4OC3A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cfibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(furan-2-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc3A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc3A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc3A02
1HDUA 2AFSA 1TF9A 3RBUA 3GUXA 4NFRA 4R8FA 4TJVA 3PB7X 1CP6A 2GLFA 5HVHA 2ZELA 1TF8A 3NH4A 7CPAA 2ZENA 1NSAA 4PXCA 8CPAA 2GU2A 3JRUA 5K8NA 4ZI6A 4CPAA 5K8MA 1YW4A 4UEZA 6CPAA 2PIYA 5LYIA 2PJCA 1CPXA 4F8ZA 3D68A 4R6TA 4TNUA 4PQAA 5IB9A 1Y0RA 5LRGA 2HB6A 4OC4A 4IAVA 2XEFA 2GLJA 4P4FA 4B6ZA 1PYTB 2OOTA 2O4HA 5JH9A 1OBRA 4PXDA 3WC7A 3PB9X 3QNVA 2JEWA 2V77A 2AFWA 2CF4A 2Q51A 1CPSA 5JM6A 4A37A 3B3SA 3PBEA 4FUUA 4MHZA 1H8LA 3KHXA 3B3VA 4UEEA 4UF4A 1Z8LA 3K2KA 4X3RA 4C99A 2PIZA 3IEHA 1DE4C 2CIJA 2PJ7A 2PJ4A 3LMSA 2G9DA 2BCOA 3D67A 3FX6A 4AXVA 3WC5A 1IY7A 3KQZA 4OIDA 2XEIA 4WWVA 1BPNA 1LANA 3VARA 4FBEA 2PJ8A 2V8GA 4OC2A 5CBMA 1PCAA 2F7VA 4YN3A 1BLLE 4A38A 4C9EA 4PPZA 1Z2LA 3B35A 2ZEMA 3PB4X 5LYLA 4NGNA 3KI9A 2AFUA 2XEJA 2BOAA 3S9LA 3SI0A 1XMBA 1WVMA 4C9AA 4OKOA 1IGBA 2J9AA 2V8VA 3L2NA 2F8HA 2ZEEA 4C85A 4ZYQA 3RZAA 2PJ9A 4NJRA 2HC9A 1BAVA 3N5FA 4MRIA 4BD9A 1DTDA 1VHEA 1ZG7A 4P4BA 3KR5A 2OR4A 3S9NA 3DLJA 3WT4A 3HLPA 2AFOA 4OMEA 4ZY2A 1ZG8A 3B7IA 4ZX8A 1LOKA 4ZY0A 2ZEHA 4DYOA 4C9VA 3NFZA 3SJFA 3BHXA 5K8PA 1F57A 1CBXA 1VIXA 4C8AA 1XFOA 2C1CA 4TWEA 3IJ3A 3EIFA 1ZG9A 4P4IA 2AFMA 4OIWA 1FNOA 4P44A 3H8FA 3CPXA 3FEDA 1VHOA 3FECA 3SI2A 4K3NA 1F2PA 2ZEPA 4G1PA 5D8NA 4MMOA 1RTQA 1Z5RA 3GB0A 3ICUA 3S9MA 3SI1A 1ELMP 3RAMA 2JBJA 4Z65A 4OC5A 1CG2A 4C8FA 2Q43A 3MN8A 3IFEA 4A39A 4KNGE 2GREA 1XF1A 1Q7LA 4R76A 3ISXA 2ZEOA 1ARMA 2WYRA 1EE3P 2JBKA 3NH5A 3PFEA 4MHPA 2ZOFA 1ARLA 1R3NA 1TKJA 3FEEA 4C9RA 2NSMA 4IHMA 5D29A 3MRUA 2ZEFA 4MXUA 3TX8A 2XEGA 2PRQA 2C6PA 4UEFA 2PJ0A 1GYTA 3KHZA 2PJ3A 2Q4ZA 1V6CA 5K8OA 4YU9A 4CDKA 3FJUA 4P10A 2AFZA 2PVVA 3PB8X 3I6SA 4R7MA 4DJLA 3I1UA 3D4UA 1ELLP 2C6GA 2PJ5A 2CTCA 3GLJA 3FMCA 2EWBA 3KR4A 3WC6A 2PJAA 2EK9A 3WABA 3D7GA 4C8UA 4C8CA 2ZOGA 3FH4A 1ZLHA 3PRTA 2RFHA 1LFWA 2PJ1A 3H8EA 1UWYA 3D7DA 3ISZA 1JQGA 1Y0YA 3PB6X 2QYVA 2PVWA 4Q7AA 5J1QA 4EFDA 2VL1A 4C8PA 3I74A 3V7ZA 4NGQA 5DS0A 4F9UA 3KGQA 1TKHA 3CT9A 1QQ9A 1XRYA 1AYEA 3KL9A 4WJBA 1TKFA 5HVGA 3SJEA 3T8WA 4ZY1A 1QMUA 3B3TA 2AFXA 4NJQA 4X2TA 2IMOA 5JGFA 1F2OA 4P45A 3FF3A 4ZX9A 1BPMA 2IQ6A 3PBBA 4C86A 4LQGA 4MHNA 1XBUA 3VATA 3V38A 3VH9A 2C6CA 5HVFA 3CPAA 4UIBA 4C8TA 3B3CA 1FT7A 5LRJA 2BO9A 3B2YA 2O53A 4MCQA 1Y7EA 3FVLA 1HEEA 3HUVA 3KQXA 2ABZA 5I4MA 4KSIA 2PCUA 3NH8A 4NGSA 4EWTA 4O23A 4MCRA 1Y9ZA 1CP7A 2IJZA 3VTAA 1YW6A 2DEAA 4PXEA 4JZ0A 1LCPA 2WZNA 2V8DA 2I3CA 4OC3A 4FWUA 2PJBA 1R43A 1LAPA 1YSJA 3IC1A 4NGTA 3CDXA 3PFOA 1HDQA 3PEIA 1CX8A 2PE3A 2QJ8A 4C84A 1KWMA 3BI1A 4FAIA 3KZWA 3D66A 2CTBA 2RB7A 2ANPA 4EMEA 2V8HA 1TXRA 3SJXA 4A94A 4MCSA 4ONWA 4X8IA 4DUKA 4OP4A 1VGYA 3K9TA 4CDJA 2NYQA 3D7FA 4F9VA 3NA6A 4OC0A 4H2KA 1AMPA 1XJOA 1YMEA 3BI0A 2FVGA 4MCPA 4NGRA 3H8GA 5F09A 1LAMA 5LYDA 4YWYA 2ZEGA 4P4JA 1M4LA 4JYWA 5THWA 3IO1A 5LRKA 3KASA 5CPAA 4NGPA 4GM5A 4P4EA 2QVPA 1ZLIA 3IWWA 3D7HA 4RUHA 5ELYA 2POKA 3BXMA 3TC8A 5LYFA 4OC1A 4W9YA 4P4DA 4IK2A 2EK8A 2PJ6A 4P6YA 4TJXA 3LWUA 4C9UA 2PJ2A 2ZEDA 3B3WA 4NGMA 1YLOA 4UIAA 3IIBA 4MHYA 4PXBA 3DGVA 5HXDA 3SJGA
chains in the Genus database with same CATH superfamily
1HDUA 2GANA 2AFSA 1MJ9A 4COGA 5AG6A 1TF9A 3RBUA 4JXRA 3GUXA 5F46A 2XPOA 4NFRA 1XIXA 4R8FA 3DR8A 3PB7X 4TJVA 4ZBGA 3TOAA 1CP6A 2GLFA 1L0CA 5HVHA 2ZELA 1TF8A 3H5ZA 2Z10A 1TIQA 1WJTA 1KUXA 3NH4A 7CPAA 2ZENA 1NSAA 3ZNIA 2AJ6A 3BJ8A 3HMJG 4PSWA 1YR0A 4PXCA 8CPAA 2GU2A 3IWGA 1KZFA 2R82A 2D0OA 2Z3PA 4J0NA 3JRUA 1KC7A 5K8NA 4ZI6A 4KOVA 4C2ZA 1WWZA 2PDOA 4CPAA 1QSOA 3TCVA 4B5PA 5K8MA 1YLEA 1YW4A 4UEZA 1QSRA 4LUAA 3IGRA 6CPAA 2PIYA 4KOSA 5LYIA 2PJCA 3TT2A 2XPNA 1CPXA 2Y0MA 2D4PA 4F8ZA 4KLWA 5G20A 3D68A 4R6TA 4UWJA 2EO8A 4A31A 4AVCA 4QC6A 4TNUA 1A9XB 4PQAA 2ZW7A 3D2MA 4NEXA 4CGMA 1KUYA 1Y0RA 1Z4EA 5LRGA 4DNCA 5J8CA 2HB6A 4OC4A 1QSTA 4IAVA 2XEFA 3SXOA 1YREA 3TLZA 4UBRA 2GLJA 4P4FA 5EMIA 4B6ZA 5FD8A 1B47A 5HKYA 1PYTB 2ZXVA 2OOTA 4MFKA 3SXNA 1S7FA 2O4HA 1IYLA 4C7HA 5JH9A 4BMHA 3ZJ0A 2OB0A 3KKWA 3PLFB 1PUAA 2Z3NA 4UCPA 3G3SA 5BY0A 3RO0A 1IOFA 3LACA 3NE8A 4F0XA 2ARHA 1OBRA 4PXDA 3WC7A 4A2ZA 4CAFA 3PB9X 3QNVA 1CE8B 4XPDC 2JEWA 1RXTA 2V77A 2AFWA 2CF4A 4FD7A 3W91A 2XPLA 2Q51A 1CPSA 1NMTA 5AG4A 5JM6A 4MI1A 5DWMA 2FL4A 1BO4A 4A37A 3B3SA 3T07A 3SHPA 2ZPAA 1S5KA 2P0WA 3PBEA 3DR6A 4FUUA 3O8ZA 2MP0A 4FD5A 4MHZA 1H8LA 1M4IA 1XEBA 3KHXA 2CNMA 4BPUB 3B3VA 4UEEA 5GCNA 5HKWA 4JD6A 4MFPA 1QSMA 3F9KC 1Z8LA 3DSBA 4UF4A 3K2KA 4X3RA 3VRQA 4MY3A 2XPPA 4IIYA 2GP4A 1U6MA 4C99A 1KUVA 3VROA 2PIZA 1ZO0A 3F0AA 1DE4C 2CIJA 2PJ7A 3IEHA 4HNYB 4IF5A 4LQ6A 3EZAA 2PJ4A 3LMSA 2DXQA 2G9DA 3TTHA 2BCOA 4B5PB 2YNCA 3D67A 2QIRA 3FX6A 1CS0B 4I49A 4F0YA 4AXVA 3WC5A 1ZYMA 1IY7A 2OU2A 2NMTA 3KQZA 1T36B 4OIDA 2BEIA 3QAYA 2VXKA 2XEIA 4WWVA 3TFYA 1BPNA 1LANA 4Y49B 2VEZA 5F47A 3VARA 4FBEA 1IB1E 3KRVA 1Z8TA 4HNWB 4MBUA 2PJ8A 4F6AA 2V8GA 4OC2A 2PR8A 4IUSA 4YRHA 3R96A 4JWPA 4M8DA 5G21A 5CBMA 2GE3A 3TLEA 4NSQA 1PCAA 2F7VA 3FYNA 4M85A 4YN3A 2PC1A 1BLLE 3EO4A 2YNDA 4A38A 1X12A 3I9SA 4C9EA 4ZGYB 4PPZA 3G23A 1LRZA 2CNTA 3P2HA 1Z2LA 3B35A 1I1DA 2ZEMA 3PB4X 1PU9A 5LYLA 1M1DA 4YGOA 5H84A 4KSAA 3T5MA 2HI6A 1A2ZA 4NGNA 1UFHA 3KI9A 4HNXB 2AFUA 5J8FA 2XEJA 2BOAA 4GPLB 3C26A 4J3GA 3S9LA 3FBUA 2OZGA 4CAWA 2X0SA 2PCNA 2ODFA 3SI0A 4NF1A 1XMBA 4BTFA 4B12A 5IV0A 1WVMA 5A28A 4KZTA 4C9AA 4AG7A 4OKOA 1IGBA 1WK4A 3TOBA 2J9AA 3ZZIA 3TLGA 2ZW6A 2FXFA 1YX0A 2V8VA 3L2NA 2F8HA 4CZ1A 2AUMA 5AXIA 3N7ZA 3PFVA 2ZEEA 3QB8A 1YGHA 2VBQA 4NCZA 4C85A 5JPHA 4KVXA 4ZYQA 1KBLA 3RZAA 2PJ9A 4NJRA 2Q4VA 2HC9A 4U9YA 1BAVA 1EZBA 3N5FA 1XE4A 4MRIA 1BXRB 4BD9A 1DTDA 1VHEA 1Y9KA 1ZG7A 4P4BA 5JVLA 3EC4A 3NE7A 5EBVA 5H86A 1M44A 4E2AA 2OH1A 2OR4A 3KR5A 1Z9UA 3GJZA 3S9NA 4A4CA 1Q5XA 3DLJA 3TLBA 5F13A 3CXQA 2BL1A 3FNCA 4RN7A 4BINA 3WT4A 5K99A 4MY0A 3HLPA 2D0PA 2Z3MA 4UCMA 2AFOA 4OMEA 4XPLA 4ZY2A 4UFWA 3GYAA 1ZG8A 3B7IA 4ZX8A 4U5YA 1LOKA 4ZY0A 2ZEHA 1IU8A 4DYOA 3NFZA 3SJFA 4C9VA 3R9FA 4E5SA 4ONUA 3BHXA 2Z11A 1VBHA 5K8PA 1F57A 1Q2YA 1YK3A 1CBXA 3DNSA 1YVOA 3JTKA 4KUBA 4B10A 1VIXA 4C8AA 1XFOA 1YVKA 1Z4RA 2C1CA 4TWEA 2OZUA 2VI7A 3IJ3A 1S60A 2FSRA 2VZYA 1XOVA 1ZG9A 4P4IA 2AFMA 3LD2A 4NXYA 4OIWA 3EIFA 3BUOB 2EZCA 5F9MA 2DIKA 2VQYA 5I0CA 1FNOA 2REFA 4P44A 3H8FA 3CPXA 3FEDA 2JDCA 4BPWB 4A33A 1VHOA 3BUWB 3FECA 3SI2A 2J8RA 1F2PA 1Q2CA 2ZEPA 3D8PA 4G1PA 4K3NA 5D8NA 4MMOA 1RTQA 2Q7SA 5JYBA 4Y49C 1Z5RA 2X7BA 3I3GA 4RR2B 2A4NA 2B3UA 3GB0A 4CAXA 5F1YA 3TLYA 1QSNA 3ICUA 1CM0A 1DIKA 3S9MA 3SI1A 1ELMP 3RAMA 3QAHA 4M6IA 3TLAA 2JBJA 4Z65A 4OC5A 1CG2A 4C8FA 2PQ8A 3BUNB 1Y9WA 1BOBA 1X10A 2Q43A 1M4GA 3TLGB 4PK3A 1P4NA 3MN8A 3IFEA 4A39A 2JEVA 2JLMA 4KNGE 2Q4YA 1IOIA 2GREA 4CGOA 1XF1A 1Q7LA 2FIAA 2YJVA 4R76A 4HPSA 4RI1A 3ISXA 2ZEOA 4MFJA 4UFVA 2N3AB 4BPXB 1I12A 2QECA 1ARMA 1IYKA 2DPTA 2WYRA 4X5KA 2K5TA 1EE3P 2J8MA 4U9ZA 2JBKA 2EVNA 3NH5A 3PFEA 2ZOFA 2KCWA 4MHPA 1XMTA 4OAEA 1ARLA 1R3NA 1TKJA 3R9EA 3FEEA 3S6KA 4CGPA 1C30B 2CXAA 4C9RA 3CXPA 3VWDA 2NSMA 2R8VA 4IHMA 4MFLA 1CJWA 5D29A 1MJBA 3MRUA 5E96A 2FIWA 2HV2A 4L89A 2B5GA 2R1IA 2ZEFA 3FIXA 4KOUA 2R98A 2G3AA 4MXUA 3S6HA 5AG7A 2B4JC 2O28A 2XEGA 2WUUA 3TX8A 5C88A 2ZW5A 2PRQA 2C6PA 1JDBC 3P2FA 4UEFA 3PT1A 3T9YA 2PJ0A 3T05A 5KTCA 3OWCA 1GYTA 3KHZA 4PK2A 2PJ3A 1VKCA 3OP0A 3T90A 4MHDA 1M6VB 2Q4ZA 2YNCC 5DWNA 3RNZA 4KOXA 4H6UA 1MK4A 4GXHA 1V6CA 3CXSA 4C2XA 2UV8G 2ZW4A 4XNHB 5K8OA 4YU9A 4CDKA 2I00A 3FJUA 2FE7A 4P10A 4H89A 2OLSA 2D4OA 2AFZA 4FD6A 4PV6A 4XPKA 2PVVA 3PB8X 3I6SA 1R57A 5AGEA 4EYSA 4R7MA 4DJLA 3I1UA 2Z0ZA 4CRZB 3D4UA 5IX3A 1ELLP 4OLLA 2C6GA 5HMNA 4KS9A 1VBGA 2PJ5A 2CTCA 3GLJA 3FMCA 2EWBA 3KR4A 2C27A 4KOWA 3WC6A 4MJXA 2PJAA 3EFAA 2EK9A 2G3TA 3D7GA 3WABA 4C8CA 2ZOGA 4C8UA 2Z3KA 1GHEA 1ZLHA 1VHSA 3FH4A 2RFHA 2IL4A 3PRTA 1LFWA 2FS5A 2PJ1A 4C7IA 3H8EA 1UWYA 3WR7A 3D7DA 3VH9A 3ISZA 1JQGA 1Y7RA 3U1BA 2J8NA 1IIDA 1Y0YA 3PB6X 2QYVA 3EZBA 3TO6A 2PVWA 2P6EA 4Q7AA 1P0HA 5J1QA 2G0BA 4EFDA 2VL1A 3PZJA 5JQ4A 5IB0A 3TLCA 4UFXA 3I74A 4C8PA 3V7ZA 4IIXA 4CAVA 4NGQA 3NOJA 5DS0A 3LODA 4OADA 3OB1B 2B5GB 3KGQA 4R57A 4F9UA 1TKHA 4M6GA 1ZRSA 3CT9A 1EZAA 1QQ9A 1XRYA 1AYEA 3A9LA 4KVME 4R3KA 3VWEA 4CYQA 3KL9A 4PSXA 4WJBA 5F5XA 1TKFA 2B3VA 5HVGA 3SJEA 3T8WA 4ZY1A 4CGNA 2Q04A 1QMUA 3B3TA 4KORA 2AFXA 4MI4A 4NJQA 4BBHA 4X2TA 2IMOA 2JDDA 1M4DA 4CS0B 5FVJA 1F2OA 5JGFA 2Q44A 4P45A 1AUGA 2P6FA 3FF3A 2H5MA 3B8GA 4LX9A 5AG5A 1BPMA 2IQ6A 4ZX9A 3R95A 3EZEA 2ATRA 1ON0A 1Z8XA 3FB3A 5F48A 1ZL0A 2EZAA 3C8OA 4JLYA 3OAKA 3W6SA 5KTAA 3PBBA 1RO5A 4AB7A 4C86A 3UY5A 4LQGA 4MHNA 3V8IA 3F8KA 3GIUA 1XBUA 3VATA 5HKZA 3V38A 2C6CA 4GS4A 1J4JA 1I21A 4JXQA 5HVFA 3CPAA 4UIBA 2GFQA 2EZBA 2PR1A 4C8TA 2QMLA 3B3CA 2EBJA 1FT7A 5LRJA 1YQEA 2BO9A 2YJTA 4CO9A 3B2YA 2O53A 4MCQA 1NSLA 4MFQA 1YVHA 2B0AA 3HPGG 3GY9A 1Y7EA 3PP9A 1B87A 1B6BA 2B4DA 3FVLA 4ORFA 2Q7BA 1HEEA 3HUVA 3KQXA 2DF5A 4K30A 4QB9A 4B13A 2VKZG 4YFJA 2ABZA 2GIVA 5IR2A 5I4MA 4KSIA 3S6FA 1C3OB 1S7KA 1NXJA 2PCUA 3NH8A 4NGSA 4EWTA 2Y1MA 2HQYA 4O23A 4RS2A 2FCKA 4INJA 1IICA 2Z3OA 3G8WA 4MCRA 4E8OA 1Y9ZA 1CP7A 3K9UA 3IU1A 4XNHC 3D3SA 3BUMB 2IJZA 2E28A 4JVOA 1K4JA 3VTAA 4R9MA 4A32A 1YW6A 2DEAA 4PXEA 4JZ0A 1LCPA 2WZNA 2B58A 4C68A 2V8DA 5IB9A 4R3LA 1S7LA 2I3CA 4E0AA 1XF8A 4OC3A 3TYXA 4FWUA 3R9GA 3TO7A 1JWQA 3H4QA 1SQHA 1V0CA 2PJBA 1R43A 1LAPA 2HUZA 2DLAA 2P6GA 1YSJA 5HH1A 2WPXA 3IC1A 4NGTA 3SR3A 3EY5A 4KOTA 4KLVA 1Z9EA 4KVOE 3CDXA 3W6XA 3IU2A 5CNPA 1GGOA 2FT0A 4KOYA 4A95A 3PFOA 1HDQA 3PEIA 5J3XA 2PSWA 1CX8A 2PE3A 2QJ8A 4C84A 4R87A 1KWMA 1Q2DA 4HKFA 4A30A 3BI1A 3DDDA 3PGPA 2OZHA 4FAIA 1EO0A 4CYOA 4L8AA 2YNEA 5G22A 2HWGA 3R1KA 3T0TA 3KZWA 4E94A 3D66A 2CTBA 2RB7A 2ANPA 5F49A 2DPSA 4EMEA 3EXNA 2FM4A 2V8HA 4MJ8A 3VRPA 1TXRA 3JUWA 1VI4A 3D2PA 3SJXA 5G1ZA 4A94A 4MCSA 1S7NA 1OZPA 1KEEB 4ONWA 4X8IA 4AVBA 4EVYA 1MJAA 4CYPA 4DUKA 4OP4A 3E0KA 1VGYA 3K9TA 4CDJA 2NYQA 3D7FA 4F9VA 3U88C 1Z8WA 3NA6A 2B4DB 4H1HA 3BLNA 2Y1NA 4OC0A 4II9A 4H2KA 1AMPA 1XJOA 4UA3A 1YMEA 4COBA 1NBWA 3BI0A 2Z3LA 2FVGA 4KUAA 5A27A 2C5QA 3VGOA 4MCPA 3NFQA 3OB2B 2CY2A 4NGRA 3H8GA 5F09A 2VZZA 1LAMA 2WPWA 4YWYA 5LYDA 3RYOA 4CYNA 4QBJA 2ZEGA 1J3LA 4P4JA 1M4LA 4QUSA 4AVAA 4JYWA 2BUEA 5THWA 1FBVA 4H6ZA 3IO1A 2WSAA 5LRKA 3KASA 5CPAA 4NGPA 2AE6A 2B4BA 3S6GA 2HROA 2PRBA 4GM5A 4P4EA 2BSWA 3BUXB 3BJ7A 2QVPA 1ZLIA 3GKRA 4Q36A 4JJXA 3F5BA 3IWWA 2I79A 4CGLA 3D7HA 4RUHA 1JDEA 4XPDB 4B11A 1S3ZA 5KTDA 3MGDA 5ELYA 3K4IA 3VRNA 2POKA 3BXMA 3JVNA 4CRYB 3TC8A 5LYFA 4OC1A 2REEA 4AG9A 3HPHE 2CNSA 2CBLA 5C82A 4W9YA 4P4DA 4IK2A 1NE9A 2EK8A 2PJ6A 4P6YA 4TJXA 4A4BA 1FY7A 3LWUA 2PJ2A 4C9UA 4KSFA 1R61A 2ZEDA 4MFZA 4M3SA 3FRMA 4CAEA 4B14A 3IWEA 4UWIA 3B3WA 4NGMA 3CZXA 4B5OA 2AUNA 2R7HA 1YLOA 2Q0YA 5BWAB 4QVTA 4Q38A 4M6HA 4UIAA 3TO9A 1N71A 3IIBA 4MHYA 2EUIA 2F5IA 3FXTA 4FD4A 4PXBA 4UCNA 3DGVA 5HXDA 5ISVA 3TE4A 5EC4A 3SJGA 3VRRA 2YGWA 4C2YA 2RC4A
chains in the Genus database with same CATH topology
1HDUA 2AFSA 1TF9A 3RBUA 3GUXA 4NFRA 4R8FA 4TJVA 3PB7X 1CP6A 2GLFA 5HVHA 2ZELA 1TF8A 3NH4A 7CPAA 2ZENA 1NSAA 4PXCA 8CPAA 2GU2A 3JRUA 5K8NA 4ZI6A 4CPAA 5K8MA 1YW4A 4UEZA 6CPAA 2PIYA 5LYIA 2PJCA 1CPXA 4F8ZA 3D68A 4R6TA 4TNUA 4PQAA 5IB9A 1Y0RA 5LRGA 2HB6A 4OC4A 4IAVA 2XEFA 2GLJA 4P4FA 4B6ZA 1PYTB 2OOTA 2O4HA 5JH9A 1OBRA 4PXDA 3WC7A 3PB9X 3QNVA 2JEWA 2V77A 2AFWA 2CF4A 2Q51A 1CPSA 5JM6A 4A37A 3B3SA 3PBEA 4FUUA 4MHZA 1H8LA 3KHXA 3B3VA 4UEEA 4UF4A 1Z8LA 3K2KA 4X3RA 2GP4A 4C99A 2PIZA 3IEHA 1DE4C 2CIJA 2PJ7A 2PJ4A 3LMSA 2G9DA 2BCOA 3D67A 3FX6A 4AXVA 3WC5A 1IY7A 3KQZA 4OIDA 2XEIA 4WWVA 1BPNA 1LANA 3VARA 4FBEA 2PJ8A 2V8GA 4OC2A 5CBMA 1PCAA 2F7VA 4YN3A 1BLLE 4A38A 4C9EA 4PPZA 1Z2LA 3B35A 2ZEMA 3PB4X 5LYLA 4NGNA 3KI9A 2AFUA 2XEJA 2BOAA 3S9LA 3SI0A 1XMBA 1WVMA 4C9AA 4OKOA 1IGBA 2J9AA 2V8VA 3L2NA 2F8HA 2ZEEA 4C85A 4ZYQA 3RZAA 2PJ9A 4NJRA 2HC9A 1BAVA 3N5FA 4MRIA 4BD9A 1DTDA 1VHEA 1ZG7A 4P4BA 3KR5A 2OR4A 3S9NA 3DLJA 3WT4A 3HLPA 2AFOA 4OMEA 4ZY2A 1ZG8A 3B7IA 4ZX8A 1LOKA 4ZY0A 2ZEHA 4DYOA 4C9VA 3NFZA 3SJFA 3BHXA 5K8PA 1F57A 1CBXA 1VIXA 4C8AA 1XFOA 2C1CA 4TWEA 3IJ3A 3EIFA 1ZG9A 4P4IA 2AFMA 4OIWA 1FNOA 4P44A 3H8FA 3CPXA 3FEDA 1VHOA 3FECA 3SI2A 4K3NA 1F2PA 2ZEPA 4G1PA 5D8NA 4MMOA 1RTQA 1Z5RA 3GB0A 3ICUA 3S9MA 3SI1A 1ELMP 3RAMA 2JBJA 4Z65A 4OC5A 1CG2A 4C8FA 2Q43A 3MN8A 3IFEA 4A39A 4KNGE 2GREA 1XF1A 1Q7LA 4R76A 3ISXA 2ZEOA 1ARMA 2WYRA 1EE3P 2JBKA 3NH5A 3PFEA 4MHPA 2ZOFA 1ARLA 1R3NA 1TKJA 3FEEA 4C9RA 2NSMA 4IHMA 5D29A 3MRUA 2ZEFA 4MXUA 3TX8A 2XEGA 2PRQA 2C6PA 4UEFA 2PJ0A 1GYTA 3KHZA 2PJ3A 2Q4ZA 1V6CA 5K8OA 4YU9A 4CDKA 3FJUA 4P10A 2AFZA 2PVVA 3PB8X 3I6SA 4R7MA 4DJLA 3I1UA 3D4UA 1ELLP 2C6GA 2PJ5A 2CTCA 3GLJA 3FMCA 2EWBA 3KR4A 3WC6A 2PJAA 2EK9A 3WABA 3D7GA 4C8UA 4C8CA 2ZOGA 3FH4A 1ZLHA 3PRTA 2RFHA 1LFWA 2PJ1A 3H8EA 1UWYA 3D7DA 3ISZA 1JQGA 1Y0YA 3PB6X 2QYVA 2PVWA 4Q7AA 5J1QA 4EFDA 2VL1A 4C8PA 3I74A 3V7ZA 4NGQA 5DS0A 4F9UA 3KGQA 1TKHA 3CT9A 1QQ9A 1XRYA 1AYEA 3KL9A 4WJBA 1TKFA 5HVGA 3SJEA 3T8WA 4ZY1A 1QMUA 3B3TA 2AFXA 4NJQA 4X2TA 2IMOA 5JGFA 1F2OA 4P45A 3FF3A 4ZX9A 1BPMA 2IQ6A 3PBBA 4C86A 4LQGA 4MHNA 1XBUA 3VATA 3V38A 3VH9A 2C6CA 5HVFA 3CPAA 4UIBA 4C8TA 3B3CA 1FT7A 5LRJA 2BO9A 3B2YA 2O53A 4MCQA 1Y7EA 3FVLA 1HEEA 3HUVA 3KQXA 5IR2A 2ABZA 5I4MA 4KSIA 2PCUA 3NH8A 4NGSA 4EWTA 4O23A 4MCRA 1Y9ZA 1CP7A 2IJZA 3VTAA 1YW6A 2DEAA 4PXEA 4JZ0A 1LCPA 2WZNA 2V8DA 2I3CA 4OC3A 4FWUA 2PJBA 1R43A 1LAPA 1YSJA 3IC1A 4NGTA 3CDXA 3PFOA 1HDQA 3PEIA 1CX8A 2PE3A 2QJ8A 4C84A 1KWMA 3BI1A 4FAIA 3KZWA 3D66A 2CTBA 2RB7A 2ANPA 4EMEA 2V8HA 1TXRA 3SJXA 4A94A 4MCSA 4ONWA 4X8IA 4DUKA 4OP4A 1VGYA 3K9TA 4CDJA 2NYQA 3D7FA 4F9VA 3NA6A 4OC0A 4H2KA 1AMPA 1XJOA 1YMEA 3BI0A 2FVGA 2C5QA 4MCPA 4NGRA 3H8GA 5F09A 1LAMA 5LYDA 4YWYA 2ZEGA 4P4JA 1M4LA 4JYWA 5THWA 3IO1A 5LRKA 3KASA 5CPAA 4NGPA 4GM5A 4P4EA 2QVPA 1ZLIA 3IWWA 3D7HA 4RUHA 5ELYA 2POKA 3BXMA 3TC8A 5LYFA 4OC1A 4W9YA 4P4DA 4IK2A 2EK8A 2PJ6A 4P6YA 4TJXA 3LWUA 4C9UA 2PJ2A 2ZEDA 3B3WA 4NGMA 1YLOA 4UIAA 3IIBA 4MHYA 4PXBA 3DGVA 5HXDA 3SJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HDU A;  2AFS A;  1TF9 A;  3RBU A;  3GUX A;  4NFR A;  4R8F A;  4TJV A;  3PB7 X;  1CP6 A;  2GLF A;  5HVH A;  2ZEL A;  1TF8 A;  3NH4 A;  7CPA A;  2ZEN A;  1NSA A;  4PXC A;  8CPA A;  2GU2 A;  3JRU A;  5K8N A;  4ZI6 A;  4CPA A;  5K8M A;  1YW4 A;  4UEZ A;  6CPA A;  2PIY A;  5LYI A;  2PJC A;  1CPX A;  4F8Z A;  3D68 A;  4R6T A;  4TNU A;  4PQA A;  5IB9 A;  1Y0R A;  5LRG A;  2HB6 A;  4OC4 A;  4IAV A;  2XEF A;  2GLJ A;  4P4F A;  4B6Z A;  1PYT B;  2OOT A;  2O4H A;  5JH9 A;  1OBR A;  4PXD A;  3WC7 A;  3PB9 X;  3QNV A;  2JEW A;  2V77 A;  2AFW A;  2CF4 A;  2Q51 A;  1CPS A;  5JM6 A;  4A37 A;  3B3S A;  3PBE A;  4FUU A;  4MHZ A;  1H8L A;  3KHX A;  3B3V A;  4UEE A;  4UF4 A;  1Z8L A;  3K2K A;  4X3R A;  4C99 A;  2PIZ A;  3IEH A;  1DE4 C;  2CIJ A;  2PJ7 A;  2PJ4 A;  3LMS A;  2G9D A;  2BCO A;  3D67 A;  3FX6 A;  4AXV A;  3WC5 A;  1IY7 A;  3KQZ A;  4OID A;  2XEI A;  4WWV A;  1BPN A;  1LAN A;  3VAR A;  4FBE A;  2PJ8 A;  2V8G A;  4OC2 A;  5CBM A;  1PCA A;  2F7V A;  4YN3 A;  1BLL E;  4A38 A;  4C9E A;  4PPZ A;  1Z2L A;  3B35 A;  2ZEM A;  3PB4 X;  5LYL A;  4NGN A;  3KI9 A;  2AFU A;  2XEJ A;  2BOA A;  3S9L A;  3SI0 A;  1XMB A;  1WVM A;  4C9A A;  4OKO A;  1IGB A;  2J9A A;  2V8V A;  3L2N A;  2F8H A;  2ZEE A;  4C85 A;  4ZYQ A;  3RZA A;  2PJ9 A;  4NJR A;  2HC9 A;  1BAV A;  3N5F A;  4MRI A;  4BD9 A;  1DTD A;  1VHE A;  1ZG7 A;  4P4B A;  3KR5 A;  2OR4 A;  3S9N A;  3DLJ A;  3WT4 A;  3HLP A;  2AFO A;  4OME A;  4ZY2 A;  1ZG8 A;  3B7I A;  4ZX8 A;  1LOK A;  4ZY0 A;  2ZEH A;  4DYO A;  4C9V A;  3NFZ A;  3SJF A;  3BHX A;  5K8P A;  1F57 A;  1CBX A;  1VIX A;  4C8A A;  1XFO A;  2C1C A;  4TWE A;  3IJ3 A;  3EIF A;  1ZG9 A;  4P4I A;  2AFM A;  4OIW A;  1FNO A;  4P44 A;  3H8F A;  3CPX A;  3FED A;  1VHO A;  3FEC A;  3SI2 A;  4K3N A;  1F2P A;  2ZEP A;  4G1P A;  5D8N A;  4MMO A;  1RTQ A;  1Z5R A;  3GB0 A;  3ICU A;  3S9M A;  3SI1 A;  1ELM P;  3RAM A;  2JBJ A;  4Z65 A;  4OC5 A;  1CG2 A;  4C8F A;  2Q43 A;  3MN8 A;  3IFE A;  4A39 A;  4KNG E;  2GRE A;  1XF1 A;  1Q7L A;  4R76 A;  3ISX A;  2ZEO A;  1ARM A;  2WYR A;  1EE3 P;  2JBK A;  3NH5 A;  3PFE A;  4MHP A;  2ZOF A;  1ARL A;  1R3N A;  1TKJ A;  3FEE A;  4C9R A;  2NSM A;  4IHM A;  5D29 A;  3MRU A;  2ZEF A;  4MXU A;  3TX8 A;  2XEG A;  2PRQ A;  2C6P A;  4UEF A;  2PJ0 A;  1GYT A;  3KHZ A;  2PJ3 A;  2Q4Z A;  1V6C A;  5K8O A;  4YU9 A;  4CDK A;  3FJU A;  4P10 A;  2AFZ A;  2PVV A;  3PB8 X;  3I6S A;  4R7M A;  4DJL A;  3I1U A;  3D4U A;  1ELL P;  2C6G A;  2PJ5 A;  2CTC A;  3GLJ A;  3FMC A;  2EWB A;  3KR4 A;  3WC6 A;  2PJA A;  2EK9 A;  3WAB A;  3D7G A;  4C8U A;  4C8C A;  2ZOG A;  3FH4 A;  1ZLH A;  3PRT A;  2RFH A;  1LFW A;  2PJ1 A;  3H8E A;  1UWY A;  3D7D A;  3ISZ A;  1JQG A;  1Y0Y A;  3PB6 X;  2QYV A;  2PVW A;  4Q7A A;  5J1Q A;  4EFD A;  2VL1 A;  4C8P A;  3I74 A;  3V7Z A;  4NGQ A;  5DS0 A;  4F9U A;  3KGQ A;  1TKH A;  3CT9 A;  1QQ9 A;  1XRY A;  1AYE A;  3KL9 A;  4WJB A;  1TKF A;  5HVG A;  3SJE A;  3T8W A;  4ZY1 A;  1QMU A;  3B3T A;  2AFX A;  4NJQ A;  4X2T A;  2IMO A;  5JGF A;  1F2O A;  4P45 A;  3FF3 A;  4ZX9 A;  1BPM A;  2IQ6 A;  3PBB A;  4C86 A;  4LQG A;  4MHN A;  1XBU A;  3VAT A;  3V38 A;  3VH9 A;  2C6C A;  5HVF A;  3CPA A;  4UIB A;  4C8T A;  3B3C A;  1FT7 A;  5LRJ A;  2BO9 A;  3B2Y A;  2O53 A;  4MCQ A;  1Y7E A;  3FVL A;  1HEE A;  3HUV A;  3KQX A;  2ABZ A;  5I4M A;  4KSI A;  2PCU A;  3NH8 A;  4NGS A;  4EWT A;  4O23 A;  4MCR A;  1Y9Z A;  1CP7 A;  2IJZ A;  3VTA A;  1YW6 A;  2DEA A;  4PXE A;  4JZ0 A;  1LCP A;  2WZN A;  2V8D A;  2I3C A;  4OC3 A;  4FWU A;  2PJB A;  1R43 A;  1LAP A;  1YSJ A;  3IC1 A;  4NGT A;  3CDX A;  3PFO A;  1HDQ A;  3PEI A;  1CX8 A;  2PE3 A;  2QJ8 A;  4C84 A;  1KWM A;  3BI1 A;  4FAI A;  3KZW A;  3D66 A;  2CTB A;  2RB7 A;  2ANP A;  4EME A;  2V8H A;  1TXR A;  3SJX A;  4A94 A;  4MCS A;  4ONW A;  4X8I A;  4DUK A;  4OP4 A;  1VGY A;  3K9T A;  4CDJ A;  2NYQ A;  3D7F A;  4F9V A;  3NA6 A;  4OC0 A;  4H2K A;  1AMP A;  1XJO A;  1YME A;  3BI0 A;  2FVG A;  4MCP A;  4NGR A;  3H8G A;  5F09 A;  1LAM A;  5LYD A;  4YWY A;  2ZEG A;  4P4J A;  1M4L A;  4JYW A;  5THW A;  3IO1 A;  5LRK A;  3KAS A;  5CPA A;  4NGP A;  4GM5 A;  4P4E A;  2QVP A;  1ZLI A;  3IWW A;  3D7H A;  4RUH A;  5ELY A;  2POK A;  3BXM A;  3TC8 A;  5LYF A;  4OC1 A;  4W9Y A;  4P4D A;  4IK2 A;  2EK8 A;  2PJ6 A;  4P6Y A;  4TJX A;  3LWU A;  4C9U A;  2PJ2 A;  2ZED A;  3B3W A;  4NGM A;  1YLO A;  4UIA A;  3IIB A;  4MHY A;  4PXB A;  3DGV A;  5HXD A;  3SJG A; 
#chains in the Genus database with same CATH topology
 1HDU A;  2GAN A;  2AFS A;  1MJ9 A;  4COG A;  5AG6 A;  1TF9 A;  3RBU A;  4JXR A;  3GUX A;  5F46 A;  2XPO A;  4NFR A;  1XIX A;  4R8F A;  3DR8 A;  3PB7 X;  4TJV A;  4ZBG A;  3TOA A;  1CP6 A;  2GLF A;  1L0C A;  5HVH A;  2ZEL A;  1TF8 A;  3H5Z A;  2Z10 A;  1TIQ A;  1WJT A;  1KUX A;  3NH4 A;  7CPA A;  2ZEN A;  1NSA A;  3ZNI A;  2AJ6 A;  3BJ8 A;  3HMJ G;  4PSW A;  1YR0 A;  4PXC A;  8CPA A;  2GU2 A;  3IWG A;  1KZF A;  2R82 A;  2D0O A;  2Z3P A;  4J0N A;  3JRU A;  1KC7 A;  5K8N A;  4ZI6 A;  4KOV A;  4C2Z A;  1WWZ A;  2PDO A;  4CPA A;  1QSO A;  3TCV A;  4B5P A;  5K8M A;  1YLE A;  1YW4 A;  4UEZ A;  1QSR A;  4LUA A;  3IGR A;  6CPA A;  2PIY A;  4KOS A;  5LYI A;  2PJC A;  3TT2 A;  2XPN A;  1CPX A;  2Y0M A;  2D4P A;  4F8Z A;  4KLW A;  5G20 A;  3D68 A;  4R6T A;  4UWJ A;  2EO8 A;  4A31 A;  4AVC A;  4QC6 A;  4TNU A;  1A9X B;  4PQA A;  2ZW7 A;  3D2M A;  4NEX A;  4CGM A;  1KUY A;  1Y0R A;  1Z4E A;  5LRG A;  4DNC A;  5J8C A;  2HB6 A;  4OC4 A;  1QST A;  4IAV A;  2XEF A;  3SXO A;  1YRE A;  3TLZ A;  4UBR A;  2GLJ A;  4P4F A;  5EMI A;  4B6Z A;  5FD8 A;  1B47 A;  5HKY A;  1PYT B;  2ZXV A;  2OOT A;  4MFK A;  3SXN A;  1S7F A;  2O4H A;  1IYL A;  4C7H A;  5JH9 A;  4BMH A;  3ZJ0 A;  2OB0 A;  3KKW A;  3PLF B;  1PUA A;  2Z3N A;  4UCP A;  3G3S A;  5BY0 A;  3RO0 A;  1IOF A;  3LAC A;  3NE8 A;  4F0X A;  2ARH A;  1OBR A;  4PXD A;  3WC7 A;  4A2Z A;  4CAF A;  3PB9 X;  3QNV A;  1CE8 B;  4XPD C;  2JEW A;  1RXT A;  2V77 A;  2AFW A;  2CF4 A;  4FD7 A;  3W91 A;  2XPL A;  2Q51 A;  1CPS A;  1NMT A;  5AG4 A;  5JM6 A;  4MI1 A;  5DWM A;  2FL4 A;  1BO4 A;  4A37 A;  3B3S A;  3T07 A;  3SHP A;  2ZPA A;  1S5K A;  2P0W A;  3PBE A;  3DR6 A;  4FUU A;  3O8Z A;  2MP0 A;  4FD5 A;  4MHZ A;  1H8L A;  1M4I A;  1XEB A;  3KHX A;  2CNM A;  4BPU B;  3B3V A;  4UEE A;  5GCN A;  5HKW A;  4JD6 A;  4MFP A;  1QSM A;  3F9K C;  1Z8L A;  3DSB A;  4UF4 A;  3K2K A;  4X3R A;  3VRQ A;  4MY3 A;  2XPP A;  4IIY A;  2GP4 A;  1U6M A;  4C99 A;  1KUV A;  3VRO A;  2PIZ A;  1ZO0 A;  3F0A A;  1DE4 C;  2CIJ A;  2PJ7 A;  3IEH A;  4HNY B;  4IF5 A;  4LQ6 A;  3EZA A;  2PJ4 A;  3LMS A;  2DXQ A;  2G9D A;  3TTH A;  2BCO A;  4B5P B;  2YNC A;  3D67 A;  2QIR A;  3FX6 A;  1CS0 B;  4I49 A;  4F0Y A;  4AXV A;  3WC5 A;  1ZYM A;  1IY7 A;  2OU2 A;  2NMT A;  3KQZ A;  1T36 B;  4OID A;  2BEI A;  3QAY A;  2VXK A;  2XEI A;  4WWV A;  3TFY A;  1BPN A;  1LAN A;  4Y49 B;  2VEZ A;  5F47 A;  3VAR A;  4FBE A;  1IB1 E;  3KRV A;  1Z8T A;  4HNW B;  4MBU A;  2PJ8 A;  4F6A A;  2V8G A;  4OC2 A;  2PR8 A;  4IUS A;  4YRH A;  3R96 A;  4JWP A;  4M8D A;  5G21 A;  5CBM A;  2GE3 A;  3TLE A;  4NSQ A;  1PCA A;  2F7V A;  3FYN A;  4M85 A;  4YN3 A;  2PC1 A;  1BLL E;  3EO4 A;  2YND A;  4A38 A;  1X12 A;  3I9S A;  4C9E A;  4ZGY B;  4PPZ A;  3G23 A;  1LRZ A;  2CNT A;  3P2H A;  1Z2L A;  3B35 A;  1I1D A;  2ZEM A;  3PB4 X;  1PU9 A;  5LYL A;  1M1D A;  4YGO A;  5H84 A;  4KSA A;  3T5M A;  2HI6 A;  1A2Z A;  4NGN A;  1UFH A;  3KI9 A;  4HNX B;  2AFU A;  5J8F A;  2XEJ A;  2BOA A;  4GPL B;  3C26 A;  4J3G A;  3S9L A;  3FBU A;  2OZG A;  4CAW A;  2X0S A;  2PCN A;  2ODF A;  3SI0 A;  4NF1 A;  1XMB A;  4BTF A;  4B12 A;  5IV0 A;  1WVM A;  5A28 A;  4KZT A;  4C9A A;  4AG7 A;  4OKO A;  1IGB A;  1WK4 A;  3TOB A;  2J9A A;  3ZZI A;  3TLG A;  2ZW6 A;  2FXF A;  1YX0 A;  2V8V A;  3L2N A;  2F8H A;  4CZ1 A;  2AUM A;  5AXI A;  3N7Z A;  3PFV A;  2ZEE A;  3QB8 A;  1YGH A;  2VBQ A;  4NCZ A;  4C85 A;  5JPH A;  4KVX A;  4ZYQ A;  1KBL A;  3RZA A;  2PJ9 A;  4NJR A;  2Q4V A;  2HC9 A;  4U9Y A;  1BAV A;  1EZB A;  3N5F A;  1XE4 A;  4MRI A;  1BXR B;  4BD9 A;  1DTD A;  1VHE A;  1Y9K A;  1ZG7 A;  4P4B A;  5JVL A;  3EC4 A;  3NE7 A;  5EBV A;  5H86 A;  1M44 A;  4E2A A;  2OH1 A;  2OR4 A;  3KR5 A;  1Z9U A;  3GJZ A;  3S9N A;  4A4C A;  1Q5X A;  3DLJ A;  3TLB A;  5F13 A;  3CXQ A;  2BL1 A;  3FNC A;  4RN7 A;  4BIN A;  3WT4 A;  5K99 A;  4MY0 A;  3HLP A;  2D0P A;  2Z3M A;  4UCM A;  2AFO A;  4OME A;  4XPL A;  4ZY2 A;  4UFW A;  3GYA A;  1ZG8 A;  3B7I A;  4ZX8 A;  4U5Y A;  1LOK A;  4ZY0 A;  2ZEH A;  1IU8 A;  4DYO A;  3NFZ A;  3SJF A;  4C9V A;  3R9F A;  4E5S A;  4ONU A;  3BHX A;  2Z11 A;  1VBH A;  5K8P A;  1F57 A;  1Q2Y A;  1YK3 A;  1CBX A;  3DNS A;  1YVO A;  3JTK A;  4KUB A;  4B10 A;  1VIX A;  4C8A A;  1XFO A;  1YVK A;  1Z4R A;  2C1C A;  4TWE A;  2OZU A;  2VI7 A;  3IJ3 A;  1S60 A;  2FSR A;  2VZY A;  1XOV A;  1ZG9 A;  4P4I A;  2AFM A;  3LD2 A;  4NXY A;  4OIW A;  3EIF A;  3BUO B;  2EZC A;  5F9M A;  2DIK A;  2VQY A;  5I0C A;  1FNO A;  2REF A;  4P44 A;  3H8F A;  3CPX A;  3FED A;  2JDC A;  4BPW B;  4A33 A;  1VHO A;  3BUW B;  3FEC A;  3SI2 A;  2J8R A;  1F2P A;  1Q2C A;  2ZEP A;  3D8P A;  4G1P A;  4K3N A;  5D8N A;  4MMO A;  1RTQ A;  2Q7S A;  5JYB A;  4Y49 C;  1Z5R A;  2X7B A;  3I3G A;  4RR2 B;  2A4N A;  2B3U A;  3GB0 A;  4CAX A;  5F1Y A;  3TLY A;  1QSN A;  3ICU A;  1CM0 A;  1DIK A;  3S9M A;  3SI1 A;  1ELM P;  3RAM A;  3QAH A;  4M6I A;  3TLA A;  2JBJ A;  4Z65 A;  4OC5 A;  1CG2 A;  4C8F A;  2PQ8 A;  3BUN B;  1Y9W A;  1BOB A;  1X10 A;  2Q43 A;  1M4G A;  3TLG B;  4PK3 A;  1P4N A;  3MN8 A;  3IFE A;  4A39 A;  2JEV A;  2JLM A;  4KNG E;  2Q4Y A;  1IOI A;  2GRE A;  4CGO A;  1XF1 A;  1Q7L A;  2FIA A;  2YJV A;  4R76 A;  4HPS A;  4RI1 A;  3ISX A;  2ZEO A;  4MFJ A;  4UFV A;  2N3A B;  4BPX B;  1I12 A;  2QEC A;  1ARM A;  1IYK A;  2DPT A;  2WYR A;  4X5K A;  2K5T A;  1EE3 P;  2J8M A;  4U9Z A;  2JBK A;  2EVN A;  3NH5 A;  3PFE A;  2ZOF A;  2KCW A;  4MHP A;  1XMT A;  4OAE A;  1ARL A;  1R3N A;  1TKJ A;  3R9E A;  3FEE A;  3S6K A;  4CGP A;  1C30 B;  2CXA A;  4C9R A;  3CXP A;  3VWD A;  2NSM A;  2R8V A;  4IHM A;  4MFL A;  1CJW A;  5D29 A;  1MJB A;  3MRU A;  5E96 A;  2FIW A;  2HV2 A;  4L89 A;  2B5G A;  2R1I A;  2ZEF A;  3FIX A;  4KOU A;  2R98 A;  2G3A A;  4MXU A;  3S6H A;  5AG7 A;  2B4J C;  2O28 A;  2XEG A;  2WUU A;  3TX8 A;  5C88 A;  2ZW5 A;  2PRQ A;  2C6P A;  1JDB C;  3P2F A;  4UEF A;  3PT1 A;  3T9Y A;  2PJ0 A;  3T05 A;  5KTC A;  3OWC A;  1GYT A;  3KHZ A;  4PK2 A;  2PJ3 A;  1VKC A;  3OP0 A;  3T90 A;  4MHD A;  1M6V B;  2Q4Z A;  2YNC C;  5DWN A;  3RNZ A;  4KOX A;  4H6U A;  1MK4 A;  4GXH A;  1V6C A;  3CXS A;  4C2X A;  2UV8 G;  2ZW4 A;  4XNH B;  5K8O A;  4YU9 A;  4CDK A;  2I00 A;  3FJU A;  2FE7 A;  4P10 A;  4H89 A;  2OLS A;  2D4O A;  2AFZ A;  4FD6 A;  4PV6 A;  4XPK A;  2PVV A;  3PB8 X;  3I6S A;  1R57 A;  5AGE A;  4EYS A;  4R7M A;  4DJL A;  3I1U A;  2Z0Z A;  4CRZ B;  3D4U A;  5IX3 A;  1ELL P;  4OLL A;  2C6G A;  5HMN A;  4KS9 A;  1VBG A;  2PJ5 A;  2CTC A;  3GLJ A;  3FMC A;  2EWB A;  3KR4 A;  2C27 A;  4KOW A;  3WC6 A;  4MJX A;  2PJA A;  3EFA A;  2EK9 A;  2G3T A;  3D7G A;  3WAB A;  4C8C A;  2ZOG A;  4C8U A;  2Z3K A;  1GHE A;  1ZLH A;  1VHS A;  3FH4 A;  2RFH A;  2IL4 A;  3PRT A;  1LFW A;  2FS5 A;  2PJ1 A;  4C7I A;  3H8E A;  1UWY A;  3WR7 A;  3D7D A;  3VH9 A;  3ISZ A;  1JQG A;  1Y7R A;  3U1B A;  2J8N A;  1IID A;  1Y0Y A;  3PB6 X;  2QYV A;  3EZB A;  3TO6 A;  2PVW A;  2P6E A;  4Q7A A;  1P0H A;  5J1Q A;  2G0B A;  4EFD A;  2VL1 A;  3PZJ A;  5JQ4 A;  5IB0 A;  3TLC A;  4UFX A;  3I74 A;  4C8P A;  3V7Z A;  4IIX A;  4CAV A;  4NGQ A;  3NOJ A;  5DS0 A;  3LOD A;  4OAD A;  3OB1 B;  2B5G B;  3KGQ A;  4R57 A;  4F9U A;  1TKH A;  4M6G A;  1ZRS A;  3CT9 A;  1EZA A;  1QQ9 A;  1XRY A;  1AYE A;  3A9L A;  4KVM E;  4R3K A;  3VWE A;  4CYQ A;  3KL9 A;  4PSX A;  4WJB A;  5F5X A;  1TKF A;  2B3V A;  5HVG A;  3SJE A;  3T8W A;  4ZY1 A;  4CGN A;  2Q04 A;  1QMU A;  3B3T A;  4KOR A;  2AFX A;  4MI4 A;  4NJQ A;  4BBH A;  4X2T A;  2IMO A;  2JDD A;  1M4D A;  4CS0 B;  5FVJ A;  1F2O A;  5JGF A;  2Q44 A;  4P45 A;  1AUG A;  2P6F A;  3FF3 A;  2H5M A;  3B8G A;  4LX9 A;  5AG5 A;  1BPM A;  2IQ6 A;  4ZX9 A;  3R95 A;  3EZE A;  2ATR A;  1ON0 A;  1Z8X A;  3FB3 A;  5F48 A;  1ZL0 A;  2EZA A;  3C8O A;  4JLY A;  3OAK A;  3W6S A;  5KTA A;  3PBB A;  1RO5 A;  4AB7 A;  4C86 A;  3UY5 A;  4LQG A;  4MHN A;  3V8I A;  3F8K A;  3GIU A;  1XBU A;  3VAT A;  5HKZ A;  3V38 A;  2C6C A;  4GS4 A;  1J4J A;  1I21 A;  4JXQ A;  5HVF A;  3CPA A;  4UIB A;  2GFQ A;  2EZB A;  2PR1 A;  4C8T A;  2QML A;  3B3C A;  2EBJ A;  1FT7 A;  5LRJ A;  1YQE A;  2BO9 A;  2YJT A;  4CO9 A;  3B2Y A;  2O53 A;  4MCQ A;  1NSL A;  4MFQ A;  1YVH A;  2B0A A;  3HPG G;  3GY9 A;  1Y7E A;  3PP9 A;  1B87 A;  1B6B A;  2B4D A;  3FVL A;  4ORF A;  2Q7B A;  1HEE A;  3HUV A;  3KQX A;  2DF5 A;  4K30 A;  4QB9 A;  4B13 A;  2VKZ G;  4YFJ A;  2ABZ A;  2GIV A;  5IR2 A;  5I4M A;  4KSI A;  3S6F A;  1C3O B;  1S7K A;  1NXJ A;  2PCU A;  3NH8 A;  4NGS A;  4EWT A;  2Y1M A;  2HQY A;  4O23 A;  4RS2 A;  2FCK A;  4INJ A;  1IIC A;  2Z3O A;  3G8W A;  4MCR A;  4E8O A;  1Y9Z A;  1CP7 A;  3K9U A;  3IU1 A;  4XNH C;  3D3S A;  3BUM B;  2IJZ A;  2E28 A;  4JVO A;  1K4J A;  3VTA A;  4R9M A;  4A32 A;  1YW6 A;  2DEA A;  4PXE A;  4JZ0 A;  1LCP A;  2WZN A;  2B58 A;  4C68 A;  2V8D A;  5IB9 A;  4R3L A;  1S7L A;  2I3C A;  4E0A A;  1XF8 A;  4OC3 A;  3TYX A;  4FWU A;  3R9G A;  3TO7 A;  1JWQ A;  3H4Q A;  1SQH A;  1V0C A;  2PJB A;  1R43 A;  1LAP A;  2HUZ A;  2DLA A;  2P6G A;  1YSJ A;  5HH1 A;  2WPX A;  3IC1 A;  4NGT A;  3SR3 A;  3EY5 A;  4KOT A;  4KLV A;  1Z9E A;  4KVO E;  3CDX A;  3W6X A;  3IU2 A;  5CNP A;  1GGO A;  2FT0 A;  4KOY A;  4A95 A;  3PFO A;  1HDQ A;  3PEI A;  5J3X A;  2PSW A;  1CX8 A;  2PE3 A;  2QJ8 A;  4C84 A;  4R87 A;  1KWM A;  1Q2D A;  4HKF A;  4A30 A;  3BI1 A;  3DDD A;  3PGP A;  2OZH A;  4FAI A;  1EO0 A;  4CYO A;  4L8A A;  2YNE A;  5G22 A;  2HWG A;  3R1K A;  3T0T A;  3KZW A;  4E94 A;  3D66 A;  2CTB A;  2RB7 A;  2ANP A;  5F49 A;  2DPS A;  4EME A;  3EXN A;  2FM4 A;  2V8H A;  4MJ8 A;  3VRP A;  1TXR A;  3JUW A;  1VI4 A;  3D2P A;  3SJX A;  5G1Z A;  4A94 A;  4MCS A;  1S7N A;  1OZP A;  1KEE B;  4ONW A;  4X8I A;  4AVB A;  4EVY A;  1MJA A;  4CYP A;  4DUK A;  4OP4 A;  3E0K A;  1VGY A;  3K9T A;  4CDJ A;  2NYQ A;  3D7F A;  4F9V A;  3U88 C;  1Z8W A;  3NA6 A;  2B4D B;  4H1H A;  3BLN A;  2Y1N A;  4OC0 A;  4II9 A;  4H2K A;  1AMP A;  1XJO A;  4UA3 A;  1YME A;  4COB A;  1NBW A;  3BI0 A;  2Z3L A;  2FVG A;  4KUA A;  5A27 A;  2C5Q A;  3VGO A;  4MCP A;  3NFQ A;  3OB2 B;  2CY2 A;  4NGR A;  3H8G A;  5F09 A;  2VZZ A;  1LAM A;  2WPW A;  4YWY A;  5LYD A;  3RYO A;  4CYN A;  4QBJ A;  2ZEG A;  1J3L A;  4P4J A;  1M4L A;  4QUS A;  4AVA A;  4JYW A;  2BUE A;  5THW A;  1FBV A;  4H6Z A;  3IO1 A;  2WSA A;  5LRK A;  3KAS A;  5CPA A;  4NGP A;  2AE6 A;  2B4B A;  3S6G A;  2HRO A;  2PRB A;  4GM5 A;  4P4E A;  2BSW A;  3BUX B;  3BJ7 A;  2QVP A;  1ZLI A;  3GKR A;  4Q36 A;  4JJX A;  3F5B A;  3IWW A;  2I79 A;  4CGL A;  3D7H A;  4RUH A;  1JDE A;  4XPD B;  4B11 A;  1S3Z A;  5KTD A;  3MGD A;  5ELY A;  3K4I A;  3VRN A;  2POK A;  3BXM A;  3JVN A;  4CRY B;  3TC8 A;  5LYF A;  4OC1 A;  2REE A;  4AG9 A;  3HPH E;  2CNS A;  2CBL A;  5C82 A;  4W9Y A;  4P4D A;  4IK2 A;  1NE9 A;  2EK8 A;  2PJ6 A;  4P6Y A;  4TJX A;  4A4B A;  1FY7 A;  3LWU A;  2PJ2 A;  4C9U A;  4KSF A;  1R61 A;  2ZED A;  4MFZ A;  4M3S A;  3FRM A;  4CAE A;  4B14 A;  3IWE A;  4UWI A;  3B3W A;  4NGM A;  3CZX A;  4B5O A;  2AUN A;  2R7H A;  1YLO A;  2Q0Y A;  5BWA B;  4QVT A;  4Q38 A;  4M6H A;  4UIA A;  3TO9 A;  1N71 A;  3IIB A;  4MHY A;  2EUI A;  2F5I A;  3FXT A;  4FD4 A;  4PXB A;  4UCN A;  3DGV A;  5HXD A;  5ISV A;  3TE4 A;  5EC4 A;  3SJG A;  3VRR A;  2YGW A;  4C2Y A;  2RC4 A; 
#chains in the Genus database with same CATH homology
 1HDU A;  2AFS A;  1TF9 A;  3RBU A;  3GUX A;  4NFR A;  4R8F A;  4TJV A;  3PB7 X;  1CP6 A;  2GLF A;  5HVH A;  2ZEL A;  1TF8 A;  3NH4 A;  7CPA A;  2ZEN A;  1NSA A;  4PXC A;  8CPA A;  2GU2 A;  3JRU A;  5K8N A;  4ZI6 A;  4CPA A;  5K8M A;  1YW4 A;  4UEZ A;  6CPA A;  2PIY A;  5LYI A;  2PJC A;  1CPX A;  4F8Z A;  3D68 A;  4R6T A;  4TNU A;  4PQA A;  5IB9 A;  1Y0R A;  5LRG A;  2HB6 A;  4OC4 A;  4IAV A;  2XEF A;  2GLJ A;  4P4F A;  4B6Z A;  1PYT B;  2OOT A;  2O4H A;  5JH9 A;  1OBR A;  4PXD A;  3WC7 A;  3PB9 X;  3QNV A;  2JEW A;  2V77 A;  2AFW A;  2CF4 A;  2Q51 A;  1CPS A;  5JM6 A;  4A37 A;  3B3S A;  3PBE A;  4FUU A;  4MHZ A;  1H8L A;  3KHX A;  3B3V A;  4UEE A;  4UF4 A;  1Z8L A;  3K2K A;  4X3R A;  2GP4 A;  4C99 A;  2PIZ A;  3IEH A;  1DE4 C;  2CIJ A;  2PJ7 A;  2PJ4 A;  3LMS A;  2G9D A;  2BCO A;  3D67 A;  3FX6 A;  4AXV A;  3WC5 A;  1IY7 A;  3KQZ A;  4OID A;  2XEI A;  4WWV A;  1BPN A;  1LAN A;  3VAR A;  4FBE A;  2PJ8 A;  2V8G A;  4OC2 A;  5CBM A;  1PCA A;  2F7V A;  4YN3 A;  1BLL E;  4A38 A;  4C9E A;  4PPZ A;  1Z2L A;  3B35 A;  2ZEM A;  3PB4 X;  5LYL A;  4NGN A;  3KI9 A;  2AFU A;  2XEJ A;  2BOA A;  3S9L A;  3SI0 A;  1XMB A;  1WVM A;  4C9A A;  4OKO A;  1IGB A;  2J9A A;  2V8V A;  3L2N A;  2F8H A;  2ZEE A;  4C85 A;  4ZYQ A;  3RZA A;  2PJ9 A;  4NJR A;  2HC9 A;  1BAV A;  3N5F A;  4MRI A;  4BD9 A;  1DTD A;  1VHE A;  1ZG7 A;  4P4B A;  3KR5 A;  2OR4 A;  3S9N A;  3DLJ A;  3WT4 A;  3HLP A;  2AFO A;  4OME A;  4ZY2 A;  1ZG8 A;  3B7I A;  4ZX8 A;  1LOK A;  4ZY0 A;  2ZEH A;  4DYO A;  4C9V A;  3NFZ A;  3SJF A;  3BHX A;  5K8P A;  1F57 A;  1CBX A;  1VIX A;  4C8A A;  1XFO A;  2C1C A;  4TWE A;  3IJ3 A;  3EIF A;  1ZG9 A;  4P4I A;  2AFM A;  4OIW A;  1FNO A;  4P44 A;  3H8F A;  3CPX A;  3FED A;  1VHO A;  3FEC A;  3SI2 A;  4K3N A;  1F2P A;  2ZEP A;  4G1P A;  5D8N A;  4MMO A;  1RTQ A;  1Z5R A;  3GB0 A;  3ICU A;  3S9M A;  3SI1 A;  1ELM P;  3RAM A;  2JBJ A;  4Z65 A;  4OC5 A;  1CG2 A;  4C8F A;  2Q43 A;  3MN8 A;  3IFE A;  4A39 A;  4KNG E;  2GRE A;  1XF1 A;  1Q7L A;  4R76 A;  3ISX A;  2ZEO A;  1ARM A;  2WYR A;  1EE3 P;  2JBK A;  3NH5 A;  3PFE A;  4MHP A;  2ZOF A;  1ARL A;  1R3N A;  1TKJ A;  3FEE A;  4C9R A;  2NSM A;  4IHM A;  5D29 A;  3MRU A;  2ZEF A;  4MXU A;  3TX8 A;  2XEG A;  2PRQ A;  2C6P A;  4UEF A;  2PJ0 A;  1GYT A;  3KHZ A;  2PJ3 A;  2Q4Z A;  1V6C A;  5K8O A;  4YU9 A;  4CDK A;  3FJU A;  4P10 A;  2AFZ A;  2PVV A;  3PB8 X;  3I6S A;  4R7M A;  4DJL A;  3I1U A;  3D4U A;  1ELL P;  2C6G A;  2PJ5 A;  2CTC A;  3GLJ A;  3FMC A;  2EWB A;  3KR4 A;  3WC6 A;  2PJA A;  2EK9 A;  3WAB A;  3D7G A;  4C8U A;  4C8C A;  2ZOG A;  3FH4 A;  1ZLH A;  3PRT A;  2RFH A;  1LFW A;  2PJ1 A;  3H8E A;  1UWY A;  3D7D A;  3ISZ A;  1JQG A;  1Y0Y A;  3PB6 X;  2QYV A;  2PVW A;  4Q7A A;  5J1Q A;  4EFD A;  2VL1 A;  4C8P A;  3I74 A;  3V7Z A;  4NGQ A;  5DS0 A;  4F9U A;  3KGQ A;  1TKH A;  3CT9 A;  1QQ9 A;  1XRY A;  1AYE A;  3KL9 A;  4WJB A;  1TKF A;  5HVG A;  3SJE A;  3T8W A;  4ZY1 A;  1QMU A;  3B3T A;  2AFX A;  4NJQ A;  4X2T A;  2IMO A;  5JGF A;  1F2O A;  4P45 A;  3FF3 A;  4ZX9 A;  1BPM A;  2IQ6 A;  3PBB A;  4C86 A;  4LQG A;  4MHN A;  1XBU A;  3VAT A;  3V38 A;  3VH9 A;  2C6C A;  5HVF A;  3CPA A;  4UIB A;  4C8T A;  3B3C A;  1FT7 A;  5LRJ A;  2BO9 A;  3B2Y A;  2O53 A;  4MCQ A;  1Y7E A;  3FVL A;  1HEE A;  3HUV A;  3KQX A;  5IR2 A;  2ABZ A;  5I4M A;  4KSI A;  2PCU A;  3NH8 A;  4NGS A;  4EWT A;  4O23 A;  4MCR A;  1Y9Z A;  1CP7 A;  2IJZ A;  3VTA A;  1YW6 A;  2DEA A;  4PXE A;  4JZ0 A;  1LCP A;  2WZN A;  2V8D A;  2I3C A;  4OC3 A;  4FWU A;  2PJB A;  1R43 A;  1LAP A;  1YSJ A;  3IC1 A;  4NGT A;  3CDX A;  3PFO A;  1HDQ A;  3PEI A;  1CX8 A;  2PE3 A;  2QJ8 A;  4C84 A;  1KWM A;  3BI1 A;  4FAI A;  3KZW A;  3D66 A;  2CTB A;  2RB7 A;  2ANP A;  4EME A;  2V8H A;  1TXR A;  3SJX A;  4A94 A;  4MCS A;  4ONW A;  4X8I A;  4DUK A;  4OP4 A;  1VGY A;  3K9T A;  4CDJ A;  2NYQ A;  3D7F A;  4F9V A;  3NA6 A;  4OC0 A;  4H2K A;  1AMP A;  1XJO A;  1YME A;  3BI0 A;  2FVG A;  2C5Q A;  4MCP A;  4NGR A;  3H8G A;  5F09 A;  1LAM A;  5LYD A;  4YWY A;  2ZEG A;  4P4J A;  1M4L A;  4JYW A;  5THW A;  3IO1 A;  5LRK A;  3KAS A;  5CPA A;  4NGP A;  4GM5 A;  4P4E A;  2QVP A;  1ZLI A;  3IWW A;  3D7H A;  4RUH A;  5ELY A;  2POK A;  3BXM A;  3TC8 A;  5LYF A;  4OC1 A;  4W9Y A;  4P4D A;  4IK2 A;  2EK8 A;  2PJ6 A;  4P6Y A;  4TJX A;  3LWU A;  4C9U A;  2PJ2 A;  2ZED A;  3B3W A;  4NGM A;  1YLO A;  4UIA A;  3IIB A;  4MHY A;  4PXB A;  3DGV A;  5HXD A;  3SJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...