1EO0A

Conserved domain common to transcription factors tfiis, elongin a, crsp70
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR S-II
publication title Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1eo0A00
3NFQA 2XPLA 1EO0A 3HPHE 3F9KC 3OAKA 3O8ZA 1WJTA 3HPGG 2B4JC 2XPNA 2XPPA 3U88C 2XPOA 1Z9EA 2N3AB
chains in the Genus database with same CATH superfamily
3OAKA 4OMEA 2JBJA 3HPGG 2XPOA 4P4BA 3VRPA 2Y1NA 1Z8LA 4P4JA 2UV8G 4NGRA 4BPWB 4OC0A 4BPUB 3S9MA 2PVWA 4MCSA 3D7GA 2B4JC 3D7FA 2Y1MA 5BY0A 3BXMA 3BUMB 3VRNA 2OR4A 4OC4A 3O8ZA 3OB1B 3BI0A 3BUXB 5HKWA 4P4DA 2XEFA 3HMJG 5F13A 2CBLA 2JBKA 1YVHA 2C6PA 2XPPA 5HKYA 4MCPA 4OC5A 3D7HA 1EO0A 4JYWA 3IWWA 2XPNA 3BUOB 4MCQA 3S9LA 2N3AB 3FEEA 4BTFA 3SJFA 3VRQA 2XEJA 2C6GA 3NFQA 2XEIA 1FBVA 3OP0A 3VGOA 4NGSA 5F09A 5ELYA 4P4EA 3KASA 4JZ0A 2OOTA 1DE4C 1B47A 3OB2B 2DLAA 4NGQA 4NGMA 3SJEA 3PFVA 4X3RA 5D29A 5HKZA 4NGNA 3BHXA 2CIJA 4MCRA 4A4BA 4LQGA 4OC3A 4P4IA 3PLFB 3VROA 3HPHE 1CX8A 2VKZG 3VRRA 3PT1A 3FEDA 2PVVA 4A4CA 2XPLA 2XEGA 3F9KC 2C6CA 4RR2B 5J3XA 3U88C 3S9NA 3RBUA 4P45A 4BPXB 4OC2A 4NGTA 3ZNIA 4W9YA 1Z9EA 5AXIA 4P44A 3SJXA 1WJTA 4P4FA 3D7DA 3BUNB 3FF3A 3BI1A 3FECA 4NGPA 4GPLB 3SJGA 4OC1A 3BUWB
chains in the Genus database with same CATH topology
3NFQA 2XPLA 1EO0A 3HPHE 3F9KC 3OAKA 3O8ZA 1WJTA 3HPGG 2B4JC 2XPNA 2XPPA 3U88C 2XPOA 1Z9EA 2N3AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NFQ A;  2XPL A;  1EO0 A;  3HPH E;  3F9K C;  3OAK A;  3O8Z A;  1WJT A;  3HPG G;  2B4J C;  2XPN A;  2XPP A;  3U88 C;  2XPO A;  1Z9E A;  2N3A B; 
#chains in the Genus database with same CATH topology
 3OAK A;  4OME A;  2JBJ A;  3HPG G;  2XPO A;  4P4B A;  3VRP A;  2Y1N A;  1Z8L A;  4P4J A;  2UV8 G;  4NGR A;  4BPW B;  4OC0 A;  4BPU B;  3S9M A;  2PVW A;  4MCS A;  3D7G A;  2B4J C;  3D7F A;  2Y1M A;  5BY0 A;  3BXM A;  3BUM B;  3VRN A;  2OR4 A;  4OC4 A;  3O8Z A;  3OB1 B;  3BI0 A;  3BUX B;  5HKW A;  4P4D A;  2XEF A;  3HMJ G;  5F13 A;  2CBL A;  2JBK A;  1YVH A;  2C6P A;  2XPP A;  5HKY A;  4MCP A;  4OC5 A;  3D7H A;  1EO0 A;  4JYW A;  3IWW A;  2XPN A;  3BUO B;  4MCQ A;  3S9L A;  2N3A B;  3FEE A;  4BTF A;  3SJF A;  3VRQ A;  2XEJ A;  2C6G A;  3NFQ A;  2XEI A;  1FBV A;  3OP0 A;  3VGO A;  4NGS A;  5F09 A;  5ELY A;  4P4E A;  3KAS A;  4JZ0 A;  2OOT A;  1DE4 C;  1B47 A;  3OB2 B;  2DLA A;  4NGQ A;  4NGM A;  3SJE A;  3PFV A;  4X3R A;  5D29 A;  5HKZ A;  4NGN A;  3BHX A;  2CIJ A;  4MCR A;  4A4B A;  4LQG A;  4OC3 A;  4P4I A;  3PLF B;  3VRO A;  3HPH E;  1CX8 A;  2VKZ G;  3VRR A;  3PT1 A;  3FED A;  2PVV A;  4A4C A;  2XPL A;  2XEG A;  3F9K C;  2C6C A;  4RR2 B;  5J3X A;  3U88 C;  3S9N A;  3RBU A;  4P45 A;  4BPX B;  4OC2 A;  4NGT A;  3ZNI A;  4W9Y A;  1Z9E A;  5AXI A;  4P44 A;  3SJX A;  1WJT A;  4P4F A;  3D7D A;  3BUN B;  3FF3 A;  3BI1 A;  3FEC A;  4NGP A;  4GPL B;  3SJG A;  4OC1 A;  3BUW B; 
#chains in the Genus database with same CATH homology
 3NFQ A;  2XPL A;  1EO0 A;  3HPH E;  3F9K C;  3OAK A;  3O8Z A;  1WJT A;  3HPG G;  2B4J C;  2XPN A;  2XPP A;  3U88 C;  2XPO A;  1Z9E A;  2N3A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...