2ZFKA

Crystal structure of the kif1a motor domain during mg release: mg-releasing transition-2
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
350
structure length
321
Chain Sequence
VKVAVRVRPFNSREMSRDSKCIIQGSTTTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQHAFEGYNVCIFAYGQTGAGKSYTMMGKQEKDQQGIIPQLCEDLFSRINDTTNDNMSYSVEVSYMEIYCERVRDLLNPKNKGNLRVREHPLLGPYVEDLSKLAVTSYNDIQDLMDSGNKPRTVNETSSRSHAVFNIIFTQKRHDAETNITTEKVSKISLVDLAGSEEGANINKSLTTLGKVISALAEMDSGPDFIPYRDSVLTWLLRENLGGNSRTAMVAALSPADINYDETLSTLRYADRAKQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein KIF1A, Kinesin heavy chain isoform 5C
publication title Structural model for strain-dependent microtubule activation of Mg-ADP release from kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 62
structure length 321
sequence length 350
ec nomenclature
pdb deposition date 2008-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 2zfkA00
2ZFLA 2X7CA 1T5CA 1Q0BA 2NCDA 3LREA 1FMVA 3K5EA 2Y5WA 1G8XA 2Q2ZA 1V8JA 4A28A 1BR2A 1LVKA 1SDMA 1GOJA 4BXNA 5LT1A 2OWMA 4AS7A 3DCBA 4HNAK 2HEHA 2X51A 1MMDA 2GRYA 2IEHA 3K3BA 3U06A 3H4SA 1MMAA 1VFXA 4PFOA 2ZFIA 3CJOA 2ZFKA 4PK4A 4A5YA 3HQDA 4ZHIA 4B7BA 3PXNA 4GKRA 4PJJA 4A14A 1F9WA 3L1CA 5LT0A 1MMNA 4PJLA 2X2RA 1VFWA 4ANJA 3L9HA 4H1GA 2X7EA 2FL6A 4DBQA 3GBJA 1D1BA 4AP0A 2UYMA 2KINA 2FL2A 1RY6A 4E7ZA 1D0YA 3KINA 2FKYA 2V26A 2Y65A 2MYSA 2VVGA 1CZ7A 3KARA 2XT3A 3NWNA 1BG2A 2VB6A 1V8KA 4UBFA 1VOMA 4PJMA 1LKXA 2PG2A 2WOGA 3T0QA 2X7DA 2Q2YA 4BBGA 1I6IA 3B6UA 4PFPA 4ETPA 4A51A 2VASA 1MKJA 5LT2A 3ZCWA 1F9TA 3WPNA 4FRZA 1I5SA 2GM1A 5GSZA 2G1QA 1VFVA 2UYIA 4ZCAA 1FMWA 3BFNA 1BR4A 4DBRA 5LT3A 3ZFCA 5HLEA 1BR1A 2ZFJA 1N6MA 3WRDA 1F9UA 4BN2A 3KENA 2ZFMA 4PJNA 1X88A 1MMGA 2XAEA 3B6VA 3CNZA 3X2TA 1KK7A 1F9VA 2FMEA 4A1ZA 1D1AA 4E7SA 4A50A 1YRSA 3ZFDA 1D0ZA 4LNUK 1VFZA 1II6A 4Y05A 3COBA 3DC4A 1D1CA 5LT4A 1MNEA 1D0XA
chains in the Genus database with same CATH superfamily
2ZFLA 2X7CA 1T5CA 1Q0BA 2NCDA 3LREA 1FMVA 3K5EA 2Y5WA 1G8XA 2Q2ZA 1V8JA 4A28A 1BR2A 1LVKA 1SDMA 1GOJA 4BXNA 5LT1A 2OWMA 4AS7A 3DCBA 4HNAK 2HEHA 2O0AA 2X51A 1MMDA 2GRYA 2IEHA 3K3BA 3U06A 3H4SA 1MMAA 1VFXA 4PFOA 2ZFIA 3CJOA 2ZFKA 4PK4A 4A5YA 3HQDA 4ZHIA 4B7BA 3PXNA 4GKRA 4PJJA 4A14A 1F9WA 3L1CA 5LT0A 1MMNA 4PJLA 2X2RA 1VFWA 4ANJA 3L9HA 4H1GA 2X7EA 2FL6A 4DBQA 3GBJA 1D1BA 4AP0A 2UYMA 2KINA 2FL2A 1RY6A 4E7ZA 1D0YA 3KINA 2FKYA 2V26A 2Y65A 2MYSA 2VVGA 1CZ7A 3KARA 2XT3A 3NWNA 1BG2A 2VB6A 1V8KA 4UBFA 1VOMA 4PJMA 1LKXA 2PG2A 2WOGA 3T0QA 2X7DA 2Q2YA 4BBGA 4ETPB 1I6IA 3B6UA 4PFPA 4GKQA 4ETPA 4A51A 2VASA 1MKJA 5LT2A 3ZCWA 1F9TA 3WPNA 4FRZA 1I5SA 2GM1A 5GSZA 2G1QA 1VFVA 2UYIA 4ZCAA 1FMWA 3BFNA 1BR4A 4DBRA 5LT3A 3ZFCA 5HLEA 1BR1A 2ZFJA 1N6MA 3WRDA 1F9UA 4BN2A 3KENA 2ZFMA 4PJNA 1X88A 1MMGA 2XAEA 3B6VA 3CNZA 3X2TA 1KK7A 1F9VA 2FMEA 4A1ZA 1D1AA 4E7SA 4GKPA 4A50A 1YRSA 3ZFDA 1D0ZA 4LNUK 1VFZA 1II6A 4Y05A 3COBA 3DC4A 1D1CA 5LT4A 1MNEA 1D0XA
chains in the Genus database with same CATH topology
2ZFLA 2X7CA 1T5CA 1Q0BA 2NCDA 3LREA 1FMVA 3K5EA 2Y5WA 1G8XA 2Q2ZA 1V8JA 4A28A 1BR2A 1LVKA 1SDMA 1GOJA 4BXNA 5LT1A 2OWMA 4AS7A 3DCBA 4HNAK 2HEHA 2X51A 1MMDA 2GRYA 2IEHA 3K3BA 3U06A 3H4SA 1MMAA 1VFXA 4PFOA 2ZFIA 3CJOA 2ZFKA 4PK4A 4A5YA 3HQDA 4ZHIA 4B7BA 3PXNA 4GKRA 4PJJA 4A14A 1F9WA 3L1CA 5LT0A 1MMNA 4PJLA 2X2RA 1VFWA 4ANJA 3L9HA 4H1GA 2X7EA 2FL6A 4DBQA 3GBJA 1D1BA 4AP0A 2UYMA 2KINA 2FL2A 1RY6A 4E7ZA 1D0YA 3KINA 2FKYA 2V26A 2Y65A 2MYSA 2VVGA 1CZ7A 3KARA 2XT3A 3NWNA 1BG2A 2VB6A 1V8KA 4UBFA 1VOMA 4PJMA 1LKXA 2PG2A 2WOGA 3T0QA 2X7DA 2Q2YA 4BBGA 1I6IA 3B6UA 4PFPA 4ETPA 4A51A 2VASA 1MKJA 5LT2A 3ZCWA 1F9TA 3WPNA 4FRZA 1I5SA 2GM1A 5GSZA 2G1QA 1VFVA 2UYIA 4ZCAA 1FMWA 3BFNA 1BR4A 4DBRA 5LT3A 3ZFCA 5HLEA 1BR1A 2ZFJA 1N6MA 3WRDA 1F9UA 4BN2A 3KENA 2ZFMA 4PJNA 1X88A 1MMGA 2XAEA 3B6VA 3CNZA 3X2TA 1KK7A 1F9VA 2FMEA 4A1ZA 1D1AA 4E7SA 4A50A 1YRSA 3ZFDA 1D0ZA 4LNUK 1VFZA 1II6A 4Y05A 3COBA 3DC4A 1D1CA 5LT4A 1MNEA 1D0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZFL A;  2X7C A;  1T5C A;  1Q0B A;  2NCD A;  3LRE A;  1FMV A;  3K5E A;  2Y5W A;  1G8X A;  2Q2Z A;  1V8J A;  4A28 A;  1BR2 A;  1LVK A;  1SDM A;  1GOJ A;  4BXN A;  5LT1 A;  2OWM A;  4AS7 A;  3DCB A;  4HNA K;  2HEH A;  2X51 A;  1MMD A;  2GRY A;  2IEH A;  3K3B A;  3U06 A;  3H4S A;  1MMA A;  1VFX A;  4PFO A;  2ZFI A;  3CJO A;  2ZFK A;  4PK4 A;  4A5Y A;  3HQD A;  4ZHI A;  4B7B A;  3PXN A;  4GKR A;  4PJJ A;  4A14 A;  1F9W A;  3L1C A;  5LT0 A;  1MMN A;  4PJL A;  2X2R A;  1VFW A;  4ANJ A;  3L9H A;  4H1G A;  2X7E A;  2FL6 A;  4DBQ A;  3GBJ A;  1D1B A;  4AP0 A;  2UYM A;  2KIN A;  2FL2 A;  1RY6 A;  4E7Z A;  1D0Y A;  3KIN A;  2FKY A;  2V26 A;  2Y65 A;  2MYS A;  2VVG A;  1CZ7 A;  3KAR A;  2XT3 A;  3NWN A;  1BG2 A;  2VB6 A;  1V8K A;  4UBF A;  1VOM A;  4PJM A;  1LKX A;  2PG2 A;  2WOG A;  3T0Q A;  2X7D A;  2Q2Y A;  4BBG A;  1I6I A;  3B6U A;  4PFP A;  4ETP A;  4A51 A;  2VAS A;  1MKJ A;  5LT2 A;  3ZCW A;  1F9T A;  3WPN A;  4FRZ A;  1I5S A;  2GM1 A;  5GSZ A;  2G1Q A;  1VFV A;  2UYI A;  4ZCA A;  1FMW A;  3BFN A;  1BR4 A;  4DBR A;  5LT3 A;  3ZFC A;  5HLE A;  1BR1 A;  2ZFJ A;  1N6M A;  3WRD A;  1F9U A;  4BN2 A;  3KEN A;  2ZFM A;  4PJN A;  1X88 A;  1MMG A;  2XAE A;  3B6V A;  3CNZ A;  3X2T A;  1KK7 A;  1F9V A;  2FME A;  4A1Z A;  1D1A A;  4E7S A;  4A50 A;  1YRS A;  3ZFD A;  1D0Z A;  4LNU K;  1VFZ A;  1II6 A;  4Y05 A;  3COB A;  3DC4 A;  1D1C A;  5LT4 A;  1MNE A;  1D0X A; 
#chains in the Genus database with same CATH topology
 2ZFL A;  2X7C A;  1T5C A;  1Q0B A;  2NCD A;  3LRE A;  1FMV A;  3K5E A;  2Y5W A;  1G8X A;  2Q2Z A;  1V8J A;  4A28 A;  1BR2 A;  1LVK A;  1SDM A;  1GOJ A;  4BXN A;  5LT1 A;  2OWM A;  4AS7 A;  3DCB A;  4HNA K;  2HEH A;  2O0A A;  2X51 A;  1MMD A;  2GRY A;  2IEH A;  3K3B A;  3U06 A;  3H4S A;  1MMA A;  1VFX A;  4PFO A;  2ZFI A;  3CJO A;  2ZFK A;  4PK4 A;  4A5Y A;  3HQD A;  4ZHI A;  4B7B A;  3PXN A;  4GKR A;  4PJJ A;  4A14 A;  1F9W A;  3L1C A;  5LT0 A;  1MMN A;  4PJL A;  2X2R A;  1VFW A;  4ANJ A;  3L9H A;  4H1G A;  2X7E A;  2FL6 A;  4DBQ A;  3GBJ A;  1D1B A;  4AP0 A;  2UYM A;  2KIN A;  2FL2 A;  1RY6 A;  4E7Z A;  1D0Y A;  3KIN A;  2FKY A;  2V26 A;  2Y65 A;  2MYS A;  2VVG A;  1CZ7 A;  3KAR A;  2XT3 A;  3NWN A;  1BG2 A;  2VB6 A;  1V8K A;  4UBF A;  1VOM A;  4PJM A;  1LKX A;  2PG2 A;  2WOG A;  3T0Q A;  2X7D A;  2Q2Y A;  4BBG A;  4ETP B;  1I6I A;  3B6U A;  4PFP A;  4GKQ A;  4ETP A;  4A51 A;  2VAS A;  1MKJ A;  5LT2 A;  3ZCW A;  1F9T A;  3WPN A;  4FRZ A;  1I5S A;  2GM1 A;  5GSZ A;  2G1Q A;  1VFV A;  2UYI A;  4ZCA A;  1FMW A;  3BFN A;  1BR4 A;  4DBR A;  5LT3 A;  3ZFC A;  5HLE A;  1BR1 A;  2ZFJ A;  1N6M A;  3WRD A;  1F9U A;  4BN2 A;  3KEN A;  2ZFM A;  4PJN A;  1X88 A;  1MMG A;  2XAE A;  3B6V A;  3CNZ A;  3X2T A;  1KK7 A;  1F9V A;  2FME A;  4A1Z A;  1D1A A;  4E7S A;  4GKP A;  4A50 A;  1YRS A;  3ZFD A;  1D0Z A;  4LNU K;  1VFZ A;  1II6 A;  4Y05 A;  3COB A;  3DC4 A;  1D1C A;  5LT4 A;  1MNE A;  1D0X A; 
#chains in the Genus database with same CATH homology
 2ZFL A;  2X7C A;  1T5C A;  1Q0B A;  2NCD A;  3LRE A;  1FMV A;  3K5E A;  2Y5W A;  1G8X A;  2Q2Z A;  1V8J A;  4A28 A;  1BR2 A;  1LVK A;  1SDM A;  1GOJ A;  4BXN A;  5LT1 A;  2OWM A;  4AS7 A;  3DCB A;  4HNA K;  2HEH A;  2X51 A;  1MMD A;  2GRY A;  2IEH A;  3K3B A;  3U06 A;  3H4S A;  1MMA A;  1VFX A;  4PFO A;  2ZFI A;  3CJO A;  2ZFK A;  4PK4 A;  4A5Y A;  3HQD A;  4ZHI A;  4B7B A;  3PXN A;  4GKR A;  4PJJ A;  4A14 A;  1F9W A;  3L1C A;  5LT0 A;  1MMN A;  4PJL A;  2X2R A;  1VFW A;  4ANJ A;  3L9H A;  4H1G A;  2X7E A;  2FL6 A;  4DBQ A;  3GBJ A;  1D1B A;  4AP0 A;  2UYM A;  2KIN A;  2FL2 A;  1RY6 A;  4E7Z A;  1D0Y A;  3KIN A;  2FKY A;  2V26 A;  2Y65 A;  2MYS A;  2VVG A;  1CZ7 A;  3KAR A;  2XT3 A;  3NWN A;  1BG2 A;  2VB6 A;  1V8K A;  4UBF A;  1VOM A;  4PJM A;  1LKX A;  2PG2 A;  2WOG A;  3T0Q A;  2X7D A;  2Q2Y A;  4BBG A;  1I6I A;  3B6U A;  4PFP A;  4ETP A;  4A51 A;  2VAS A;  1MKJ A;  5LT2 A;  3ZCW A;  1F9T A;  3WPN A;  4FRZ A;  1I5S A;  2GM1 A;  5GSZ A;  2G1Q A;  1VFV A;  2UYI A;  4ZCA A;  1FMW A;  3BFN A;  1BR4 A;  4DBR A;  5LT3 A;  3ZFC A;  5HLE A;  1BR1 A;  2ZFJ A;  1N6M A;  3WRD A;  1F9U A;  4BN2 A;  3KEN A;  2ZFM A;  4PJN A;  1X88 A;  1MMG A;  2XAE A;  3B6V A;  3CNZ A;  3X2T A;  1KK7 A;  1F9V A;  2FME A;  4A1Z A;  1D1A A;  4E7S A;  4A50 A;  1YRS A;  3ZFD A;  1D0Z A;  4LNU K;  1VFZ A;  1II6 A;  4Y05 A;  3COB A;  3DC4 A;  1D1C A;  5LT4 A;  1MNE A;  1D0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...