;  4BBG A;  2FKY A;  2ZFJ A;  4PK4 A;  1RY6 A;  2ZFL A;  2X2R A;  3BFN A;  4PJM A;  4PJJ A;  2VVG A;  4A1Z A;  2VAS A;  1KK7 A;  1F9W A;  3B6U A;  4PFP A;  3KEN A;  1F9U A;  5LT4 A;  1N6M A;  1MKJ A;  1YRS A;  4ETP A;  1G8X A;  2ZFK A;  3L9H A;  2HEH A;  1D0Z A;  4AP0 A;  4E7Z A;  1BR1 A;  3H4S A;  1MMG A;  1VFV A;  1CZ7 A;  1LKX A;  3K5E A;  3LRE A;  1BR2 A;  3WPN A;  3HQD A;  1LVK A;  2Y65 A;  4E7S A;  1MMN A;  3U06 A;  2UYM A;  4H1G A;  4ZCA A;  1VFW A;  1F9T A;  1I6I A;  4LNU K;  5LT2 A;  4A50 A;  4ANJ A;  3WRD A;  1T5C A;  3K3B A;  5GSZ A;  1D0X A;  1MNE A;  2MYS A;  2Y5W A;  1GOJ A;  1X88 A;  2FL2 A;  4A5Y A;  2ZFM A;  5LT3 A;  4AS7 A;  1D1B A;  1I5S A;  1FMW A;  1VFZ A;  3X2T A;  1SDM A;  3KAR A;  3DC4 A;  1V8K A;  4A51 A;  1FMV A;  4DBR A;  1VFX A;  3CNZ A;  3GBJ A;  4ZHI A;  3ZFD A;  2OWM A;  4DBQ A;  2IEH A;  3DCB A;  1MMD A;  1D0Y A;  2X7C A;  2G1Q A;  1BG2 A;  4B7B A;  2NCD A;  4PFO A;  5HLE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...