3ZFCA

Crystal structure of the kif4 motor domain complexed with mg-amppnp
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
343
structure length
337
Chain Sequence
VKGIPVRVALRCRPLVSKEIKEGCQTCLSFVPGEPQVVVGNDKSFTYDFVFDPSTEQEEVFNTAVAPLIKGVFKGYNATVLAYGQTGSGKTYSMGGAYTAEQEHDSAIGVIPRVIQLLFKEINKKSDFEFTLKVSYLEIYNEEILDLLCSQINIREDPKEGIKIVGLTEKTVLVASDTVSCLEQGNNSRTVASTAMNSQSSRSHAIFTISIEQRKKNDKNSSFRSKLHLVDLAGSERQKKTKAEGDRLREGININRGLLCLGNVISALGDDKKGNFVPYRDSKLTRLLQDSLGGNSHTLMIACVSPADSNLEETLNTLRYADRARKIKNKPIINHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHROMOSOME-ASSOCIATED KINESIN KIF4
publication title Structural Basis for the ATP-Induced Isomerization of Kinesin.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 113
structure length 337
sequence length 343
ec nomenclature ec 3.6.4.4: Transferred entry: 5.6.1.3.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3zfcA00
2OWMA 1VFXA 5LT2A 4ZHIA 4DBRA 3BFNA 1Q0BA 4H1GA 2G1QA 2X51A 5LT1A 3X2TA 4A14A 2KINA 4LNUK 1BG2A 2NCDA 4PJLA 3GBJA 1GOJA 3CJOA 3K5EA 3ZCWA 4E7SA 3HQDA 2GM1A 1SDMA 1D0XA 3B6UA 5LT3A 4PJNA 3WPNA 4AS7A 1CZ7A 2XAEA 4PJJA 1MMDA 4A51A 2FKYA 3ZFCA 3COBA 4GKRA 2X7DA 3ZFDA 1VFVA 1F9TA 3K3BA 2ZFJA 1F9WA 4B7BA 1II6A 2X2RA 1D1CA 1D0YA 3PXNA 1MMNA 1V8JA 2WOGA 4PFOA 4PFPA 2VASA 4FRZA 4E7ZA 4ETPA 1T5CA 1MMAA 1F9VA 1D1AA 2FL2A 3H4SA 4ANJA 4UBFA 2Q2ZA 1MMGA 1I5SA 1I6IA 4A28A 2UYIA 1KK7A 2V26A 4PK4A 1YRSA 2Y65A 1MNEA 2ZFLA 2FMEA 4BXNA 1VFWA 2XT3A 2Y5WA 3LREA 1G8XA 4AP0A 1FMWA 3L1CA 3B6VA 5LT0A 3WRDA 4PJMA 3KINA 5HLEA 2VVGA 1D1BA 3DCBA 4DBQA 3CNZA 2X7EA 4Y05A 1N6MA 3KARA 1VFZA 2ZFKA 4A5YA 1VOMA 2ZFMA 2GRYA 2IEHA 2ZFIA 4HNAK 1F9UA 3KENA 4BN2A 3L9HA 2Q2YA 3U06A 1D0ZA 3DC4A 2MYSA 4ZCAA 2VB6A 3NWNA 4A1ZA 4A50A 1BR1A 1V8KA 1LKXA 2FL6A 1BR2A 2UYMA 5GSZA 3T0QA 1MKJA 2HEHA 2X7CA 1BR4A 1RY6A 5LT4A 1FMVA 2PG2A 1X88A 1LVKA 4BBGA
chains in the Genus database with same CATH superfamily
2OWMA 1VFXA 5LT2A 4ZHIA 4DBRA 2O0AA 3BFNA 1Q0BA 4H1GA 2G1QA 2X51A 5LT1A 3X2TA 4A14A 2KINA 4LNUK 1BG2A 2NCDA 4PJLA 3GBJA 1GOJA 3CJOA 3K5EA 3ZCWA 4E7SA 3HQDA 2GM1A 1SDMA 1D0XA 3B6UA 5LT3A 4PJNA 3WPNA 4AS7A 1CZ7A 2XAEA 4PJJA 1MMDA 4A51A 2FKYA 3ZFCA 3COBA 4GKRA 2X7DA 3ZFDA 1VFVA 1F9TA 3K3BA 2ZFJA 1F9WA 4B7BA 1II6A 2X2RA 1D1CA 1D0YA 3PXNA 1MMNA 1V8JA 2WOGA 4PFOA 4PFPA 2VASA 4FRZA 4E7ZA 4ETPA 1T5CA 1MMAA 1F9VA 1D1AA 2FL2A 3H4SA 4ANJA 4UBFA 2Q2ZA 1MMGA 1I5SA 1I6IA 4A28A 2UYIA 1KK7A 2V26A 4PK4A 4GKPA 1YRSA 2Y65A 1MNEA 2ZFLA 2FMEA 4BXNA 1VFWA 2XT3A 2Y5WA 3LREA 1G8XA 4AP0A 1FMWA 3L1CA 3B6VA 5LT0A 3WRDA 4PJMA 3KINA 5HLEA 2VVGA 1D1BA 3DCBA 4DBQA 3CNZA 2X7EA 4Y05A 1N6MA 3KARA 4ETPB 1VFZA 2ZFKA 4A5YA 1VOMA 2ZFMA 2GRYA 2IEHA 2ZFIA 4HNAK 1F9UA 3KENA 4BN2A 3L9HA 2Q2YA 3U06A 1D0ZA 3DC4A 2MYSA 4ZCAA 2VB6A 3NWNA 4A1ZA 4A50A 1BR1A 4GKQA 1V8KA 1LKXA 2FL6A 1BR2A 2UYMA 5GSZA 3T0QA 1MKJA 2HEHA 2X7CA 1BR4A 1RY6A 5LT4A 1FMVA 2PG2A 1X88A 1LVKA 4BBGA
chains in the Genus database with same CATH topology
2OWMA 1VFXA 5LT2A 4ZHIA 4DBRA 3BFNA 1Q0BA 4H1GA 2G1QA 2X51A 5LT1A 3X2TA 4A14A 2KINA 4LNUK 1BG2A 2NCDA 4PJLA 3GBJA 1GOJA 3CJOA 3K5EA 3ZCWA 4E7SA 3HQDA 2GM1A 1SDMA 1D0XA 3B6UA 5LT3A 4PJNA 3WPNA 4AS7A 1CZ7A 2XAEA 4PJJA 1MMDA 4A51A 2FKYA 3ZFCA 3COBA 4GKRA 2X7DA 3ZFDA 1VFVA 1F9TA 3K3BA 2ZFJA 1F9WA 4B7BA 1II6A 2X2RA 1D1CA 1D0YA 3PXNA 1MMNA 1V8JA 2WOGA 4PFOA 4PFPA 2VASA 4FRZA 4E7ZA 4ETPA 1T5CA 1MMAA 1F9VA 1D1AA 2FL2A 3H4SA 4ANJA 4UBFA 2Q2ZA 1MMGA 1I5SA 1I6IA 4A28A 2UYIA 1KK7A 2V26A 4PK4A 1YRSA 2Y65A 1MNEA 2ZFLA 2FMEA 4BXNA 1VFWA 2XT3A 2Y5WA 3LREA 1G8XA 4AP0A 1FMWA 3L1CA 3B6VA 5LT0A 3WRDA 4PJMA 3KINA 5HLEA 2VVGA 1D1BA 3DCBA 4DBQA 3CNZA 2X7EA 4Y05A 1N6MA 3KARA 1VFZA 2ZFKA 4A5YA 1VOMA 2ZFMA 2GRYA 2IEHA 2ZFIA 4HNAK 1F9UA 3KENA 4BN2A 3L9HA 2Q2YA 3U06A 1D0ZA 3DC4A 2MYSA 4ZCAA 2VB6A 3NWNA 4A1ZA 4A50A 1BR1A 1V8KA 1LKXA 2FL6A 1BR2A 2UYMA 5GSZA 3T0QA 1MKJA 2HEHA 2X7CA 1BR4A 1RY6A 5LT4A 1FMVA 2PG2A 1X88A 1LVKA 4BBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OWM A;  1VFX A;  5LT2 A;  4ZHI A;  4DBR A;  3BFN A;  1Q0B A;  4H1G A;  2G1Q A;  2X51 A;  5LT1 A;  3X2T A;  4A14 A;  2KIN A;  4LNU K;  1BG2 A;  2NCD A;  4PJL A;  3GBJ A;  1GOJ A;  3CJO A;  3K5E A;  3ZCW A;  4E7S A;  3HQD A;  2GM1 A;  1SDM A;  1D0X A;  3B6U A;  5LT3 A;  4PJN A;  3WPN A;  4AS7 A;  1CZ7 A;  2XAE A;  4PJJ A;  1MMD A;  4A51 A;  2FKY A;  3ZFC A;  3COB A;  4GKR A;  2X7D A;  3ZFD A;  1VFV A;  1F9T A;  3K3B A;  2ZFJ A;  1F9W A;  4B7B A;  1II6 A;  2X2R A;  1D1C A;  1D0Y A;  3PXN A;  1MMN A;  1V8J A;  2WOG A;  4PFO A;  4PFP A;  2VAS A;  4FRZ A;  4E7Z A;  4ETP A;  1T5C A;  1MMA A;  1F9V A;  1D1A A;  2FL2 A;  3H4S A;  4ANJ A;  4UBF A;  2Q2Z A;  1MMG A;  1I5S A;  1I6I A;  4A28 A;  2UYI A;  1KK7 A;  2V26 A;  4PK4 A;  1YRS A;  2Y65 A;  1MNE A;  2ZFL A;  2FME A;  4BXN A;  1VFW A;  2XT3 A;  2Y5W A;  3LRE A;  1G8X A;  4AP0 A;  1FMW A;  3L1C A;  3B6V A;  5LT0 A;  3WRD A;  4PJM A;  3KIN A;  5HLE A;  2VVG A;  1D1B A;  3DCB A;  4DBQ A;  3CNZ A;  2X7E A;  4Y05 A;  1N6M A;  3KAR A;  1VFZ A;  2ZFK A;  4A5Y A;  1VOM A;  2ZFM A;  2GRY A;  2IEH A;  2ZFI A;  4HNA K;  1F9U A;  3KEN A;  4BN2 A;  3L9H A;  2Q2Y A;  3U06 A;  1D0Z A;  3DC4 A;  2MYS A;  4ZCA A;  2VB6 A;  3NWN A;  4A1Z A;  4A50 A;  1BR1 A;  1V8K A;  1LKX A;  2FL6 A;  1BR2 A;  2UYM A;  5GSZ A;  3T0Q A;  1MKJ A;  2HEH A;  2X7C A;  1BR4 A;  1RY6 A;  5LT4 A;  1FMV A;  2PG2 A;  1X88 A;  1LVK A;  4BBG A; 
#chains in the Genus database with same CATH topology
 2OWM A;  1VFX A;  5LT2 A;  4ZHI A;  4DBR A;  2O0A A;  3BFN A;  1Q0B A;  4H1G A;  2G1Q A;  2X51 A;  5LT1 A;  3X2T A;  4A14 A;  2KIN A;  4LNU K;  1BG2 A;  2NCD A;  4PJL A;  3GBJ A;  1GOJ A;  3CJO A;  3K5E A;  3ZCW A;  4E7S A;  3HQD A;  2GM1 A;  1SDM A;  1D0X A;  3B6U A;  5LT3 A;  4PJN A;  3WPN A;  4AS7 A;  1CZ7 A;  2XAE A;  4PJJ A;  1MMD A;  4A51 A;  2FKY A;  3ZFC A;  3COB A;  4GKR A;  2X7D A;  3ZFD A;  1VFV A;  1F9T A;  3K3B A;  2ZFJ A;  1F9W A;  4B7B A;  1II6 A;  2X2R A;  1D1C A;  1D0Y A;  3PXN A;  1MMN A;  1V8J A;  2WOG A;  4PFO A;  4PFP A;  2VAS A;  4FRZ A;  4E7Z A;  4ETP A;  1T5C A;  1MMA A;  1F9V A;  1D1A A;  2FL2 A;  3H4S A;  4ANJ A;  4UBF A;  2Q2Z A;  1MMG A;  1I5S A;  1I6I A;  4A28 A;  2UYI A;  1KK7 A;  2V26 A;  4PK4 A;  4GKP A;  1YRS A;  2Y65 A;  1MNE A;  2ZFL A;  2FME A;  4BXN A;  1VFW A;  2XT3 A;  2Y5W A;  3LRE A;  1G8X A;  4AP0 A;  1FMW A;  3L1C A;  3B6V A;  5LT0 A;  3WRD A;  4PJM A;  3KIN A;  5HLE A;  2VVG A;  1D1B A;  3DCB A;  4DBQ A;  3CNZ A;  2X7E A;  4Y05 A;  1N6M A;  3KAR A;  4ETP B;  1VFZ A;  2ZFK A;  4A5Y A;  1VOM A;  2ZFM A;  2GRY A;  2IEH A;  2ZFI A;  4HNA K;  1F9U A;  3KEN A;  4BN2 A;  3L9H A;  2Q2Y A;  3U06 A;  1D0Z A;  3DC4 A;  2MYS A;  4ZCA A;  2VB6 A;  3NWN A;  4A1Z A;  4A50 A;  1BR1 A;  4GKQ A;  1V8K A;  1LKX A;  2FL6 A;  1BR2 A;  2UYM A;  5GSZ A;  3T0Q A;  1MKJ A;  2HEH A;  2X7C A;  1BR4 A;  1RY6 A;  5LT4 A;  1FMV A;  2PG2 A;  1X88 A;  1LVK A;  4BBG A; 
#chains in the Genus database with same CATH homology
 2OWM A;  1VFX A;  5LT2 A;  4ZHI A;  4DBR A;  3BFN A;  1Q0B A;  4H1G A;  2G1Q A;  2X51 A;  5LT1 A;  3X2T A;  4A14 A;  2KIN A;  4LNU K;  1BG2 A;  2NCD A;  4PJL A;  3GBJ A;  1GOJ A;  3CJO A;  3K5E A;  3ZCW A;  4E7S A;  3HQD A;  2GM1 A;  1SDM A;  1D0X A;  3B6U A;  5LT3 A;  4PJN A;  3WPN A;  4AS7 A;  1CZ7 A;  2XAE A;  4PJJ A;  1MMD A;  4A51 A;  2FKY A;  3ZFC A;  3COB A;  4GKR A;  2X7D A;  3ZFD A;  1VFV A;  1F9T A;  3K3B A;  2ZFJ A;  1F9W A;  4B7B A;  1II6 A;  2X2R A;  1D1C A;  1D0Y A;  3PXN A;  1MMN A;  1V8J A;  2WOG A;  4PFO A;  4PFP A;  2VAS A;  4FRZ A;  4E7Z A;  4ETP A;  1T5C A;  1MMA A;  1F9V A;  1D1A A;  2FL2 A;  3H4S A;  4ANJ A;  4UBF A;  2Q2Z A;  1MMG A;  1I5S A;  1I6I A;  4A28 A;  2UYI A;  1KK7 A;  2V26 A;  4PK4 A;  1YRS A;  2Y65 A;  1MNE A;  2ZFL A;  2FME A;  4BXN A;  1VFW A;  2XT3 A;  2Y5W A;  3LRE A;  1G8X A;  4AP0 A;  1FMW A;  3L1C A;  3B6V A;  5LT0 A;  3WRD A;  4PJM A;  3KIN A;  5HLE A;  2VVG A;  1D1B A;  3DCB A;  4DBQ A;  3CNZ A;  2X7E A;  4Y05 A;  1N6M A;  3KAR A;  1VFZ A;  2ZFK A;  4A5Y A;  1VOM A;  2ZFM A;  2GRY A;  2IEH A;  2ZFI A;  4HNA K;  1F9U A;  3KEN A;  4BN2 A;  3L9H A;  2Q2Y A;  3U06 A;  1D0Z A;  3DC4 A;  2MYS A;  4ZCA A;  2VB6 A;  3NWN A;  4A1Z A;  4A50 A;  1BR1 A;  1V8K A;  1LKX A;  2FL6 A;  1BR2 A;  2UYM A;  5GSZ A;  3T0Q A;  1MKJ A;  2HEH A;  2X7C A;  1BR4 A;  1RY6 A;  5LT4 A;  1FMV A;  2PG2 A;  1X88 A;  1LVK A;  4BBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...