3PXNA

Crystal structure of the drosophila kinesin family member kin10/nod in complex with divalent manganese and adp
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
321
structure length
291
Chain Sequence
b'AKLSAVRIAVREAPYRPSVVQFPPWSDGKSLIVDQNEFHFDHAFPATISQDEMYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTARQENNKDAIQVYASFIEIYNEKPFDLLGSTPHMPMVAARCQRCTCLPLHSQADLHHILELGTRNRRSRSHAIVTIHVKSKTHHSRMNIVDLAGSEGVVNINLGLLSINKVVMSMAAGHTVIPYRDSVLTTVLQASLTAQSYLTFLACISPHQCDLSETLSTLRFGTSAKKLRLEH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kinesin-like protein Nod
publication title A metal switch for controlling the activity of molecular motor proteins.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Motor protein
total genus 89
structure length 291
sequence length 321
ec nomenclature
pdb deposition date 2010-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3pxnA00
1D1AA 1T5CA 4HNAK 4BN2A 1D1CA 4A14A 3KINA 1MKJA 1MMAA 2ZFJA 4A51A 2MYSA 3ZCWA 1F9UA 2ZFMA 3DCBA 1F9VA 4DBQA 2UYIA 5LT1A 4PFPA 2G1QA 1GOJA 1F9TA 4H1GA 2HEHA 1BR4A 1D0ZA 2VB6A 4E7SA 3KARA 3ZFDA 4AS7A 4PJJA 1VFVA 2X7EA 1X88A 3K5EA 3LREA 4PJNA 4ZHIA 4A50A 3CJOA 1BR2A 3L9HA 1D0XA 2GRYA 4LNUK 4PFOA 2FL2A 5HLEA 4A1ZA 1LVKA 5LT0A 1LKXA 1MMDA 2X2RA 1KK7A 5LT4A 4UBFA 2Y65A 4AP0A 4PK4A 1YRSA 2X7CA 2XT3A 2KINA 1D1BA 2ZFKA 1G8XA 1CZ7A 1VOMA 4PJLA 1V8KA 4E7ZA 2IEHA 1I5SA 3BFNA 3K3BA 2FL6A 3CNZA 2FMEA 3WPNA 1Q0BA 1BG2A 2Q2YA 2GM1A 4A28A 2Y5WA 2Q2ZA 1F9WA 3COBA 3B6UA 2UYMA 3U06A 4ZCAA 3ZFCA 2VVGA 3T0QA 1FMVA 4B7BA 4PJMA 3GBJA 2X7DA 2OWMA 2V26A 3DC4A 5LT2A 3KENA 3WRDA 1D0YA 1VFWA 2VASA 3B6VA 5GSZA 4A5YA 3L1CA 1FMWA 2ZFLA 1SDMA 1II6A 2PG2A 4DBRA 2X51A 1I6IA 1VFZA 1MNEA 1MMGA 2XAEA 2WOGA 4ANJA 5LT3A 3PXNA 2NCDA 1N6MA 1RY6A 4BXNA 4GKRA 2ZFIA 3X2TA 1MMNA 3NWNA 4Y05A 3H4SA 1VFXA 4BBGA 1V8JA 4ETPA 2FKYA 3HQDA 1BR1A 4FRZA
chains in the Genus database with same CATH superfamily
1D1AA 1T5CA 4HNAK 4GKPA 4BN2A 1D1CA 4A14A 3KINA 1MKJA 1MMAA 2ZFJA 4A51A 2MYSA 4GKQA 3ZCWA 1F9UA 2ZFMA 3DCBA 1F9VA 4DBQA 2UYIA 5LT1A 2O0AA 2G1QA 4PFPA 1GOJA 1F9TA 4H1GA 2HEHA 1BR4A 1D0ZA 2VB6A 4E7SA 3KARA 3ZFDA 4AS7A 4PJJA 1VFVA 2X7EA 1X88A 3K5EA 3LREA 4PJNA 4ZHIA 4A50A 3CJOA 1BR2A 3L9HA 1D0XA 2GRYA 4LNUK 4PFOA 2FL2A 5HLEA 4A1ZA 1LVKA 5LT0A 1LKXA 1MMDA 2X2RA 1KK7A 5LT4A 4UBFA 2Y65A 4AP0A 4PK4A 1YRSA 2X7CA 2XT3A 2KINA 1D1BA 2ZFKA 1G8XA 1CZ7A 1VOMA 4PJLA 1V8KA 4E7ZA 2IEHA 1I5SA 3BFNA 3K3BA 2FL6A 3CNZA 2FMEA 3WPNA 1Q0BA 1BG2A 2Q2YA 2GM1A 4A28A 2Y5WA 2Q2ZA 1F9WA 3COBA 3B6UA 2UYMA 3U06A 4ZCAA 3ZFCA 2VVGA 3T0QA 1FMVA 4B7BA 4PJMA 3GBJA 2X7DA 2OWMA 2V26A 3DC4A 5LT2A 3KENA 3WRDA 1D0YA 1VFWA 2VASA 3B6VA 4ETPB 5GSZA 4A5YA 3L1CA 1FMWA 2ZFLA 1SDMA 1II6A 2PG2A 4DBRA 2X51A 1I6IA 1VFZA 1MNEA 1MMGA 2XAEA 2WOGA 4ANJA 5LT3A 3PXNA 2NCDA 1N6MA 1RY6A 4BXNA 4GKRA 2ZFIA 3X2TA 1MMNA 3NWNA 4Y05A 3H4SA 1VFXA 4BBGA 1V8JA 4ETPA 2FKYA 3HQDA 1BR1A 4FRZA
chains in the Genus database with same CATH topology
1D1AA 1T5CA 4HNAK 4BN2A 1D1CA 4A14A 3KINA 1MKJA 1MMAA 2ZFJA 4A51A 2MYSA 3ZCWA 1F9UA 2ZFMA 3DCBA 1F9VA 4DBQA 2UYIA 5LT1A 4PFPA 2G1QA 1GOJA 1F9TA 4H1GA 2HEHA 1BR4A 1D0ZA 2VB6A 4E7SA 3KARA 3ZFDA 4AS7A 4PJJA 1VFVA 2X7EA 1X88A 3K5EA 3LREA 4PJNA 4ZHIA 4A50A 3CJOA 1BR2A 3L9HA 1D0XA 2GRYA 4LNUK 4PFOA 2FL2A 5HLEA 4A1ZA 1LVKA 5LT0A 1LKXA 1MMDA 2X2RA 1KK7A 5LT4A 4UBFA 2Y65A 4AP0A 4PK4A 1YRSA 2X7CA 2XT3A 2KINA 1D1BA 2ZFKA 1G8XA 1CZ7A 1VOMA 4PJLA 1V8KA 4E7ZA 2IEHA 1I5SA 3BFNA 3K3BA 2FL6A 3CNZA 2FMEA 3WPNA 1Q0BA 1BG2A 2Q2YA 2GM1A 4A28A 2Y5WA 2Q2ZA 1F9WA 3COBA 3B6UA 2UYMA 3U06A 4ZCAA 3ZFCA 2VVGA 3T0QA 1FMVA 4B7BA 4PJMA 3GBJA 2X7DA 2OWMA 2V26A 3DC4A 5LT2A 3KENA 3WRDA 1D0YA 1VFWA 2VASA 3B6VA 5GSZA 4A5YA 3L1CA 1FMWA 2ZFLA 1SDMA 1II6A 2PG2A 4DBRA 2X51A 1I6IA 1VFZA 1MNEA 1MMGA 2XAEA 2WOGA 4ANJA 5LT3A 3PXNA 2NCDA 1N6MA 1RY6A 4BXNA 4GKRA 2ZFIA 3X2TA 1MMNA 3NWNA 4Y05A 3H4SA 1VFXA 4BBGA 1V8JA 4ETPA 2FKYA 3HQDA 1BR1A 4FRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1A A;  1T5C A;  4HNA K;  4BN2 A;  1D1C A;  4A14 A;  3KIN A;  1MKJ A;  1MMA A;  2ZFJ A;  4A51 A;  2MYS A;  3ZCW A;  1F9U A;  2ZFM A;  3DCB A;  1F9V A;  4DBQ A;  2UYI A;  5LT1 A;  4PFP A;  2G1Q A;  1GOJ A;  1F9T A;  4H1G A;  2HEH A;  1BR4 A;  1D0Z A;  2VB6 A;  4E7S A;  3KAR A;  3ZFD A;  4AS7 A;  4PJJ A;  1VFV A;  2X7E A;  1X88 A;  3K5E A;  3LRE A;  4PJN A;  4ZHI A;  4A50 A;  3CJO A;  1BR2 A;  3L9H A;  1D0X A;  2GRY A;  4LNU K;  4PFO A;  2FL2 A;  5HLE A;  4A1Z A;  1LVK A;  5LT0 A;  1LKX A;  1MMD A;  2X2R A;  1KK7 A;  5LT4 A;  4UBF A;  2Y65 A;  4AP0 A;  4PK4 A;  1YRS A;  2X7C A;  2XT3 A;  2KIN A;  1D1B A;  2ZFK A;  1G8X A;  1CZ7 A;  1VOM A;  4PJL A;  1V8K A;  4E7Z A;  2IEH A;  1I5S A;  3BFN A;  3K3B A;  2FL6 A;  3CNZ A;  2FME A;  3WPN A;  1Q0B A;  1BG2 A;  2Q2Y A;  2GM1 A;  4A28 A;  2Y5W A;  2Q2Z A;  1F9W A;  3COB A;  3B6U A;  2UYM A;  3U06 A;  4ZCA A;  3ZFC A;  2VVG A;  3T0Q A;  1FMV A;  4B7B A;  4PJM A;  3GBJ A;  2X7D A;  2OWM A;  2V26 A;  3DC4 A;  5LT2 A;  3KEN A;  3WRD A;  1D0Y A;  1VFW A;  2VAS A;  3B6V A;  5GSZ A;  4A5Y A;  3L1C A;  1FMW A;  2ZFL A;  1SDM A;  1II6 A;  2PG2 A;  4DBR A;  2X51 A;  1I6I A;  1VFZ A;  1MNE A;  1MMG A;  2XAE A;  2WOG A;  4ANJ A;  5LT3 A;  3PXN A;  2NCD A;  1N6M A;  1RY6 A;  4BXN A;  4GKR A;  2ZFI A;  3X2T A;  1MMN A;  3NWN A;  4Y05 A;  3H4S A;  1VFX A;  4BBG A;  1V8J A;  4ETP A;  2FKY A;  3HQD A;  1BR1 A;  4FRZ A; 
#chains in the Genus database with same CATH topology
 1D1A A;  1T5C A;  4HNA K;  4GKP A;  4BN2 A;  1D1C A;  4A14 A;  3KIN A;  1MKJ A;  1MMA A;  2ZFJ A;  4A51 A;  2MYS A;  4GKQ A;  3ZCW A;  1F9U A;  2ZFM A;  3DCB A;  1F9V A;  4DBQ A;  2UYI A;  5LT1 A;  2O0A A;  2G1Q A;  4PFP A;  1GOJ A;  1F9T A;  4H1G A;  2HEH A;  1BR4 A;  1D0Z A;  2VB6 A;  4E7S A;  3KAR A;  3ZFD A;  4AS7 A;  4PJJ A;  1VFV A;  2X7E A;  1X88 A;  3K5E A;  3LRE A;  4PJN A;  4ZHI A;  4A50 A;  3CJO A;  1BR2 A;  3L9H A;  1D0X A;  2GRY A;  4LNU K;  4PFO A;  2FL2 A;  5HLE A;  4A1Z A;  1LVK A;  5LT0 A;  1LKX A;  1MMD A;  2X2R A;  1KK7 A;  5LT4 A;  4UBF A;  2Y65 A;  4AP0 A;  4PK4 A;  1YRS A;  2X7C A;  2XT3 A;  2KIN A;  1D1B A;  2ZFK A;  1G8X A;  1CZ7 A;  1VOM A;  4PJL A;  1V8K A;  4E7Z A;  2IEH A;  1I5S A;  3BFN A;  3K3B A;  2FL6 A;  3CNZ A;  2FME A;  3WPN A;  1Q0B A;  1BG2 A;  2Q2Y A;  2GM1 A;  4A28 A;  2Y5W A;  2Q2Z A;  1F9W A;  3COB A;  3B6U A;  2UYM A;  3U06 A;  4ZCA A;  3ZFC A;  2VVG A;  3T0Q A;  1FMV A;  4B7B A;  4PJM A;  3GBJ A;  2X7D A;  2OWM A;  2V26 A;  3DC4 A;  5LT2 A;  3KEN A;  3WRD A;  1D0Y A;  1VFW A;  2VAS A;  3B6V A;  4ETP B;  5GSZ A;  4A5Y A;  3L1C A;  1FMW A;  2ZFL A;  1SDM A;  1II6 A;  2PG2 A;  4DBR A;  2X51 A;  1I6I A;  1VFZ A;  1MNE A;  1MMG A;  2XAE A;  2WOG A;  4ANJ A;  5LT3 A;  3PXN A;  2NCD A;  1N6M A;  1RY6 A;  4BXN A;  4GKR A;  2ZFI A;  3X2T A;  1MMN A;  3NWN A;  4Y05 A;  3H4S A;  1VFX A;  4BBG A;  1V8J A;  4ETP A;  2FKY A;  3HQD A;  1BR1 A;  4FRZ A; 
#chains in the Genus database with same CATH homology
 1D1A A;  1T5C A;  4HNA K;  4BN2 A;  1D1C A;  4A14 A;  3KIN A;  1MKJ A;  1MMA A;  2ZFJ A;  4A51 A;  2MYS A;  3ZCW A;  1F9U A;  2ZFM A;  3DCB A;  1F9V A;  4DBQ A;  2UYI A;  5LT1 A;  4PFP A;  2G1Q A;  1GOJ A;  1F9T A;  4H1G A;  2HEH A;  1BR4 A;  1D0Z A;  2VB6 A;  4E7S A;  3KAR A;  3ZFD A;  4AS7 A;  4PJJ A;  1VFV A;  2X7E A;  1X88 A;  3K5E A;  3LRE A;  4PJN A;  4ZHI A;  4A50 A;  3CJO A;  1BR2 A;  3L9H A;  1D0X A;  2GRY A;  4LNU K;  4PFO A;  2FL2 A;  5HLE A;  4A1Z A;  1LVK A;  5LT0 A;  1LKX A;  1MMD A;  2X2R A;  1KK7 A;  5LT4 A;  4UBF A;  2Y65 A;  4AP0 A;  4PK4 A;  1YRS A;  2X7C A;  2XT3 A;  2KIN A;  1D1B A;  2ZFK A;  1G8X A;  1CZ7 A;  1VOM A;  4PJL A;  1V8K A;  4E7Z A;  2IEH A;  1I5S A;  3BFN A;  3K3B A;  2FL6 A;  3CNZ A;  2FME A;  3WPN A;  1Q0B A;  1BG2 A;  2Q2Y A;  2GM1 A;  4A28 A;  2Y5W A;  2Q2Z A;  1F9W A;  3COB A;  3B6U A;  2UYM A;  3U06 A;  4ZCA A;  3ZFC A;  2VVG A;  3T0Q A;  1FMV A;  4B7B A;  4PJM A;  3GBJ A;  2X7D A;  2OWM A;  2V26 A;  3DC4 A;  5LT2 A;  3KEN A;  3WRD A;  1D0Y A;  1VFW A;  2VAS A;  3B6V A;  5GSZ A;  4A5Y A;  3L1C A;  1FMW A;  2ZFL A;  1SDM A;  1II6 A;  2PG2 A;  4DBR A;  2X51 A;  1I6I A;  1VFZ A;  1MNE A;  1MMG A;  2XAE A;  2WOG A;  4ANJ A;  5LT3 A;  3PXN A;  2NCD A;  1N6M A;  1RY6 A;  4BXN A;  4GKR A;  2ZFI A;  3X2T A;  1MMN A;  3NWN A;  4Y05 A;  3H4S A;  1VFX A;  4BBG A;  1V8J A;  4ETP A;  2FKY A;  3HQD A;  1BR1 A;  4FRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...