1EO0A

Conserved domain common to transcription factors tfiis, elongin a, crsp70
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
b'MDSKEVLVHVKNLEKNKSNDAAVLEILHVLDKEFVPTEKLLRETKVGVEVNKFKKSTNVEISKLVKKMISSWKDAIN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTION ELONGATION FACTOR S-II
publication title Structure of a conserved domain common to the transcription factors TFIIS, elongin A, and CRSP70
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 25
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2000-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1eo0A00
2XPOA 3OAKA 2B4JC 3F9KC 1EO0A 3HPHE 1WJTA 3O8ZA 3HPGG 3U88C 2N3AB 1Z9EA 2XPLA 3NFQA 2XPPA 2XPNA
chains in the Genus database with same CATH superfamily
3D7GA 4JYWA 3VRPA 4OC3A 2C6GA 3BXMA 2PVWA 3NFQA 4MCRA 4P44A 3KASA 4BPWB 3OB1B 3O8ZA 4OC2A 4OC1A 4A4CA 4MCQA 4BPXB 2XPNA 2C6PA 3HMJG 4GPLB 3BI1A 3S9LA 5ELYA 3BUWB 2C6CA 4NGQA 2UV8G 3FF3A 4NGNA 4P4DA 4NGPA 3VRNA 2VKZG 4NGRA 3PLFB 4NGMA 1DE4C 4P4JA 3HPGG 3D7DA 4MCPA 4RR2B 3HPHE 5BY0A 5HKYA 2N3AB 3OB2B 4P4FA 3SJEA 3OAKA 3VROA 3D7FA 3ZNIA 3IWWA 3BI0A 5D29A 5J3XA 3FEDA 2DLAA 5F13A 2XPOA 2CIJA 3BUMB 3BHXA 1WJTA 3D7HA 3PFVA 2Y1MA 2XEGA 4P4BA 4OC0A 5HKZA 2JBJA 3VRQA 3FECA 2XPPA 2OOTA 2XEFA 1FBVA 4NGSA 3F9KC 4X3RA 4NGTA 3RBUA 4LQGA 4OC4A 3S9MA 3S9NA 1YVHA 4JZ0A 4MCSA 4W9YA 2PVVA 4P4IA 3VGOA 4P4EA 1CX8A 2Y1NA 5HKWA 2B4JC 2XEJA 5F09A 1B47A 1Z9EA 3FEEA 2XPLA 4A4BA 2JBKA 2OR4A 3PT1A 5AXIA 3SJGA 3BUOB 4P45A 3SJXA 3BUXB 1Z8LA 1EO0A 3VRRA 2CBLA 2XEIA 4OC5A 3OP0A 4BPUB 3BUNB 4OMEA 4BTFA 3U88C 3SJFA
chains in the Genus database with same CATH topology
2XPOA 3OAKA 2B4JC 3F9KC 1EO0A 3HPHE 1WJTA 3O8ZA 3HPGG 3U88C 2N3AB 1Z9EA 2XPLA 3NFQA 2XPPA 2XPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPO A;  3OAK A;  2B4J C;  3F9K C;  1EO0 A;  3HPH E;  1WJT A;  3O8Z A;  3HPG G;  3U88 C;  2N3A B;  1Z9E A;  2XPL A;  3NFQ A;  2XPP A;  2XPN A; 
#chains in the Genus database with same CATH topology
 3D7G A;  4JYW A;  3VRP A;  4OC3 A;  2C6G A;  3BXM A;  2PVW A;  3NFQ A;  4MCR A;  4P44 A;  3KAS A;  4BPW B;  3OB1 B;  3O8Z A;  4OC2 A;  4OC1 A;  4A4C A;  4MCQ A;  4BPX B;  2XPN A;  2C6P A;  3HMJ G;  4GPL B;  3BI1 A;  3S9L A;  5ELY A;  3BUW B;  2C6C A;  4NGQ A;  2UV8 G;  3FF3 A;  4NGN A;  4P4D A;  4NGP A;  3VRN A;  2VKZ G;  4NGR A;  3PLF B;  4NGM A;  1DE4 C;  4P4J A;  3HPG G;  3D7D A;  4MCP A;  4RR2 B;  3HPH E;  5BY0 A;  5HKY A;  2N3A B;  3OB2 B;  4P4F A;  3SJE A;  3OAK A;  3VRO A;  3D7F A;  3ZNI A;  3IWW A;  3BI0 A;  5D29 A;  5J3X A;  3FED A;  2DLA A;  5F13 A;  2XPO A;  2CIJ A;  3BUM B;  3BHX A;  1WJT A;  3D7H A;  3PFV A;  2Y1M A;  2XEG A;  4P4B A;  4OC0 A;  5HKZ A;  2JBJ A;  3VRQ A;  3FEC A;  2XPP A;  2OOT A;  2XEF A;  1FBV A;  4NGS A;  3F9K C;  4X3R A;  4NGT A;  3RBU A;  4LQG A;  4OC4 A;  3S9M A;  3S9N A;  1YVH A;  4JZ0 A;  4MCS A;  4W9Y A;  2PVV A;  4P4I A;  3VGO A;  4P4E A;  1CX8 A;  2Y1N A;  5HKW A;  2B4J C;  2XEJ A;  5F09 A;  1B47 A;  1Z9E A;  3FEE A;  2XPL A;  4A4B A;  2JBK A;  2OR4 A;  3PT1 A;  5AXI A;  3SJG A;  3BUO B;  4P45 A;  3SJX A;  3BUX B;  1Z8L A;  1EO0 A;  3VRR A;  2CBL A;  2XEI A;  4OC5 A;  3OP0 A;  4BPU B;  3BUN B;  4OME A;  4BTF A;  3U88 C;  3SJF A; 
#chains in the Genus database with same CATH homology
 2XPO A;  3OAK A;  2B4J C;  3F9K C;  1EO0 A;  3HPH E;  1WJT A;  3O8Z A;  3HPG G;  3U88 C;  2N3A B;  1Z9E A;  2XPL A;  3NFQ A;  2XPP A;  2XPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...