1EO0A

Conserved domain common to transcription factors tfiis, elongin a, crsp70
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR S-II
publication title Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1eo0A00
3F9KC 2XPOA 1WJTA 3O8ZA 2N3AB 1Z9EA 2B4JC 3HPHE 3NFQA 3OAKA 3U88C 1EO0A 3HPGG 2XPLA 2XPPA 2XPNA
chains in the Genus database with same CATH superfamily
3SJFA 3BXMA 4NGSA 3O8ZA 4OC3A 4NGTA 3U88C 3VGOA 4A4BA 3KASA 4OC0A 5HKZA 4MCRA 3OP0A 3HPHE 3D7HA 2PVWA 3VRRA 2OR4A 4P4DA 3BI0A 2XPNA 4NGNA 4P4IA 5HKYA 3S9NA 4NGQA 3HPGG 3FECA 3BUMB 2XPOA 4W9YA 4BTFA 2VKZG 3BUNB 4P4EA 3VRQA 5AXIA 4NGMA 4BPUB 4RR2B 2N3AB 2XEJA 4OC4A 4P4BA 3VRNA 3FEEA 2XEGA 5F13A 4P4FA 1CX8A 2CIJA 4MCQA 3VROA 3BUOB 1DE4C 2DLAA 1B47A 4OMEA 5J3XA 4OC5A 4A4CA 3S9LA 3BUXB 2JBKA 3D7DA 4P4JA 3S9MA 4X3RA 3D7GA 1WJTA 4NGRA 4BPWB 2B4JC 3NFQA 2PVVA 2XEFA 5ELYA 2XPPA 4MCSA 3OB1B 2Y1MA 1YVHA 5HKWA 3D7FA 2C6GA 4JZ0A 2CBLA 3F9KC 4NGPA 5F09A 4BPXB 3OB2B 4GPLB 1EO0A 3FEDA 2C6PA 4MCPA 3SJGA 1Z8LA 1FBVA 3ZNIA 3SJEA 4LQGA 2XEIA 3RBUA 3BI1A 4P44A 3BHXA 4OC1A 2UV8G 3BUWB 3PFVA 2XPLA 4P45A 3FF3A 3VRPA 3PT1A 2OOTA 3PLFB 2C6CA 2JBJA 1Z9EA 5D29A 3OAKA 4JYWA 3HMJG 4OC2A 5BY0A 3SJXA 2Y1NA 3IWWA
chains in the Genus database with same CATH topology
3F9KC 2XPOA 1WJTA 3O8ZA 2N3AB 1Z9EA 2B4JC 3HPHE 3NFQA 3OAKA 3U88C 1EO0A 3HPGG 2XPLA 2XPPA 2XPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9K C;  2XPO A;  1WJT A;  3O8Z A;  2N3A B;  1Z9E A;  2B4J C;  3HPH E;  3NFQ A;  3OAK A;  3U88 C;  1EO0 A;  3HPG G;  2XPL A;  2XPP A;  2XPN A; 
#chains in the Genus database with same CATH topology
 3SJF A;  3BXM A;  4NGS A;  3O8Z A;  4OC3 A;  4NGT A;  3U88 C;  3VGO A;  4A4B A;  3KAS A;  4OC0 A;  5HKZ A;  4MCR A;  3OP0 A;  3HPH E;  3D7H A;  2PVW A;  3VRR A;  2OR4 A;  4P4D A;  3BI0 A;  2XPN A;  4NGN A;  4P4I A;  5HKY A;  3S9N A;  4NGQ A;  3HPG G;  3FEC A;  3BUM B;  2XPO A;  4W9Y A;  4BTF A;  2VKZ G;  3BUN B;  4P4E A;  3VRQ A;  5AXI A;  4NGM A;  4BPU B;  4RR2 B;  2N3A B;  2XEJ A;  4OC4 A;  4P4B A;  3VRN A;  3FEE A;  2XEG A;  5F13 A;  4P4F A;  1CX8 A;  2CIJ A;  4MCQ A;  3VRO A;  3BUO B;  1DE4 C;  2DLA A;  1B47 A;  4OME A;  5J3X A;  4OC5 A;  4A4C A;  3S9L A;  3BUX B;  2JBK A;  3D7D A;  4P4J A;  3S9M A;  4X3R A;  3D7G A;  1WJT A;  4NGR A;  4BPW B;  2B4J C;  3NFQ A;  2PVV A;  2XEF A;  5ELY A;  2XPP A;  4MCS A;  3OB1 B;  2Y1M A;  1YVH A;  5HKW A;  3D7F A;  2C6G A;  4JZ0 A;  2CBL A;  3F9K C;  4NGP A;  5F09 A;  4BPX B;  3OB2 B;  4GPL B;  1EO0 A;  3FED A;  2C6P A;  4MCP A;  3SJG A;  1Z8L A;  1FBV A;  3ZNI A;  3SJE A;  4LQG A;  2XEI A;  3RBU A;  3BI1 A;  4P44 A;  3BHX A;  4OC1 A;  2UV8 G;  3BUW B;  3PFV A;  2XPL A;  4P45 A;  3FF3 A;  3VRP A;  3PT1 A;  2OOT A;  3PLF B;  2C6C A;  2JBJ A;  1Z9E A;  5D29 A;  3OAK A;  4JYW A;  3HMJ G;  4OC2 A;  5BY0 A;  3SJX A;  2Y1N A;  3IWW A; 
#chains in the Genus database with same CATH homology
 3F9K C;  2XPO A;  1WJT A;  3O8Z A;  2N3A B;  1Z9E A;  2B4J C;  3HPH E;  3NFQ A;  3OAK A;  3U88 C;  1EO0 A;  3HPG G;  2XPL A;  2XPP A;  2XPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...