3KINA

Kinesin (dimeric) from rattus norvegicus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
238
structure length
238
Chain Sequence
b'ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN HEAVY CHAIN
publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 57
structure length 238
sequence length 238
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3kinA00
4A1ZA 2UYMA 2VVGA 4A28A 1D0ZA 5LT3A 4HNAK 3DCBA 5LT0A 1MMGA 2WOGA 4PK4A 4A14A 1I5SA 3KINA 1CZ7A 4PJLA 3B6VA 3BFNA 1KK7A 5LT1A 2FMEA 2VB6A 4A5YA 3K5EA 3LREA 4A51A 1BG2A 1VFXA 2MYSA 2NCDA 4A50A 3B6UA 4H1GA 2ZFIA 1VFWA 1G8XA 1VFVA 5LT4A 4E7ZA 4BXNA 2G1QA 2PG2A 3DC4A 4FRZA 4ZCAA 1N6MA 3T0QA 1RY6A 2ZFJA 2ZFLA 2HEHA 1V8KA 4Y05A 2OWMA 3H4SA 2KINA 1SDMA 1X88A 2FKYA 4B7BA 3L9HA 3ZCWA 5GSZA 1D1BA 3X2TA 1D1CA 1D0YA 4ETPA 3CNZA 1F9TA 2UYIA 1VOMA 1VFZA 4ZHIA 4AP0A 1BR2A 1F9VA 4UBFA 1LKXA 1YRSA 3GBJA 3ZFCA 1MMNA 3L1CA 3CJOA 1D0XA 2XAEA 4DBRA 4AS7A 3U06A 3KARA 3HQDA 1MNEA 3WRDA 2IEHA 4E7SA 2X7DA 1GOJA 2X7EA 4GKRA 1FMWA 2Q2YA 4PFPA 1FMVA 1T5CA 5LT2A 1BR4A 2X51A 1II6A 1D1AA 2X2RA 1I6IA 3KENA 4DBQA 1MKJA 1LVKA 4LNUK 3ZFDA 2GM1A 1V8JA 2Q2ZA 2GRYA 3COBA 2ZFMA 2XT3A 2ZFKA 1F9UA 2X7CA 1BR1A 4BBGA 2V26A 1MMAA 3WPNA 2FL2A 1F9WA 4BN2A 4PJJA 2VASA 3K3BA 1MMDA 1Q0BA 3NWNA 4PJNA 4PFOA 4ANJA 5HLEA 3PXNA 2Y65A 2FL6A 4PJMA 2Y5WA
chains in the Genus database with same CATH superfamily
4A1ZA 2UYMA 2VVGA 4A28A 1D0ZA 5LT3A 4HNAK 3DCBA 5LT0A 1MMGA 2WOGA 4PK4A 4A14A 1I5SA 3KINA 1CZ7A 4PJLA 3B6VA 3BFNA 1KK7A 5LT1A 2FMEA 2VB6A 4A5YA 3K5EA 3LREA 4A51A 1BG2A 1VFXA 2MYSA 2NCDA 4A50A 3B6UA 4H1GA 2ZFIA 1VFWA 1G8XA 1VFVA 4ETPB 5LT4A 4E7ZA 4BXNA 2G1QA 2PG2A 3DC4A 4FRZA 4ZCAA 1N6MA 3T0QA 1RY6A 2ZFJA 2ZFLA 2HEHA 1V8KA 4Y05A 2OWMA 3H4SA 2KINA 1SDMA 1X88A 2FKYA 4B7BA 3L9HA 3ZCWA 5GSZA 1D1BA 3X2TA 1D1CA 1D0YA 4ETPA 3CNZA 1F9TA 2UYIA 1VOMA 1VFZA 4ZHIA 4AP0A 1BR2A 1F9VA 4UBFA 1LKXA 1YRSA 3GBJA 3ZFCA 1MMNA 3L1CA 3CJOA 1D0XA 2XAEA 4DBRA 4AS7A 4GKPA 3U06A 3KARA 3HQDA 1MNEA 3WRDA 2IEHA 4E7SA 2X7DA 1GOJA 2X7EA 4GKRA 1FMWA 2Q2YA 4PFPA 1FMVA 1T5CA 5LT2A 1BR4A 2X51A 1II6A 1D1AA 2X2RA 1I6IA 3KENA 4DBQA 1MKJA 1LVKA 4LNUK 3ZFDA 2GM1A 1V8JA 2Q2ZA 2GRYA 3COBA 2ZFMA 2XT3A 2ZFKA 1F9UA 2X7CA 1BR1A 4BBGA 2V26A 1MMAA 3WPNA 2O0AA 2FL2A 1F9WA 4BN2A 4GKQA 4PJJA 2VASA 3K3BA 1MMDA 1Q0BA 3NWNA 4PJNA 4PFOA 4ANJA 5HLEA 3PXNA 2Y65A 2FL6A 4PJMA 2Y5WA
chains in the Genus database with same CATH topology
4A1ZA 2UYMA 2VVGA 4A28A 1D0ZA 5LT3A 4HNAK 3DCBA 5LT0A 1MMGA 2WOGA 4PK4A 4A14A 1I5SA 3KINA 1CZ7A 4PJLA 3B6VA 3BFNA 1KK7A 5LT1A 2FMEA 2VB6A 4A5YA 3K5EA 3LREA 4A51A 1BG2A 1VFXA 2MYSA 2NCDA 4A50A 3B6UA 4H1GA 2ZFIA 1VFWA 1G8XA 1VFVA 5LT4A 4E7ZA 4BXNA 2G1QA 2PG2A 3DC4A 4FRZA 4ZCAA 1N6MA 3T0QA 1RY6A 2ZFJA 2ZFLA 2HEHA 1V8KA 4Y05A 2OWMA 3H4SA 2KINA 1SDMA 1X88A 2FKYA 4B7BA 3L9HA 3ZCWA 5GSZA 1D1BA 3X2TA 1D1CA 1D0YA 4ETPA 3CNZA 1F9TA 2UYIA 1VOMA 1VFZA 4ZHIA 4AP0A 1BR2A 1F9VA 4UBFA 1LKXA 1YRSA 3GBJA 3ZFCA 1MMNA 3L1CA 3CJOA 1D0XA 2XAEA 4DBRA 4AS7A 3U06A 3KARA 3HQDA 1MNEA 3WRDA 2IEHA 4E7SA 2X7DA 1GOJA 2X7EA 4GKRA 1FMWA 2Q2YA 4PFPA 1FMVA 1T5CA 5LT2A 1BR4A 2X51A 1II6A 1D1AA 2X2RA 1I6IA 3KENA 4DBQA 1MKJA 1LVKA 4LNUK 3ZFDA 2GM1A 1V8JA 2Q2ZA 2GRYA 3COBA 2ZFMA 2XT3A 2ZFKA 1F9UA 2X7CA 1BR1A 4BBGA 2V26A 1MMAA 3WPNA 2FL2A 1F9WA 4BN2A 4PJJA 2VASA 3K3BA 1MMDA 1Q0BA 3NWNA 4PJNA 4PFOA 4ANJA 5HLEA 3PXNA 2Y65A 2FL6A 4PJMA 2Y5WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A1Z A;  2UYM A;  2VVG A;  4A28 A;  1D0Z A;  5LT3 A;  4HNA K;  3DCB A;  5LT0 A;  1MMG A;  2WOG A;  4PK4 A;  4A14 A;  1I5S A;  3KIN A;  1CZ7 A;  4PJL A;  3B6V A;  3BFN A;  1KK7 A;  5LT1 A;  2FME A;  2VB6 A;  4A5Y A;  3K5E A;  3LRE A;  4A51 A;  1BG2 A;  1VFX A;  2MYS A;  2NCD A;  4A50 A;  3B6U A;  4H1G A;  2ZFI A;  1VFW A;  1G8X A;  1VFV A;  5LT4 A;  4E7Z A;  4BXN A;  2G1Q A;  2PG2 A;  3DC4 A;  4FRZ A;  4ZCA A;  1N6M A;  3T0Q A;  1RY6 A;  2ZFJ A;  2ZFL A;  2HEH A;  1V8K A;  4Y05 A;  2OWM A;  3H4S A;  2KIN A;  1SDM A;  1X88 A;  2FKY A;  4B7B A;  3L9H A;  3ZCW A;  5GSZ A;  1D1B A;  3X2T A;  1D1C A;  1D0Y A;  4ETP A;  3CNZ A;  1F9T A;  2UYI A;  1VOM A;  1VFZ A;  4ZHI A;  4AP0 A;  1BR2 A;  1F9V A;  4UBF A;  1LKX A;  1YRS A;  3GBJ A;  3ZFC A;  1MMN A;  3L1C A;  3CJO A;  1D0X A;  2XAE A;  4DBR A;  4AS7 A;  3U06 A;  3KAR A;  3HQD A;  1MNE A;  3WRD A;  2IEH A;  4E7S A;  2X7D A;  1GOJ A;  2X7E A;  4GKR A;  1FMW A;  2Q2Y A;  4PFP A;  1FMV A;  1T5C A;  5LT2 A;  1BR4 A;  2X51 A;  1II6 A;  1D1A A;  2X2R A;  1I6I A;  3KEN A;  4DBQ A;  1MKJ A;  1LVK A;  4LNU K;  3ZFD A;  2GM1 A;  1V8J A;  2Q2Z A;  2GRY A;  3COB A;  2ZFM A;  2XT3 A;  2ZFK A;  1F9U A;  2X7C A;  1BR1 A;  4BBG A;  2V26 A;  1MMA A;  3WPN A;  2FL2 A;  1F9W A;  4BN2 A;  4PJJ A;  2VAS A;  3K3B A;  1MMD A;  1Q0B A;  3NWN A;  4PJN A;  4PFO A;  4ANJ A;  5HLE A;  3PXN A;  2Y65 A;  2FL6 A;  4PJM A;  2Y5W A; 
#chains in the Genus database with same CATH topology
 4A1Z A;  2UYM A;  2VVG A;  4A28 A;  1D0Z A;  5LT3 A;  4HNA K;  3DCB A;  5LT0 A;  1MMG A;  2WOG A;  4PK4 A;  4A14 A;  1I5S A;  3KIN A;  1CZ7 A;  4PJL A;  3B6V A;  3BFN A;  1KK7 A;  5LT1 A;  2FME A;  2VB6 A;  4A5Y A;  3K5E A;  3LRE A;  4A51 A;  1BG2 A;  1VFX A;  2MYS A;  2NCD A;  4A50 A;  3B6U A;  4H1G A;  2ZFI A;  1VFW A;  1G8X A;  1VFV A;  4ETP B;  5LT4 A;  4E7Z A;  4BXN A;  2G1Q A;  2PG2 A;  3DC4 A;  4FRZ A;  4ZCA A;  1N6M A;  3T0Q A;  1RY6 A;  2ZFJ A;  2ZFL A;  2HEH A;  1V8K A;  4Y05 A;  2OWM A;  3H4S A;  2KIN A;  1SDM A;  1X88 A;  2FKY A;  4B7B A;  3L9H A;  3ZCW A;  5GSZ A;  1D1B A;  3X2T A;  1D1C A;  1D0Y A;  4ETP A;  3CNZ A;  1F9T A;  2UYI A;  1VOM A;  1VFZ A;  4ZHI A;  4AP0 A;  1BR2 A;  1F9V A;  4UBF A;  1LKX A;  1YRS A;  3GBJ A;  3ZFC A;  1MMN A;  3L1C A;  3CJO A;  1D0X A;  2XAE A;  4DBR A;  4AS7 A;  4GKP A;  3U06 A;  3KAR A;  3HQD A;  1MNE A;  3WRD A;  2IEH A;  4E7S A;  2X7D A;  1GOJ A;  2X7E A;  4GKR A;  1FMW A;  2Q2Y A;  4PFP A;  1FMV A;  1T5C A;  5LT2 A;  1BR4 A;  2X51 A;  1II6 A;  1D1A A;  2X2R A;  1I6I A;  3KEN A;  4DBQ A;  1MKJ A;  1LVK A;  4LNU K;  3ZFD A;  2GM1 A;  1V8J A;  2Q2Z A;  2GRY A;  3COB A;  2ZFM A;  2XT3 A;  2ZFK A;  1F9U A;  2X7C A;  1BR1 A;  4BBG A;  2V26 A;  1MMA A;  3WPN A;  2O0A A;  2FL2 A;  1F9W A;  4BN2 A;  4GKQ A;  4PJJ A;  2VAS A;  3K3B A;  1MMD A;  1Q0B A;  3NWN A;  4PJN A;  4PFO A;  4ANJ A;  5HLE A;  3PXN A;  2Y65 A;  2FL6 A;  4PJM A;  2Y5W A; 
#chains in the Genus database with same CATH homology
 4A1Z A;  2UYM A;  2VVG A;  4A28 A;  1D0Z A;  5LT3 A;  4HNA K;  3DCB A;  5LT0 A;  1MMG A;  2WOG A;  4PK4 A;  4A14 A;  1I5S A;  3KIN A;  1CZ7 A;  4PJL A;  3B6V A;  3BFN A;  1KK7 A;  5LT1 A;  2FME A;  2VB6 A;  4A5Y A;  3K5E A;  3LRE A;  4A51 A;  1BG2 A;  1VFX A;  2MYS A;  2NCD A;  4A50 A;  3B6U A;  4H1G A;  2ZFI A;  1VFW A;  1G8X A;  1VFV A;  5LT4 A;  4E7Z A;  4BXN A;  2G1Q A;  2PG2 A;  3DC4 A;  4FRZ A;  4ZCA A;  1N6M A;  3T0Q A;  1RY6 A;  2ZFJ A;  2ZFL A;  2HEH A;  1V8K A;  4Y05 A;  2OWM A;  3H4S A;  2KIN A;  1SDM A;  1X88 A;  2FKY A;  4B7B A;  3L9H A;  3ZCW A;  5GSZ A;  1D1B A;  3X2T A;  1D1C A;  1D0Y A;  4ETP A;  3CNZ A;  1F9T A;  2UYI A;  1VOM A;  1VFZ A;  4ZHI A;  4AP0 A;  1BR2 A;  1F9V A;  4UBF A;  1LKX A;  1YRS A;  3GBJ A;  3ZFC A;  1MMN A;  3L1C A;  3CJO A;  1D0X A;  2XAE A;  4DBR A;  4AS7 A;  3U06 A;  3KAR A;  3HQD A;  1MNE A;  3WRD A;  2IEH A;  4E7S A;  2X7D A;  1GOJ A;  2X7E A;  4GKR A;  1FMW A;  2Q2Y A;  4PFP A;  1FMV A;  1T5C A;  5LT2 A;  1BR4 A;  2X51 A;  1II6 A;  1D1A A;  2X2R A;  1I6I A;  3KEN A;  4DBQ A;  1MKJ A;  1LVK A;  4LNU K;  3ZFD A;  2GM1 A;  1V8J A;  2Q2Z A;  2GRY A;  3COB A;  2ZFM A;  2XT3 A;  2ZFK A;  1F9U A;  2X7C A;  1BR1 A;  4BBG A;  2V26 A;  1MMA A;  3WPN A;  2FL2 A;  1F9W A;  4BN2 A;  4PJJ A;  2VAS A;  3K3B A;  1MMD A;  1Q0B A;  3NWN A;  4PJN A;  4PFO A;  4ANJ A;  5HLE A;  3PXN A;  2Y65 A;  2FL6 A;  4PJM A;  2Y5W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...