1EO0A

Conserved domain common to transcription factors tfiis, elongin a, crsp70
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAIN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords TRANSCRIPTION ELONGATION FACTOR S-II
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1eo0A00
2N3AB 1Z9EA 2XPPA 3HPHE 2B4JC 2XPNA 2XPOA 3NFQA 1EO0A 1WJTA 3F9KC 2XPLA 3OAKA 3HPGG 3O8ZA 3U88C
chains in the Genus database with same CATH superfamily
4NGMA 4BPUB 2Y1NA 3FECA 3BUNB 3BUWB 3OP0A 3SJEA 2CBLA 3U88C 2N3AB 4MCPA 3BUXB 3IWWA 4A4BA 3BXMA 3PT1A 4OC5A 5D29A 4W9YA 3VROA 4OC2A 3SJFA 4P4JA 4NGSA 3SJXA 2XEGA 3VGOA 3PFVA 2PVVA 3OB2B 3FEEA 2DLAA 3D7HA 1CX8A 2OR4A 3VRPA 3HMJG 4A4CA 2VKZG 2CIJA 2XEJA 3PLFB 3VRNA 3S9MA 4NGTA 4OMEA 1Z8LA 4P44A 3BUOB 5HKWA 4LQGA 4P4DA 1FBVA 4MCQA 3BUMB 3HPGG 3FF3A 3FEDA 4P45A 4P4BA 4BTFA 2JBJA 3OAKA 4MCSA 3KASA 2XEIA 4OC4A 1B47A 3S9NA 2PVWA 3OB1B 3RBUA 3BI1A 3VRRA 5AXIA 3BHXA 2XEFA 4NGNA 3D7GA 4P4EA 4JYWA 4NGPA 4GPLB 5HKZA 5F13A 4NGRA 4X3RA 5HKYA 1DE4C 4OC0A 3O8ZA 2OOTA 3BI0A 3D7FA 3SJGA 4JZ0A 3VRQA 2JBKA 5J3XA 2B4JC 2XPOA 5BY0A 4NGQA 4BPXB 4OC3A 1YVHA 5F09A 5ELYA 2Y1MA 4P4FA 3D7DA 3ZNIA 4MCRA 2XPNA 1EO0A 3NFQA 4BPWB 4OC1A 2C6CA 2C6GA 2C6PA 1Z9EA 2XPPA 1WJTA 3F9KC 2XPLA 2UV8G 4RR2B 3HPHE 4P4IA 3S9LA
chains in the Genus database with same CATH topology
2N3AB 1Z9EA 2XPPA 3HPHE 2B4JC 2XPNA 2XPOA 3NFQA 1EO0A 1WJTA 3F9KC 2XPLA 3OAKA 3HPGG 3O8ZA 3U88C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N3A B;  1Z9E A;  2XPP A;  3HPH E;  2B4J C;  2XPN A;  2XPO A;  3NFQ A;  1EO0 A;  1WJT A;  3F9K C;  2XPL A;  3OAK A;  3HPG G;  3O8Z A;  3U88 C; 
#chains in the Genus database with same CATH topology
 4NGM A;  4BPU B;  2Y1N A;  3FEC A;  3BUN B;  3BUW B;  3OP0 A;  3SJE A;  2CBL A;  3U88 C;  2N3A B;  4MCP A;  3BUX B;  3IWW A;  4A4B A;  3BXM A;  3PT1 A;  4OC5 A;  5D29 A;  4W9Y A;  3VRO A;  4OC2 A;  3SJF A;  4P4J A;  4NGS A;  3SJX A;  2XEG A;  3VGO A;  3PFV A;  2PVV A;  3OB2 B;  3FEE A;  2DLA A;  3D7H A;  1CX8 A;  2OR4 A;  3VRP A;  3HMJ G;  4A4C A;  2VKZ G;  2CIJ A;  2XEJ A;  3PLF B;  3VRN A;  3S9M A;  4NGT A;  4OME A;  1Z8L A;  4P44 A;  3BUO B;  5HKW A;  4LQG A;  4P4D A;  1FBV A;  4MCQ A;  3BUM B;  3HPG G;  3FF3 A;  3FED A;  4P45 A;  4P4B A;  4BTF A;  2JBJ A;  3OAK A;  4MCS A;  3KAS A;  2XEI A;  4OC4 A;  1B47 A;  3S9N A;  2PVW A;  3OB1 B;  3RBU A;  3BI1 A;  3VRR A;  5AXI A;  3BHX A;  2XEF A;  4NGN A;  3D7G A;  4P4E A;  4JYW A;  4NGP A;  4GPL B;  5HKZ A;  5F13 A;  4NGR A;  4X3R A;  5HKY A;  1DE4 C;  4OC0 A;  3O8Z A;  2OOT A;  3BI0 A;  3D7F A;  3SJG A;  4JZ0 A;  3VRQ A;  2JBK A;  5J3X A;  2B4J C;  2XPO A;  5BY0 A;  4NGQ A;  4BPX B;  4OC3 A;  1YVH A;  5F09 A;  5ELY A;  2Y1M A;  4P4F A;  3D7D A;  3ZNI A;  4MCR A;  2XPN A;  1EO0 A;  3NFQ A;  4BPW B;  4OC1 A;  2C6C A;  2C6G A;  2C6P A;  1Z9E A;  2XPP A;  1WJT A;  3F9K C;  2XPL A;  2UV8 G;  4RR2 B;  3HPH E;  4P4I A;  3S9L A; 
#chains in the Genus database with same CATH homology
 2N3A B;  1Z9E A;  2XPP A;  3HPH E;  2B4J C;  2XPN A;  2XPO A;  3NFQ A;  1EO0 A;  1WJT A;  3F9K C;  2XPL A;  3OAK A;  3HPG G;  3O8Z A;  3U88 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...