3PXNA

Crystal structure of the drosophila kinesin family member kin10/nod in complex with divalent manganese and adp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
321
structure length
291
Chain Sequence
AKLSAVRIAVREAPYRPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADLHHILELGTRNRRSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein Nod
publication title A metal switch for controlling the activity of molecular motor proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Motor protein
total genus 89
structure length 291
sequence length 321
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3pxnA00
3H4SA 2HEHA 2X7EA 4PJJA 2XT3A 1X88A 4AP0A 1F9WA 2Q2ZA 1VFXA 3NWNA 1F9UA 1V8JA 1VFVA 2IEHA 2ZFKA 4BXNA 1YRSA 2ZFJA 3CJOA 4PK4A 1MNEA 2FKYA 1MMNA 4PFPA 2VVGA 1MMDA 1BR2A 2NCDA 3KINA 2X2RA 3WRDA 4A14A 3X2TA 1BR1A 1N6MA 2WOGA 2XAEA 3LREA 5HLEA 4BBGA 1MMGA 2KINA 2X51A 3KENA 3PXNA 1I5SA 2MYSA 4ETPA 3K5EA 3WPNA 3ZCWA 4A1ZA 1D1CA 3T0QA 3HQDA 1GOJA 1FMWA 1Q0BA 2V26A 5LT1A 1LKXA 1V8KA 1D1AA 2Y65A 1VOMA 3L9HA 3KARA 2Y5WA 1F9TA 2UYIA 1MKJA 2ZFIA 2FL6A 3ZFDA 4PJLA 4ZCAA 4ZHIA 3K3BA 4A28A 1BG2A 4FRZA 5GSZA 3DCBA 1KK7A 3CNZA 2X7DA 4PJMA 4PFOA 1SDMA 5LT4A 3COBA 3BFNA 3B6UA 4HNAK 1MMAA 4A51A 4BN2A 4E7SA 2UYMA 3GBJA 1CZ7A 4PJNA 1II6A 4A5YA 4B7BA 2Q2YA 4Y05A 1T5CA 2G1QA 5LT3A 4H1GA 1D0YA 1RY6A 4A50A 5LT0A 2FL2A 1VFZA 3DC4A 1FMVA 1VFWA 1BR4A 3ZFCA 2FMEA 2ZFLA 4E7ZA 5LT2A 2VASA 2X7CA 4GKRA 3L1CA 4DBQA 2GRYA 2GM1A 1D0XA 1G8XA 2VB6A 1F9VA 1I6IA 2OWMA 2ZFMA 3B6VA 1D0ZA 1LVKA 4ANJA 4DBRA 4UBFA 3U06A 1D1BA 4LNUK 4AS7A 2PG2A
chains in the Genus database with same CATH superfamily
3H4SA 2HEHA 2X7EA 4PJJA 2XT3A 1X88A 4AP0A 1F9WA 2Q2ZA 1VFXA 3NWNA 1F9UA 1V8JA 1VFVA 2IEHA 2ZFKA 4BXNA 1YRSA 2ZFJA 3CJOA 4PK4A 1MNEA 2FKYA 1MMNA 4PFPA 2VVGA 1MMDA 1BR2A 2NCDA 3KINA 2X2RA 3WRDA 2O0AA 4A14A 3X2TA 1BR1A 1N6MA 2WOGA 2XAEA 3LREA 5HLEA 4BBGA 1MMGA 2KINA 2X51A 3KENA 3PXNA 1I5SA 2MYSA 4ETPA 3K5EA 3WPNA 3ZCWA 4A1ZA 1D1CA 3T0QA 3HQDA 1GOJA 1FMWA 1Q0BA 2V26A 5LT1A 1LKXA 1V8KA 1D1AA 2Y65A 1VOMA 3L9HA 3KARA 2Y5WA 1F9TA 2UYIA 1MKJA 2ZFIA 2FL6A 3ZFDA 4PJLA 4ZCAA 4ZHIA 3K3BA 4A28A 1BG2A 4FRZA 5GSZA 3DCBA 1KK7A 3CNZA 2X7DA 4PJMA 4PFOA 1SDMA 5LT4A 3COBA 3BFNA 3B6UA 4HNAK 1MMAA 4A51A 4BN2A 4E7SA 2UYMA 3GBJA 1CZ7A 4PJNA 1II6A 4A5YA 4B7BA 2Q2YA 4Y05A 1T5CA 2G1QA 5LT3A 4H1GA 1D0YA 1RY6A 4A50A 5LT0A 2FL2A 1VFZA 3DC4A 4GKQA 1FMVA 1VFWA 1BR4A 3ZFCA 2FMEA 2ZFLA 4E7ZA 4ETPB 5LT2A 2VASA 2X7CA 4GKPA 4GKRA 3L1CA 4DBQA 2GRYA 2GM1A 1D0XA 1G8XA 2VB6A 1F9VA 1I6IA 2OWMA 2ZFMA 3B6VA 1D0ZA 1LVKA 4ANJA 4DBRA 4UBFA 3U06A 1D1BA 4LNUK 4AS7A 2PG2A
chains in the Genus database with same CATH topology
3H4SA 2HEHA 2X7EA 4PJJA 2XT3A 1X88A 4AP0A 1F9WA 2Q2ZA 1VFXA 3NWNA 1F9UA 1V8JA 1VFVA 2IEHA 2ZFKA 4BXNA 1YRSA 2ZFJA 3CJOA 4PK4A 1MNEA 2FKYA 1MMNA 4PFPA 2VVGA 1MMDA 1BR2A 2NCDA 3KINA 2X2RA 3WRDA 4A14A 3X2TA 1BR1A 1N6MA 2WOGA 2XAEA 3LREA 5HLEA 4BBGA 1MMGA 2KINA 2X51A 3KENA 3PXNA 1I5SA 2MYSA 4ETPA 3K5EA 3WPNA 3ZCWA 4A1ZA 1D1CA 3T0QA 3HQDA 1GOJA 1FMWA 1Q0BA 2V26A 5LT1A 1LKXA 1V8KA 1D1AA 2Y65A 1VOMA 3L9HA 3KARA 2Y5WA 1F9TA 2UYIA 1MKJA 2ZFIA 2FL6A 3ZFDA 4PJLA 4ZCAA 4ZHIA 3K3BA 4A28A 1BG2A 4FRZA 5GSZA 3DCBA 1KK7A 3CNZA 2X7DA 4PJMA 4PFOA 1SDMA 5LT4A 3COBA 3BFNA 3B6UA 4HNAK 1MMAA 4A51A 4BN2A 4E7SA 2UYMA 3GBJA 1CZ7A 4PJNA 1II6A 4A5YA 4B7BA 2Q2YA 4Y05A 1T5CA 2G1QA 5LT3A 4H1GA 1D0YA 1RY6A 4A50A 5LT0A 2FL2A 1VFZA 3DC4A 1FMVA 1VFWA 1BR4A 3ZFCA 2FMEA 2ZFLA 4E7ZA 5LT2A 2VASA 2X7CA 4GKRA 3L1CA 4DBQA 2GRYA 2GM1A 1D0XA 1G8XA 2VB6A 1F9VA 1I6IA 2OWMA 2ZFMA 3B6VA 1D0ZA 1LVKA 4ANJA 4DBRA 4UBFA 3U06A 1D1BA 4LNUK 4AS7A 2PG2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H4S A;  2HEH A;  2X7E A;  4PJJ A;  2XT3 A;  1X88 A;  4AP0 A;  1F9W A;  2Q2Z A;  1VFX A;  3NWN A;  1F9U A;  1V8J A;  1VFV A;  2IEH A;  2ZFK A;  4BXN A;  1YRS A;  2ZFJ A;  3CJO A;  4PK4 A;  1MNE A;  2FKY A;  1MMN A;  4PFP A;  2VVG A;  1MMD A;  1BR2 A;  2NCD A;  3KIN A;  2X2R A;  3WRD A;  4A14 A;  3X2T A;  1BR1 A;  1N6M A;  2WOG A;  2XAE A;  3LRE A;  5HLE A;  4BBG A;  1MMG A;  2KIN A;  2X51 A;  3KEN A;  3PXN A;  1I5S A;  2MYS A;  4ETP A;  3K5E A;  3WPN A;  3ZCW A;  4A1Z A;  1D1C A;  3T0Q A;  3HQD A;  1GOJ A;  1FMW A;  1Q0B A;  2V26 A;  5LT1 A;  1LKX A;  1V8K A;  1D1A A;  2Y65 A;  1VOM A;  3L9H A;  3KAR A;  2Y5W A;  1F9T A;  2UYI A;  1MKJ A;  2ZFI A;  2FL6 A;  3ZFD A;  4PJL A;  4ZCA A;  4ZHI A;  3K3B A;  4A28 A;  1BG2 A;  4FRZ A;  5GSZ A;  3DCB A;  1KK7 A;  3CNZ A;  2X7D A;  4PJM A;  4PFO A;  1SDM A;  5LT4 A;  3COB A;  3BFN A;  3B6U A;  4HNA K;  1MMA A;  4A51 A;  4BN2 A;  4E7S A;  2UYM A;  3GBJ A;  1CZ7 A;  4PJN A;  1II6 A;  4A5Y A;  4B7B A;  2Q2Y A;  4Y05 A;  1T5C A;  2G1Q A;  5LT3 A;  4H1G A;  1D0Y A;  1RY6 A;  4A50 A;  5LT0 A;  2FL2 A;  1VFZ A;  3DC4 A;  1FMV A;  1VFW A;  1BR4 A;  3ZFC A;  2FME A;  2ZFL A;  4E7Z A;  5LT2 A;  2VAS A;  2X7C A;  4GKR A;  3L1C A;  4DBQ A;  2GRY A;  2GM1 A;  1D0X A;  1G8X A;  2VB6 A;  1F9V A;  1I6I A;  2OWM A;  2ZFM A;  3B6V A;  1D0Z A;  1LVK A;  4ANJ A;  4DBR A;  4UBF A;  3U06 A;  1D1B A;  4LNU K;  4AS7 A;  2PG2 A; 
#chains in the Genus database with same CATH topology
 3H4S A;  2HEH A;  2X7E A;  4PJJ A;  2XT3 A;  1X88 A;  4AP0 A;  1F9W A;  2Q2Z A;  1VFX A;  3NWN A;  1F9U A;  1V8J A;  1VFV A;  2IEH A;  2ZFK A;  4BXN A;  1YRS A;  2ZFJ A;  3CJO A;  4PK4 A;  1MNE A;  2FKY A;  1MMN A;  4PFP A;  2VVG A;  1MMD A;  1BR2 A;  2NCD A;  3KIN A;  2X2R A;  3WRD A;  2O0A A;  4A14 A;  3X2T A;  1BR1 A;  1N6M A;  2WOG A;  2XAE A;  3LRE A;  5HLE A;  4BBG A;  1MMG A;  2KIN A;  2X51 A;  3KEN A;  3PXN A;  1I5S A;  2MYS A;  4ETP A;  3K5E A;  3WPN A;  3ZCW A;  4A1Z A;  1D1C A;  3T0Q A;  3HQD A;  1GOJ A;  1FMW A;  1Q0B A;  2V26 A;  5LT1 A;  1LKX A;  1V8K A;  1D1A A;  2Y65 A;  1VOM A;  3L9H A;  3KAR A;  2Y5W A;  1F9T A;  2UYI A;  1MKJ A;  2ZFI A;  2FL6 A;  3ZFD A;  4PJL A;  4ZCA A;  4ZHI A;  3K3B A;  4A28 A;  1BG2 A;  4FRZ A;  5GSZ A;  3DCB A;  1KK7 A;  3CNZ A;  2X7D A;  4PJM A;  4PFO A;  1SDM A;  5LT4 A;  3COB A;  3BFN A;  3B6U A;  4HNA K;  1MMA A;  4A51 A;  4BN2 A;  4E7S A;  2UYM A;  3GBJ A;  1CZ7 A;  4PJN A;  1II6 A;  4A5Y A;  4B7B A;  2Q2Y A;  4Y05 A;  1T5C A;  2G1Q A;  5LT3 A;  4H1G A;  1D0Y A;  1RY6 A;  4A50 A;  5LT0 A;  2FL2 A;  1VFZ A;  3DC4 A;  4GKQ A;  1FMV A;  1VFW A;  1BR4 A;  3ZFC A;  2FME A;  2ZFL A;  4E7Z A;  4ETP B;  5LT2 A;  2VAS A;  2X7C A;  4GKP A;  4GKR A;  3L1C A;  4DBQ A;  2GRY A;  2GM1 A;  1D0X A;  1G8X A;  2VB6 A;  1F9V A;  1I6I A;  2OWM A;  2ZFM A;  3B6V A;  1D0Z A;  1LVK A;  4ANJ A;  4DBR A;  4UBF A;  3U06 A;  1D1B A;  4LNU K;  4AS7 A;  2PG2 A; 
#chains in the Genus database with same CATH homology
 3H4S A;  2HEH A;  2X7E A;  4PJJ A;  2XT3 A;  1X88 A;  4AP0 A;  1F9W A;  2Q2Z A;  1VFX A;  3NWN A;  1F9U A;  1V8J A;  1VFV A;  2IEH A;  2ZFK A;  4BXN A;  1YRS A;  2ZFJ A;  3CJO A;  4PK4 A;  1MNE A;  2FKY A;  1MMN A;  4PFP A;  2VVG A;  1MMD A;  1BR2 A;  2NCD A;  3KIN A;  2X2R A;  3WRD A;  4A14 A;  3X2T A;  1BR1 A;  1N6M A;  2WOG A;  2XAE A;  3LRE A;  5HLE A;  4BBG A;  1MMG A;  2KIN A;  2X51 A;  3KEN A;  3PXN A;  1I5S A;  2MYS A;  4ETP A;  3K5E A;  3WPN A;  3ZCW A;  4A1Z A;  1D1C A;  3T0Q A;  3HQD A;  1GOJ A;  1FMW A;  1Q0B A;  2V26 A;  5LT1 A;  1LKX A;  1V8K A;  1D1A A;  2Y65 A;  1VOM A;  3L9H A;  3KAR A;  2Y5W A;  1F9T A;  2UYI A;  1MKJ A;  2ZFI A;  2FL6 A;  3ZFD A;  4PJL A;  4ZCA A;  4ZHI A;  3K3B A;  4A28 A;  1BG2 A;  4FRZ A;  5GSZ A;  3DCB A;  1KK7 A;  3CNZ A;  2X7D A;  4PJM A;  4PFO A;  1SDM A;  5LT4 A;  3COB A;  3BFN A;  3B6U A;  4HNA K;  1MMA A;  4A51 A;  4BN2 A;  4E7S A;  2UYM A;  3GBJ A;  1CZ7 A;  4PJN A;  1II6 A;  4A5Y A;  4B7B A;  2Q2Y A;  4Y05 A;  1T5C A;  2G1Q A;  5LT3 A;  4H1G A;  1D0Y A;  1RY6 A;  4A50 A;  5LT0 A;  2FL2 A;  1VFZ A;  3DC4 A;  1FMV A;  1VFW A;  1BR4 A;  3ZFC A;  2FME A;  2ZFL A;  4E7Z A;  5LT2 A;  2VAS A;  2X7C A;  4GKR A;  3L1C A;  4DBQ A;  2GRY A;  2GM1 A;  1D0X A;  1G8X A;  2VB6 A;  1F9V A;  1I6I A;  2OWM A;  2ZFM A;  3B6V A;  1D0Z A;  1LVK A;  4ANJ A;  4DBR A;  4UBF A;  3U06 A;  1D1B A;  4LNU K;  4AS7 A;  2PG2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...