The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
100
|
sequence length |
290
|
structure length |
269
|
Chain Sequence |
ASTVEKELLRSRRLENSIIEQKGTMRCYAYVMEQNLPENLLFDYENGVITQGLSEHVYKFNRVIPHLKVSEDKFFTQEYSVYHDMCLNQKKNFNLISLSTTPHGSLRESLIKFLAEKDTIYQKQYVITLQFVFLSDDEFSQDMLLDYSIKLKFEKHSISLDSKLVIIENGLEDLPLNFSCDSGMGIIKVQFFPRDSPVPVDFYFIELNNLKSIEQFDKSIFKKSCETPIALVLKKLISDTKSFFLLNLNDSKNVNKLLTISEEVQTQLC
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Vik1 modulates microtubule-Kar3 interactions through a motor domain that lacks an active site.
pubmed doi rcsb |
| molecule tags |
Cell cycle/transport protein
|
| molecule keywords |
S.cerevisiae chromosome XVI reading frame ORF YPL253c
|
| total genus |
100
|
| structure length |
269
|
| sequence length |
290
|
| ec nomenclature | |
| pdb deposition date | 2006-11-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF16796 | Microtub_bd | Microtubule binding |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Kinesin | Kinesin |
#chains in the Genus database with same CATH superfamily 4GKQ A; 4ETP B; 2O0A A; 4GKP A; #chains in the Genus database with same CATH topology 2XT3 A; 1D0X A; 3KAR A; 1YRS A; 1VOM A; 2FKY A; 3KEN A; 4PK4 A; 2X51 A; 3LRE A; 3L1C A; 1F9W A; 4A14 A; 4A28 A; 1I5S A; 4A5Y A; 2ZFL A; 2FL2 A; 3ZFC A; 1VFZ A; 3BFN A; 4GKR A; 1D1C A; 1VFX A; 2X2R A; 5LT1 A; 4Y05 A; 1D0Z A; 1V8J A; 4PFP A; 2GRY A; 3T0Q A; 4BN2 A; 5HLE A; 2MYS A; 1LKX A; 1BR1 A; 3HQD A; 4E7Z A; 2Q2Z A; 3CNZ A; 1II6 A; 2ZFK A; 1MMN A; 1D1B A; 1V8K A; 1Q0B A; 4GKP A; 1N6M A; 1SDM A; 2ZFI A; 1KK7 A; 3NWN A; 1BR4 A; 4HNA K; 3WPN A; 5LT0 A; 4BXN A; 2VAS A; 3U06 A; 4PFO A; 5LT3 A; 1VFV A; 1GOJ A; 3COB A; 4UBF A; 1FMW A; 2Q2Y A; 2ZFM A; 4A1Z A; 1I6I A; 1G8X A; 2KIN A; 2X7D A; 5GSZ A; 1F9T A; 2VB6 A; 4PJJ A; 3B6U A; 4AP0 A; 2WOG A; 3ZFD A; 2HEH A; 4B7B A; 2FL6 A; 4BBG A; 4ETP A; 4ZHI A; 1MMA A; 4ANJ A; 2XAE A; 1MNE A; 4A50 A; 1BG2 A; 1X88 A; 5LT4 A; 2V26 A; 1VFW A; 3GBJ A; 4LNU K; 2OWM A; 3K5E A; 3CJO A; 2GM1 A; 3KIN A; 3DCB A; 4H1G A; 4A51 A; 3DC4 A; 4AS7 A; 1RY6 A; 2PG2 A; 4ZCA A; 2O0A A; 4GKQ A; 2IEH A; 2ZFJ A; 1FMV A; 2X7E A; 1MMG A; 1MKJ A; 2Y5W A; 3B6V A; 4DBQ A; 4ETP B; 3PXN A; 4DBR A; 2G1Q A; 2NCD A; 2FME A; 2X7C A; 1CZ7 A; 5LT2 A; 2VVG A; 4PJN A; 4PJM A; 3WRD A; 2Y65 A; 3H4S A; 1F9V A; 1D0Y A; 3X2T A; 3K3B A; 4FRZ A; 1BR2 A; 3ZCW A; 4E7S A; 1LVK A; 2UYI A; 1F9U A; 1MMD A; 1T5C A; 4PJL A; 3L9H A; 1D1A A; 2UYM A; #chains in the Genus database with same CATH homology 4GKQ A; 4ETP B; 2O0A A; 4GKP A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
