2ZFKA

Crystal structure of the kif1a motor domain during mg release: mg-releasing transition-2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
350
structure length
321
Chain Sequence
b'VKVAVRVRPFNSREMSRDSKCIIQGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEEGANINKSLTTLGKVISALAEMDSGPDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 62
structure length 321
sequence length 350
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfkA00
3T0QA 2VASA 1G8XA 1D0XA 2Y5WA 1II6A 2Q2ZA 1V8JA 4A5YA 2FMEA 2ZFIA 2WOGA 1I6IA 4DBRA 3KENA 2IEHA 1SDMA 1VFZA 3ZCWA 2ZFLA 1FMVA 3NWNA 3U06A 3B6VA 3B6UA 1F9WA 4AP0A 4PJMA 1D1CA 1RY6A 1MMGA 1VOMA 2PG2A 3KARA 3ZFCA 4BN2A 4Y05A 4H1GA 1VFWA 4A51A 1D1AA 1GOJA 4A28A 4PFPA 2G1QA 3K3BA 3H4SA 4UBFA 4A1ZA 1YRSA 3BFNA 1MMNA 2Y65A 1D0ZA 3LREA 1I5SA 3WPNA 4A50A 4AS7A 1CZ7A 1MMAA 5LT0A 2X2RA 2Q2YA 4FRZA 4E7SA 4B7BA 2XAEA 3DC4A 1BR4A 3L9HA 1VFVA 1FMWA 5LT3A 1T5CA 2FL2A 2MYSA 2X51A 1LKXA 2UYMA 3GBJA 2VVGA 4ANJA 1MNEA 1MKJA 2ZFKA 2V26A 2KINA 1F9VA 2ZFMA 2OWMA 4ETPA 3HQDA 1D1BA 4PFOA 1N6MA 3PXNA 4ZHIA 5LT1A 1VFXA 2GM1A 1F9UA 3COBA 2X7EA 1BR1A 2FL6A 4DBQA 3X2TA 2HEHA 4PJJA 4PJNA 4E7ZA 5LT4A 1Q0BA 2GRYA 2UYIA 1BG2A 4LNUK 2X7DA 2VB6A 4BBGA 4PJLA 4PK4A 4ZCAA 3ZFDA 3K5EA 2NCDA 5HLEA 3L1CA 4BXNA 3CJOA 2FKYA 4GKRA 3KINA 1BR2A 3DCBA 4A14A 2X7CA 1D0YA 3CNZA 3WRDA 1KK7A 1F9TA 5GSZA 1V8KA 2XT3A 1LVKA 4HNAK 5LT2A 1MMDA 2ZFJA 1X88A
chains in the Genus database with same CATH superfamily
3T0QA 2VASA 1G8XA 2O0AA 1D0XA 2Y5WA 1II6A 2Q2ZA 1V8JA 4A5YA 2FMEA 2ZFIA 2WOGA 1I6IA 4DBRA 3KENA 2IEHA 1SDMA 1VFZA 3ZCWA 2ZFLA 1FMVA 3NWNA 3U06A 3B6VA 3B6UA 1F9WA 4AP0A 4PJMA 1D1CA 1RY6A 1MMGA 1VOMA 2PG2A 3KARA 3ZFCA 4BN2A 4Y05A 4H1GA 1VFWA 4A51A 1D1AA 1GOJA 4A28A 4PFPA 2G1QA 3K3BA 4ETPB 3H4SA 4UBFA 4A1ZA 1YRSA 3BFNA 1MMNA 2Y65A 1D0ZA 3LREA 1I5SA 3WPNA 4A50A 4AS7A 1CZ7A 1MMAA 5LT0A 2X2RA 2Q2YA 4FRZA 4E7SA 4B7BA 2XAEA 3DC4A 1BR4A 3L9HA 1VFVA 1FMWA 5LT3A 1T5CA 2FL2A 2MYSA 2X51A 1LKXA 2UYMA 3GBJA 2VVGA 4ANJA 1MNEA 1MKJA 2ZFKA 2V26A 2KINA 1F9VA 2ZFMA 2OWMA 4ETPA 3HQDA 1D1BA 4PFOA 1N6MA 3PXNA 4ZHIA 5LT1A 1VFXA 2GM1A 1F9UA 3COBA 2X7EA 1BR1A 2FL6A 4DBQA 3X2TA 2HEHA 4PJJA 4GKQA 4PJNA 4E7ZA 5LT4A 1Q0BA 2GRYA 2UYIA 1BG2A 4LNUK 2X7DA 2VB6A 4BBGA 4PJLA 4PK4A 4ZCAA 3ZFDA 3K5EA 2NCDA 5HLEA 3L1CA 4GKPA 4BXNA 3CJOA 2FKYA 4GKRA 3KINA 1BR2A 3DCBA 4A14A 2X7CA 1D0YA 3CNZA 3WRDA 1KK7A 1F9TA 5GSZA 1V8KA 2XT3A 1LVKA 4HNAK 5LT2A 1MMDA 2ZFJA 1X88A
chains in the Genus database with same CATH topology
3T0QA 2VASA 1G8XA 1D0XA 2Y5WA 1II6A 2Q2ZA 1V8JA 4A5YA 2FMEA 2ZFIA 2WOGA 1I6IA 4DBRA 3KENA 2IEHA 1SDMA 1VFZA 3ZCWA 2ZFLA 1FMVA 3NWNA 3U06A 3B6VA 3B6UA 1F9WA 4AP0A 4PJMA 1D1CA 1RY6A 1MMGA 1VOMA 2PG2A 3KARA 3ZFCA 4BN2A 4Y05A 4H1GA 1VFWA 4A51A 1D1AA 1GOJA 4A28A 4PFPA 2G1QA 3K3BA 3H4SA 4UBFA 4A1ZA 1YRSA 3BFNA 1MMNA 2Y65A 1D0ZA 3LREA 1I5SA 3WPNA 4A50A 4AS7A 1CZ7A 1MMAA 5LT0A 2X2RA 2Q2YA 4FRZA 4E7SA 4B7BA 2XAEA 3DC4A 1BR4A 3L9HA 1VFVA 1FMWA 5LT3A 1T5CA 2FL2A 2MYSA 2X51A 1LKXA 2UYMA 3GBJA 2VVGA 4ANJA 1MNEA 1MKJA 2ZFKA 2V26A 2KINA 1F9VA 2ZFMA 2OWMA 4ETPA 3HQDA 1D1BA 4PFOA 1N6MA 3PXNA 4ZHIA 5LT1A 1VFXA 2GM1A 1F9UA 3COBA 2X7EA 1BR1A 2FL6A 4DBQA 3X2TA 2HEHA 4PJJA 4PJNA 4E7ZA 5LT4A 1Q0BA 2GRYA 2UYIA 1BG2A 4LNUK 2X7DA 2VB6A 4BBGA 4PJLA 4PK4A 4ZCAA 3ZFDA 3K5EA 2NCDA 5HLEA 3L1CA 4BXNA 3CJOA 2FKYA 4GKRA 3KINA 1BR2A 3DCBA 4A14A 2X7CA 1D0YA 3CNZA 3WRDA 1KK7A 1F9TA 5GSZA 1V8KA 2XT3A 1LVKA 4HNAK 5LT2A 1MMDA 2ZFJA 1X88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T0Q A;  2VAS A;  1G8X A;  1D0X A;  2Y5W A;  1II6 A;  2Q2Z A;  1V8J A;  4A5Y A;  2FME A;  2ZFI A;  2WOG A;  1I6I A;  4DBR A;  3KEN A;  2IEH A;  1SDM A;  1VFZ A;  3ZCW A;  2ZFL A;  1FMV A;  3NWN A;  3U06 A;  3B6V A;  3B6U A;  1F9W A;  4AP0 A;  4PJM A;  1D1C A;  1RY6 A;  1MMG A;  1VOM A;  2PG2 A;  3KAR A;  3ZFC A;  4BN2 A;  4Y05 A;  4H1G A;  1VFW A;  4A51 A;  1D1A A;  1GOJ A;  4A28 A;  4PFP A;  2G1Q A;  3K3B A;  3H4S A;  4UBF A;  4A1Z A;  1YRS A;  3BFN A;  1MMN A;  2Y65 A;  1D0Z A;  3LRE A;  1I5S A;  3WPN A;  4A50 A;  4AS7 A;  1CZ7 A;  1MMA A;  5LT0 A;  2X2R A;  2Q2Y A;  4FRZ A;  4E7S A;  4B7B A;  2XAE A;  3DC4 A;  1BR4 A;  3L9H A;  1VFV A;  1FMW A;  5LT3 A;  1T5C A;  2FL2 A;  2MYS A;  2X51 A;  1LKX A;  2UYM A;  3GBJ A;  2VVG A;  4ANJ A;  1MNE A;  1MKJ A;  2ZFK A;  2V26 A;  2KIN A;  1F9V A;  2ZFM A;  2OWM A;  4ETP A;  3HQD A;  1D1B A;  4PFO A;  1N6M A;  3PXN A;  4ZHI A;  5LT1 A;  1VFX A;  2GM1 A;  1F9U A;  3COB A;  2X7E A;  1BR1 A;  2FL6 A;  4DBQ A;  3X2T A;  2HEH A;  4PJJ A;  4PJN A;  4E7Z A;  5LT4 A;  1Q0B A;  2GRY A;  2UYI A;  1BG2 A;  4LNU K;  2X7D A;  2VB6 A;  4BBG A;  4PJL A;  4PK4 A;  4ZCA A;  3ZFD A;  3K5E A;  2NCD A;  5HLE A;  3L1C A;  4BXN A;  3CJO A;  2FKY A;  4GKR A;  3KIN A;  1BR2 A;  3DCB A;  4A14 A;  2X7C A;  1D0Y A;  3CNZ A;  3WRD A;  1KK7 A;  1F9T A;  5GSZ A;  1V8K A;  2XT3 A;  1LVK A;  4HNA K;  5LT2 A;  1MMD A;  2ZFJ A;  1X88 A; 
#chains in the Genus database with same CATH topology
 3T0Q A;  2VAS A;  1G8X A;  2O0A A;  1D0X A;  2Y5W A;  1II6 A;  2Q2Z A;  1V8J A;  4A5Y A;  2FME A;  2ZFI A;  2WOG A;  1I6I A;  4DBR A;  3KEN A;  2IEH A;  1SDM A;  1VFZ A;  3ZCW A;  2ZFL A;  1FMV A;  3NWN A;  3U06 A;  3B6V A;  3B6U A;  1F9W A;  4AP0 A;  4PJM A;  1D1C A;  1RY6 A;  1MMG A;  1VOM A;  2PG2 A;  3KAR A;  3ZFC A;  4BN2 A;  4Y05 A;  4H1G A;  1VFW A;  4A51 A;  1D1A A;  1GOJ A;  4A28 A;  4PFP A;  2G1Q A;  3K3B A;  4ETP B;  3H4S A;  4UBF A;  4A1Z A;  1YRS A;  3BFN A;  1MMN A;  2Y65 A;  1D0Z A;  3LRE A;  1I5S A;  3WPN A;  4A50 A;  4AS7 A;  1CZ7 A;  1MMA A;  5LT0 A;  2X2R A;  2Q2Y A;  4FRZ A;  4E7S A;  4B7B A;  2XAE A;  3DC4 A;  1BR4 A;  3L9H A;  1VFV A;  1FMW A;  5LT3 A;  1T5C A;  2FL2 A;  2MYS A;  2X51 A;  1LKX A;  2UYM A;  3GBJ A;  2VVG A;  4ANJ A;  1MNE A;  1MKJ A;  2ZFK A;  2V26 A;  2KIN A;  1F9V A;  2ZFM A;  2OWM A;  4ETP A;  3HQD A;  1D1B A;  4PFO A;  1N6M A;  3PXN A;  4ZHI A;  5LT1 A;  1VFX A;  2GM1 A;  1F9U A;  3COB A;  2X7E A;  1BR1 A;  2FL6 A;  4DBQ A;  3X2T A;  2HEH A;  4PJJ A;  4GKQ A;  4PJN A;  4E7Z A;  5LT4 A;  1Q0B A;  2GRY A;  2UYI A;  1BG2 A;  4LNU K;  2X7D A;  2VB6 A;  4BBG A;  4PJL A;  4PK4 A;  4ZCA A;  3ZFD A;  3K5E A;  2NCD A;  5HLE A;  3L1C A;  4GKP A;  4BXN A;  3CJO A;  2FKY A;  4GKR A;  3KIN A;  1BR2 A;  3DCB A;  4A14 A;  2X7C A;  1D0Y A;  3CNZ A;  3WRD A;  1KK7 A;  1F9T A;  5GSZ A;  1V8K A;  2XT3 A;  1LVK A;  4HNA K;  5LT2 A;  1MMD A;  2ZFJ A;  1X88 A; 
#chains in the Genus database with same CATH homology
 3T0Q A;  2VAS A;  1G8X A;  1D0X A;  2Y5W A;  1II6 A;  2Q2Z A;  1V8J A;  4A5Y A;  2FME A;  2ZFI A;  2WOG A;  1I6I A;  4DBR A;  3KEN A;  2IEH A;  1SDM A;  1VFZ A;  3ZCW A;  2ZFL A;  1FMV A;  3NWN A;  3U06 A;  3B6V A;  3B6U A;  1F9W A;  4AP0 A;  4PJM A;  1D1C A;  1RY6 A;  1MMG A;  1VOM A;  2PG2 A;  3KAR A;  3ZFC A;  4BN2 A;  4Y05 A;  4H1G A;  1VFW A;  4A51 A;  1D1A A;  1GOJ A;  4A28 A;  4PFP A;  2G1Q A;  3K3B A;  3H4S A;  4UBF A;  4A1Z A;  1YRS A;  3BFN A;  1MMN A;  2Y65 A;  1D0Z A;  3LRE A;  1I5S A;  3WPN A;  4A50 A;  4AS7 A;  1CZ7 A;  1MMA A;  5LT0 A;  2X2R A;  2Q2Y A;  4FRZ A;  4E7S A;  4B7B A;  2XAE A;  3DC4 A;  1BR4 A;  3L9H A;  1VFV A;  1FMW A;  5LT3 A;  1T5C A;  2FL2 A;  2MYS A;  2X51 A;  1LKX A;  2UYM A;  3GBJ A;  2VVG A;  4ANJ A;  1MNE A;  1MKJ A;  2ZFK A;  2V26 A;  2KIN A;  1F9V A;  2ZFM A;  2OWM A;  4ETP A;  3HQD A;  1D1B A;  4PFO A;  1N6M A;  3PXN A;  4ZHI A;  5LT1 A;  1VFX A;  2GM1 A;  1F9U A;  3COB A;  2X7E A;  1BR1 A;  2FL6 A;  4DBQ A;  3X2T A;  2HEH A;  4PJJ A;  4PJN A;  4E7Z A;  5LT4 A;  1Q0B A;  2GRY A;  2UYI A;  1BG2 A;  4LNU K;  2X7D A;  2VB6 A;  4BBG A;  4PJL A;  4PK4 A;  4ZCA A;  3ZFD A;  3K5E A;  2NCD A;  5HLE A;  3L1C A;  4BXN A;  3CJO A;  2FKY A;  4GKR A;  3KIN A;  1BR2 A;  3DCB A;  4A14 A;  2X7C A;  1D0Y A;  3CNZ A;  3WRD A;  1KK7 A;  1F9T A;  5GSZ A;  1V8K A;  2XT3 A;  1LVK A;  4HNA K;  5LT2 A;  1MMD A;  2ZFJ A;  1X88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...