3KINA

Kinesin (dimeric) from rattus norvegicus
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
238
structure length
238
Chain Sequence
ADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQEQVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHIYSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEVMDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KINESIN HEAVY CHAIN
publication title The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Motor protein
total genus 57
structure length 238
sequence length 238
chains with identical sequence C
ec nomenclature
pdb deposition date 1997-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00225 Kinesin Kinesin motor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.850.10 Alpha Beta 3-Layer(aba) Sandwich Kinesin Kinesin motor domain 3kinA00
1D0XA 4H1GA 1D1AA 5GSZA 3CJOA 4A14A 1F9WA 1Q0BA 2ZFMA 2X7DA 3B6VA 2Y5WA 5LT3A 5LT1A 4PJJA 1V8JA 1LKXA 2G1QA 4A28A 1MMDA 2V26A 2FKYA 4LNUK 4PK4A 2MYSA 3KINA 3K5EA 1D0YA 1N6MA 2FL2A 2UYIA 3WRDA 4DBRA 4PJLA 1MKJA 3T0QA 1MMGA 3U06A 3L9HA 1SDMA 3ZFCA 2OWMA 2X2RA 1F9VA 1LVKA 1MMAA 4UBFA 2GM1A 3BFNA 1D1BA 4AP0A 4BN2A 1BR1A 3KARA 1VFZA 2HEHA 1V8KA 3ZCWA 3NWNA 1II6A 3DCBA 5LT0A 3X2TA 2X7CA 2FL6A 2ZFIA 2WOGA 1VFXA 4PJMA 1RY6A 3GBJA 2VB6A 5HLEA 1FMVA 4E7ZA 3DC4A 2ZFKA 3HQDA 1CZ7A 1F9UA 4PFOA 1I5SA 3WPNA 1GOJA 2VVGA 1I6IA 2XAEA 4ETPA 1VFWA 4ANJA 4A51A 2X7EA 5LT4A 1X88A 4BBGA 2UYMA 4PFPA 1FMWA 1D1CA 4A5YA 1D0ZA 2XT3A 3KENA 1MNEA 4AS7A 4GKRA 1T5CA 2ZFLA 1VFVA 1BR2A 3L1CA 4A50A 4PJNA 3ZFDA 4BXNA 2FMEA 3CNZA 4HNAK 2ZFJA 1G8XA 2NCDA 2Y65A 1VOMA 2VASA 2GRYA 1YRSA 2KINA 5LT2A 4ZHIA 2Q2ZA 3COBA 1BG2A 4Y05A 4DBQA 4B7BA 2IEHA 4E7SA 3PXNA 3B6UA 4A1ZA 4ZCAA 2PG2A 1F9TA 3LREA 2Q2YA 1MMNA 4FRZA 2X51A 3H4SA 3K3BA 1KK7A 1BR4A
chains in the Genus database with same CATH superfamily
1D0XA 4H1GA 1D1AA 5GSZA 3CJOA 4A14A 1F9WA 1Q0BA 2ZFMA 2X7DA 3B6VA 2Y5WA 5LT3A 5LT1A 4PJJA 1V8JA 1LKXA 2G1QA 4A28A 1MMDA 2V26A 2FKYA 4LNUK 4PK4A 2MYSA 3KINA 3K5EA 1D0YA 1N6MA 2FL2A 2UYIA 3WRDA 4DBRA 4PJLA 1MKJA 3T0QA 1MMGA 3U06A 3L9HA 1SDMA 3ZFCA 2OWMA 2X2RA 1F9VA 1LVKA 1MMAA 4UBFA 2GM1A 3BFNA 2O0AA 1D1BA 4AP0A 4BN2A 1BR1A 3KARA 1VFZA 2HEHA 1V8KA 3ZCWA 3NWNA 1II6A 3DCBA 5LT0A 3X2TA 2X7CA 2FL6A 2ZFIA 2WOGA 1VFXA 4PJMA 1RY6A 3GBJA 2VB6A 5HLEA 1FMVA 4E7ZA 3DC4A 2ZFKA 3HQDA 1CZ7A 1F9UA 4PFOA 1I5SA 3WPNA 1GOJA 2VVGA 1I6IA 2XAEA 4ETPA 1VFWA 4ANJA 4GKQA 4A51A 2X7EA 5LT4A 1X88A 4BBGA 2UYMA 4PFPA 1FMWA 1D1CA 4A5YA 1D0ZA 2XT3A 3KENA 1MNEA 4AS7A 4GKRA 1T5CA 2ZFLA 1VFVA 1BR2A 3L1CA 4A50A 4PJNA 3ZFDA 4BXNA 2FMEA 3CNZA 4HNAK 2ZFJA 1G8XA 2NCDA 2Y65A 1VOMA 2VASA 2GRYA 1YRSA 2KINA 5LT2A 4ZHIA 2Q2ZA 4GKPA 3COBA 1BG2A 4Y05A 4DBQA 4B7BA 2IEHA 4E7SA 3PXNA 3B6UA 4A1ZA 4ZCAA 2PG2A 4ETPB 1F9TA 3LREA 2Q2YA 1MMNA 4FRZA 2X51A 3H4SA 3K3BA 1KK7A 1BR4A
chains in the Genus database with same CATH topology
1D0XA 4H1GA 1D1AA 5GSZA 3CJOA 4A14A 1F9WA 1Q0BA 2ZFMA 2X7DA 3B6VA 2Y5WA 5LT3A 5LT1A 4PJJA 1V8JA 1LKXA 2G1QA 4A28A 1MMDA 2V26A 2FKYA 4LNUK 4PK4A 2MYSA 3KINA 3K5EA 1D0YA 1N6MA 2FL2A 2UYIA 3WRDA 4DBRA 4PJLA 1MKJA 3T0QA 1MMGA 3U06A 3L9HA 1SDMA 3ZFCA 2OWMA 2X2RA 1F9VA 1LVKA 1MMAA 4UBFA 2GM1A 3BFNA 1D1BA 4AP0A 4BN2A 1BR1A 3KARA 1VFZA 2HEHA 1V8KA 3ZCWA 3NWNA 1II6A 3DCBA 5LT0A 3X2TA 2X7CA 2FL6A 2ZFIA 2WOGA 1VFXA 4PJMA 1RY6A 3GBJA 2VB6A 5HLEA 1FMVA 4E7ZA 3DC4A 2ZFKA 3HQDA 1CZ7A 1F9UA 4PFOA 1I5SA 3WPNA 1GOJA 2VVGA 1I6IA 2XAEA 4ETPA 1VFWA 4ANJA 4A51A 2X7EA 5LT4A 1X88A 4BBGA 2UYMA 4PFPA 1FMWA 1D1CA 4A5YA 1D0ZA 2XT3A 3KENA 1MNEA 4AS7A 4GKRA 1T5CA 2ZFLA 1VFVA 1BR2A 3L1CA 4A50A 4PJNA 3ZFDA 4BXNA 2FMEA 3CNZA 4HNAK 2ZFJA 1G8XA 2NCDA 2Y65A 1VOMA 2VASA 2GRYA 1YRSA 2KINA 5LT2A 4ZHIA 2Q2ZA 3COBA 1BG2A 4Y05A 4DBQA 4B7BA 2IEHA 4E7SA 3PXNA 3B6UA 4A1ZA 4ZCAA 2PG2A 1F9TA 3LREA 2Q2YA 1MMNA 4FRZA 2X51A 3H4SA 3K3BA 1KK7A 1BR4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D0X A;  4H1G A;  1D1A A;  5GSZ A;  3CJO A;  4A14 A;  1F9W A;  1Q0B A;  2ZFM A;  2X7D A;  3B6V A;  2Y5W A;  5LT3 A;  5LT1 A;  4PJJ A;  1V8J A;  1LKX A;  2G1Q A;  4A28 A;  1MMD A;  2V26 A;  2FKY A;  4LNU K;  4PK4 A;  2MYS A;  3KIN A;  3K5E A;  1D0Y A;  1N6M A;  2FL2 A;  2UYI A;  3WRD A;  4DBR A;  4PJL A;  1MKJ A;  3T0Q A;  1MMG A;  3U06 A;  3L9H A;  1SDM A;  3ZFC A;  2OWM A;  2X2R A;  1F9V A;  1LVK A;  1MMA A;  4UBF A;  2GM1 A;  3BFN A;  1D1B A;  4AP0 A;  4BN2 A;  1BR1 A;  3KAR A;  1VFZ A;  2HEH A;  1V8K A;  3ZCW A;  3NWN A;  1II6 A;  3DCB A;  5LT0 A;  3X2T A;  2X7C A;  2FL6 A;  2ZFI A;  2WOG A;  1VFX A;  4PJM A;  1RY6 A;  3GBJ A;  2VB6 A;  5HLE A;  1FMV A;  4E7Z A;  3DC4 A;  2ZFK A;  3HQD A;  1CZ7 A;  1F9U A;  4PFO A;  1I5S A;  3WPN A;  1GOJ A;  2VVG A;  1I6I A;  2XAE A;  4ETP A;  1VFW A;  4ANJ A;  4A51 A;  2X7E A;  5LT4 A;  1X88 A;  4BBG A;  2UYM A;  4PFP A;  1FMW A;  1D1C A;  4A5Y A;  1D0Z A;  2XT3 A;  3KEN A;  1MNE A;  4AS7 A;  4GKR A;  1T5C A;  2ZFL A;  1VFV A;  1BR2 A;  3L1C A;  4A50 A;  4PJN A;  3ZFD A;  4BXN A;  2FME A;  3CNZ A;  4HNA K;  2ZFJ A;  1G8X A;  2NCD A;  2Y65 A;  1VOM A;  2VAS A;  2GRY A;  1YRS A;  2KIN A;  5LT2 A;  4ZHI A;  2Q2Z A;  3COB A;  1BG2 A;  4Y05 A;  4DBQ A;  4B7B A;  2IEH A;  4E7S A;  3PXN A;  3B6U A;  4A1Z A;  4ZCA A;  2PG2 A;  1F9T A;  3LRE A;  2Q2Y A;  1MMN A;  4FRZ A;  2X51 A;  3H4S A;  3K3B A;  1KK7 A;  1BR4 A; 
#chains in the Genus database with same CATH topology
 1D0X A;  4H1G A;  1D1A A;  5GSZ A;  3CJO A;  4A14 A;  1F9W A;  1Q0B A;  2ZFM A;  2X7D A;  3B6V A;  2Y5W A;  5LT3 A;  5LT1 A;  4PJJ A;  1V8J A;  1LKX A;  2G1Q A;  4A28 A;  1MMD A;  2V26 A;  2FKY A;  4LNU K;  4PK4 A;  2MYS A;  3KIN A;  3K5E A;  1D0Y A;  1N6M A;  2FL2 A;  2UYI A;  3WRD A;  4DBR A;  4PJL A;  1MKJ A;  3T0Q A;  1MMG A;  3U06 A;  3L9H A;  1SDM A;  3ZFC A;  2OWM A;  2X2R A;  1F9V A;  1LVK A;  1MMA A;  4UBF A;  2GM1 A;  3BFN A;  2O0A A;  1D1B A;  4AP0 A;  4BN2 A;  1BR1 A;  3KAR A;  1VFZ A;  2HEH A;  1V8K A;  3ZCW A;  3NWN A;  1II6 A;  3DCB A;  5LT0 A;  3X2T A;  2X7C A;  2FL6 A;  2ZFI A;  2WOG A;  1VFX A;  4PJM A;  1RY6 A;  3GBJ A;  2VB6 A;  5HLE A;  1FMV A;  4E7Z A;  3DC4 A;  2ZFK A;  3HQD A;  1CZ7 A;  1F9U A;  4PFO A;  1I5S A;  3WPN A;  1GOJ A;  2VVG A;  1I6I A;  2XAE A;  4ETP A;  1VFW A;  4ANJ A;  4GKQ A;  4A51 A;  2X7E A;  5LT4 A;  1X88 A;  4BBG A;  2UYM A;  4PFP A;  1FMW A;  1D1C A;  4A5Y A;  1D0Z A;  2XT3 A;  3KEN A;  1MNE A;  4AS7 A;  4GKR A;  1T5C A;  2ZFL A;  1VFV A;  1BR2 A;  3L1C A;  4A50 A;  4PJN A;  3ZFD A;  4BXN A;  2FME A;  3CNZ A;  4HNA K;  2ZFJ A;  1G8X A;  2NCD A;  2Y65 A;  1VOM A;  2VAS A;  2GRY A;  1YRS A;  2KIN A;  5LT2 A;  4ZHI A;  2Q2Z A;  4GKP A;  3COB A;  1BG2 A;  4Y05 A;  4DBQ A;  4B7B A;  2IEH A;  4E7S A;  3PXN A;  3B6U A;  4A1Z A;  4ZCA A;  2PG2 A;  4ETP B;  1F9T A;  3LRE A;  2Q2Y A;  1MMN A;  4FRZ A;  2X51 A;  3H4S A;  3K3B A;  1KK7 A;  1BR4 A; 
#chains in the Genus database with same CATH homology
 1D0X A;  4H1G A;  1D1A A;  5GSZ A;  3CJO A;  4A14 A;  1F9W A;  1Q0B A;  2ZFM A;  2X7D A;  3B6V A;  2Y5W A;  5LT3 A;  5LT1 A;  4PJJ A;  1V8J A;  1LKX A;  2G1Q A;  4A28 A;  1MMD A;  2V26 A;  2FKY A;  4LNU K;  4PK4 A;  2MYS A;  3KIN A;  3K5E A;  1D0Y A;  1N6M A;  2FL2 A;  2UYI A;  3WRD A;  4DBR A;  4PJL A;  1MKJ A;  3T0Q A;  1MMG A;  3U06 A;  3L9H A;  1SDM A;  3ZFC A;  2OWM A;  2X2R A;  1F9V A;  1LVK A;  1MMA A;  4UBF A;  2GM1 A;  3BFN A;  1D1B A;  4AP0 A;  4BN2 A;  1BR1 A;  3KAR A;  1VFZ A;  2HEH A;  1V8K A;  3ZCW A;  3NWN A;  1II6 A;  3DCB A;  5LT0 A;  3X2T A;  2X7C A;  2FL6 A;  2ZFI A;  2WOG A;  1VFX A;  4PJM A;  1RY6 A;  3GBJ A;  2VB6 A;  5HLE A;  1FMV A;  4E7Z A;  3DC4 A;  2ZFK A;  3HQD A;  1CZ7 A;  1F9U A;  4PFO A;  1I5S A;  3WPN A;  1GOJ A;  2VVG A;  1I6I A;  2XAE A;  4ETP A;  1VFW A;  4ANJ A;  4A51 A;  2X7E A;  5LT4 A;  1X88 A;  4BBG A;  2UYM A;  4PFP A;  1FMW A;  1D1C A;  4A5Y A;  1D0Z A;  2XT3 A;  3KEN A;  1MNE A;  4AS7 A;  4GKR A;  1T5C A;  2ZFL A;  1VFV A;  1BR2 A;  3L1C A;  4A50 A;  4PJN A;  3ZFD A;  4BXN A;  2FME A;  3CNZ A;  4HNA K;  2ZFJ A;  1G8X A;  2NCD A;  2Y65 A;  1VOM A;  2VAS A;  2GRY A;  1YRS A;  2KIN A;  5LT2 A;  4ZHI A;  2Q2Z A;  3COB A;  1BG2 A;  4Y05 A;  4DBQ A;  4B7B A;  2IEH A;  4E7S A;  3PXN A;  3B6U A;  4A1Z A;  4ZCA A;  2PG2 A;  1F9T A;  3LRE A;  2Q2Y A;  1MMN A;  4FRZ A;  2X51 A;  3H4S A;  3K3B A;  1KK7 A;  1BR4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...