4OC3A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cfibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(furan-2-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc3A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc3A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc3A02
2F7VA 2PIYA 4NJQA 3SI2A 4UEEA 2PJCA 3RBUA 2EK8A 3NH8A 3D68A 3D7DA 4PXEA 3PB7X 3KR4A 1CX8A 1ARMA 5CPAA 1TKHA 1BPNA 3KGQA 2XEJA 4A38A 1CP7A 1TKFA 2PVVA 2PJ5A 1CPSA 4Q7AA 1ARLA 3PRTA 3SI1A 2V77A 4C9RA 1Z5RA 2AFZA 3VTAA 2ZENA 4X8IA 1LAPA 2CTCA 4OMEA 2PJ2A 4X2TA 2C6PA 2PJ3A 1CG2A 2WYRA 4ZYQA 1FNOA 3D7HA 3PFEA 1TKJA 3EIFA 5LRJA 3D4UA 3DGVA 3B3SA 2NSMA 4IAVA 3FF3A 4CDJA 1PYTB 1Z8LA 4C86A 2ZEMA 3VH9A 3NA6A 2O53A 1F57A 4P4EA 5THWA 1GYTA 1ZG8A 4LQGA 5LRKA 3PB6X 1TXRA 4DUKA 5DS0A 2BO9A 3CPXA 4DJLA 2ZEHA 1R43A 4OC4A 3GLJA 3PBBA 5JH9A 3PB8X 4MXUA 4R76A 2AFMA 3SI0A 4P45A 4ZY1A 3SJGA 3ICUA 1HDQA 5HVHA 2ANPA 2ZELA 3V38A 3PB9X 1VIXA 2RB7A 3FEDA 1NSAA 4TJXA 2V8VA 4OIDA 1YMEA 3N5FA 2BCOA 4MHNA 5LYDA 2PE3A 1TF9A 4AXVA 4MCPA 2PRQA 4C8PA 1FT7A 4C8TA 5I4MA 3D66A 3GB0A 2IQ6A 2DEAA 2GREA 1LOKA 4OC2A 3CT9A 1QMUA 1YSJA 3LWUA 4CDKA 4MMOA 3IEHA 4C8CA 3KHZA 2V8HA 4MCQA 3HUVA 4F8ZA 4ZY2A 1HEEA 3JRUA 1EE3P 1LANA 4UF4A 3PBEA 3B35A 4OC1A 3BHXA 1XRYA 2POKA 4GM5A 5LYIA 4CPAA 3KQZA 5HVGA 2JEWA 2ZEFA 4R6TA 4BD9A 3VARA 1XFOA 5IB9A 2BOAA 1VHOA 4MHZA 3K2KA 2PJBA 3FVLA 5JM6A 4OC3A 3MN8A 3KASA 2QVPA 3BXMA 3PEIA 4PPZA 4YU9A 2EK9A 3IFEA 3KZWA 2IJZA 2EWBA 4TJVA 4KNGE 1F2OA 3FX6A 4R8FA 3S9MA 3NFZA 1IY7A 3L2NA 3T8WA 4NGNA 4DYOA 4EMEA 4F9UA 1LCPA 1Y9ZA 3WC7A 1TF8A 1PCAA 2RFHA 3WC6A 1XF1A 1R3NA 4PQAA 5ELYA 2ZEPA 4C9EA 2PJ0A 4IHMA 1V6CA 8CPAA 3IIBA 3KI9A 1ZG7A 3WC5A 4IK2A 5LYFA 1LFWA 4B6ZA 2AFSA 1ELLP 4FBEA 1F2PA 4C84A 1YW6A 4UIBA 2HB6A 2AFOA 2QJ8A 3D67A 2CF4A 3FMCA 2PVWA 2V8GA 3S9LA 2PJ4A 2XEIA 3NH4A 1JQGA 3IWWA 2NYQA 3I74A 4JYWA 2XEGA 3B3TA 3DLJA 3KR5A 2O4HA 4C9AA 2CTBA 1BPMA 3WT4A 4YN3A 1WVMA 2F8HA 1KWMA 3CPAA 4MHYA 3KL9A 2AFUA 3FECA 1Z2LA 4A94A 4EWTA 2C1CA 4WJBA 1YLOA 4FWUA 4WWVA 5JGFA 4C8AA 4OC0A 2FVGA 2OR4A 2PIZA 3KHXA 4UEZA 3FH4A 2ABZA 1IGBA 3QNVA 5LYLA 3KQXA 1Y0YA 3WABA 4NGSA 5CBMA 1BLLE 2GLFA 4X3RA 3B3VA 4MRIA 4ZI6A 1YW4A 3TC8A 4PXCA 3V7ZA 3H8EA 4OKOA 4RUHA 2Q43A 2XEFA 4P4IA 2PJ1A 1Y0RA 4EFDA 4MCRA 1QQ9A 4W9YA 1DTDA 5HVFA 2G9DA 3TX8A 1UWYA 5F09A 3PFOA 4NGMA 4ZX9A 4P4DA 5D8NA 1Y7EA 2ZEGA 4C99A 1ZG9A 2ZOFA 4OC5A 3B7IA 1ZLIA 2IMOA 1LAMA 2PJ9A 4NGTA 4KSIA 4P4FA 4NJRA 4PXDA 4P6YA 4R7MA 2ZEDA 4TWEA 3H8GA 2JBJA 5K8OA 3SJEA 3SJFA 4JZ0A 2AFXA 5J1QA 3BI0A 4OIWA 4NFRA 4UIAA 3D7FA 2HC9A 5K8PA 3HLPA 4Z65A 4FUUA 4C9UA 2C6CA 4P4BA 2PJAA 4TNUA 4NGQA 2PJ6A 1AMPA 4FAIA 3B3WA 2JBKA 1XBUA 4K3NA 4ZY0A 3RZAA 5LRGA 2C6GA 2V8DA 3FJUA 2OOTA 3ISZA 3D7GA 3NH5A 5K8NA 2CIJA 1CBXA 2GU2A 4YWYA 3IJ3A 5K8MA 4ZX8A 2Q4ZA 1H8LA 4MHPA 3LMSA 2Q51A 1DE4C 3B2YA 4C8UA 2ZEEA 3BI1A 3IC1A 3RAMA 2VL1A 2QYVA 4P10A 3CDXA 1VHEA 6CPAA 5D29A 3SJXA 3K9TA 1XJOA 2ZEOA 5HXDA 4ONWA 1VGYA 2ZOGA 2GLJA 2I3CA 4A37A 1M4LA 4NGRA 7CPAA 3I1UA 2PCUA 4C9VA 3FEEA 1OBRA 2PJ8A 1RTQA 1ZLHA 4OP4A 4H2KA 3I6SA 4A39A 1XMBA 2J9AA 2WZNA 1CP6A 4UEFA 3H8FA 2PJ7A 3GUXA 1Q7LA 1CPXA 3IO1A 1HDUA 4P4JA 4P44A 3PB4X 4G1PA 4C85A 3VATA 4NGPA 4F9VA 4O23A 1ELMP 4MCSA 4PXBA 2AFWA 3ISXA 3S9NA 1AYEA 4C8FA 3B3CA 3MRUA 1BAVA
chains in the Genus database with same CATH superfamily
2FSRA 2F7VA 1Y9KA 2PIYA 4NJQA 3MGDA 5AG5A 1Z8TA 5G21A 3SI2A 4U9YA 4J3GA 4UEEA 2PJCA 3W6SA 3RBUA 4BMHA 1J4JA 3BUXB 2EK8A 3FXTA 3NH8A 2B0AA 3D68A 2XPPA 1C30B 3D7DA 2XPOA 2ZW5A 3TLYA 1M44A 2GIVA 4PXEA 2UV8G 3O8ZA 3IU1A 2DF5A 3PB7X 4KSFA 3KR4A 3GY9A 1CX8A 1ARMA 5CPAA 1TKHA 4CGLA 3SR3A 2EBJA 2Z3OA 1BPNA 4Q38A 3KGQA 1B87A 3S6FA 2XEJA 4A38A 4ZGYB 1CP7A 1TKFA 2PVVA 2PJ5A 4H1HA 1CPSA 1ZO0A 4Q7AA 1ARLA 3PRTA 3SI1A 2V77A 4M6IA 4CAWA 4CRYB 4C9RA 1Z5RA 1V0CA 2AFZA 4MI4A 4NCZA 4A2ZA 5J8FA 3JUWA 3U88C 4M85A 3VTAA 2ZENA 5HKWA 4X8IA 1LAPA 2CTCA 2D4OA 3H5ZA 3WR7A 2YNCC 4IIXA 4OMEA 2PJ2A 4X2TA 2C6PA 2PJ3A 3PP9A 4PK2A 3TO7A 3TLZA 1CG2A 2OU2A 2WYRA 4ZYQA 1FNOA 2CXAA 2OZHA 4OADA 1ZYMA 2FIWA 1KBLA 2HROA 3D7HA 3PFEA 1TKJA 3DNSA 4UWIA 1YVHA 5GCNA 5DWMA 4F6AA 2B4DA 3EIFA 2J8MA 2JEVA 5LRJA 3D4UA 1EZBA 3DGVA 3SXNA 3S6HA 3B3SA 1WJTA 3TOBA 3F0AA 2NSMA 4IAVA 3FF3A 1MK4A 2X7BA 4UBRA 2P0WA 3FIXA 1PYTB 4CDJA 1Z8LA 3HPHE 1IB1E 1YREA 2WUUA 4C86A 2ZEMA 2DPTA 3BLNA 5KTDA 3VH9A 3SXOA 3NA6A 4L89A 2CNSA 3PLFB 2O53A 1BXRB 4LUAA 1F57A 1Z4EA 4UCMA 4P4EA 5THWA 3QB8A 1GYTA 3TLGA 1ZG8A 4FD5A 4LQGA 5LRKA 2Z3NA 2CBLA 2Y1MA 3FBUA 3PB6X 2YJTA 1TXRA 2FS5A 4MJXA 4DUKA 2CY2A 2DXQA 2D0PA 5DS0A 4UFVA 1R57A 2BO9A 3CPXA 4DJLA 2ZEHA 1R43A 2VI7A 4COGA 3TE4A 4KLVA 4OC4A 3GLJA 2YNDA 1GHEA 5A28A 3PBBA 5JH9A 3PB8X 4MXUA 4R76A 1A9XB 4H6UA 3LD2A 2R98A 2Z3LA 4JLYA 2AFMA 3SI0A 3K4IA 4P45A 4HKFA 4ZY1A 3SJGA 2B3VA 4GXHA 4PV6A 2HQYA 5AG7A 3QAYA 1CS0B 1HDQA 3ICUA 1EZAA 5HVHA 3BUNB 2ANPA 3DSBA 2ZELA 2XPNA 3ZNIA 3HMJG 3SHPA 4MFLA 1Z8XA 3OB1B 2PQ8A 3R1KA 3W91A 3V38A 3T5MA 4CGPA 3PB9X 1VIXA 2P6EA 3DR6A 3FYNA 2RB7A 4KOWA 3FEDA 1NSAA 2B4BA 4KVME 1OZPA 2OZUA 1S5KA 1YQEA 4M6HA 4TJXA 3EXNA 5BY0A 2V8VA 4OIDA 1YMEA 2QIRA 3BJ7A 3N5FA 2BCOA 4COBA 5HKZA 4MHNA 5EC4A 5LYDA 2PE3A 5G22A 1TF9A 4H6ZA 4UCNA 4AVBA 4A4BA 4MCPA 3S6KA 3VWEA 4AXVA 1Z9UA 2ODFA 2YGWA 1I21A 2PRQA 4CGOA 1J3LA 4JXRA 1S7KA 2FCKA 4C8PA 1FT7A 3KRVA 4QC6A 4C8TA 1AUGA 2OLSA 2ARHA 3D66A 3GB0A 4KOTA 5I4MA 1BO4A 4CYNA 4BTFA 1GGOA 2IQ6A 1I1DA 2DEAA 2GREA 2REFA 3CXQA 1RO5A 3OAKA 1CJWA 2ZW7A 3EY5A 1LOKA 4OC2A 3D2MA 3CT9A 3FB3A 2J8RA 4XPDB 4B5PB 3OP0A 1QMUA 2Z3PA 1YSJA 3LWUA 4IUSA 4UWJA 2B5GA 3EZEA 4CDKA 4MMOA 1DIKA 2ZW6A 3IEHA 1Y9WA 3F9KC 4C2YA 4C8CA 3KHZA 4MY3A 1ZL0A 2V8HA 4CYPA 5H84A 4MCQA 3TCVA 2Z3KA 4B14A 3HUVA 4F8ZA 4ZY2A 1NE9A 1HEEA 3JRUA 1EE3P 1LANA 1XEBA 5C88A 3I3GA 4UF4A 3PBEA 3B35A 4OC1A 1K4JA 2AJ6A 4CGMA 3BHXA 2NMTA 1XRYA 1IYKA 4LQ6A 2HWGA 1MJAA 2POKA 4MHDA 1YR0A 3TTHA 4R3KA 2Y1NA 4GM5A 4EVYA 1R61A 5LYIA 4CPAA 1B47A 1NBWA 3KQZA 3BUMB 3TT2A 1PU9A 4IIYA 1Y7RA 5HVGA 2JEWA 2ZEFA 2P6GA 4R6TA 4BD9A 3VARA 4DNCA 3TLEA 4E0AA 1XFOA 3TLBA 3VGOA 2BOAA 3F5BA 5IB9A 1VHOA 4MHZA 3K2KA 2PJBA 3FVLA 4ZBGA 2R7HA 4NXYA 5JM6A 4OC3A 1Q2YA 3KASA 3MN8A 2QVPA 3BXMA 2OZGA 3PEIA 4PPZA 2EK9A 2FL4A 4YU9A 4KOSA 3TO9A 2D4PA 3IFEA 3KZWA 5KTCA 4Y49B 2IJZA 4R3LA 2EWBA 3IWEA 4KNGE 4TJVA 5JVLA 1F2OA 2G3AA 1QSMA 2B4DB 1IOIA 2Z3MA 3FX6A 5A27A 1VBHA 4R8FA 1YVKA 3S9MA 3S6GA 1XOVA 1IY7A 3L2NA 3NFZA 3T8WA 4NGNA 5I0CA 1IICA 5J8CA 2RC4A 1KUYA 4HNYB 4MFJA 1M4DA 4DYOA 3BUWB 2WPXA 4EMEA 1ON0A 4F0XA 2EZBA 1JDEA 2EUIA 1IIDA 1WWZA 2YNEA 4F9UA 3TFYA 1LCPA 2B58A 1QSTA 1Y9ZA 3FRMA 3WC7A 3PZJA 4CAFA 4XPLA 5ISVA 3TLGB 1TF8A 2MP0A 1PCAA 4FD7A 2Q7SA 2RFHA 2PSWA 3WC6A 1XF1A 4UA3A 3H4QA 1R3NA 4PQAA 3P2HA 4F0YA 5ELYA 2ZEPA 4RN7A 4RS2A 2I79A 4C9EA 5F46A 3T0TA 2PJ0A 4IHMA 4R87A 1V6CA 4IF5A 3P2FA 8CPAA 2Y0MA 1VBGA 4KOVA 4KVXA 4LX9A 1T36B 2PDOA 1WK4A 2BL1A 3IIBA 2VBQA 1TIQA 1ZG7A 3KI9A 4I49A 3R96A 1XE4A 1PUAA 4IK2A 4KOXA 3WC5A 5JQ4A 5LYFA 1LFWA 3E0KA 1S7LA 4B6ZA 3VROA 2AFSA 1ELLP 4FBEA 1F2PA 4C84A 2CNTA 1KEEB 2Q0YA 4CO9A 1YW6A 4UIBA 2HB6A 4GPLB 4QUSA 2AFOA 1VKCA 2QJ8A 3D67A 1YLEA 2CF4A 3NE7A 2H5MA 1S7NA 4A31A 2VZZA 4PK3A 5F48A 3FMCA 2PVWA 2EVNA 2V8GA 3LACA 1KZFA 3S9LA 3N7ZA 3ZJ0A 2PJ4A 2XEIA 3NH4A 4C2XA 2B4JC 2DIKA 1JQGA 3T90A 3IWWA 2NYQA 3I74A 3TO6A 4JYWA 2QMLA 2G3TA 2XEGA 3B3TA 3DLJA 3KR5A 2O4HA 2PR1A 4BBHA 4C9AA 4R57A 4MFKA 4CZ1A 1P4NA 1BOBA 4A4CA 2CTBA 1X10A 1BPMA 3WT4A 3HPGG 1Q5XA 4PSWA 4YN3A 1WVMA 2DPSA 2F8HA 5F49A 5HKYA 4AVCA 1KWMA 2Q4YA 2B5GB 3CPAA 3CXSA 3IGRA 3KL9A 2ZXVA 3QAHA 4K30A 4MHYA 2AFUA 4U5YA 4JJXA 5CNPA 1YVOA 3FECA 5E96A 4BPUB 1Z2LA 4A94A 5FD8A 2DLAA 2PC1A 4EWTA 2C1CA 3KKWA 4WJBA 1YLOA 5AG4A 1IYLA 2Q7BA 4U9ZA 4FWUA 4WWVA 3OB2B 1SQHA 5JGFA 4C8AA 4OC0A 4KZTA 2FVGA 1KC7A 2Z11A 3TLAA 2JDCA 2OR4A 2FT0A 2PIZA 3D8PA 3KHXA 4C7HA 3G3SA 3G8WA 4UEZA 1Z4RA 1L0CA 3FH4A 3EO4A 4JVOA 2GP4A 2G0BA 1QSRA 2ABZA 4KOUA 1IGBA 4CAVA 3BJ8A 3RYOA 1QSOA 3QNVA 5G20A 3R9EA 5LYLA 3RO0A 4RR2B 2IL4A 1MJBA 3D2PA 3KQXA 4E94A 1Y0YA 1XMTA 2WPWA 5J3XA 2K5TA 3WABA 3BUOB 4NGSA 1RXTA 2REEA 5CBMA 1BLLE 1EO0A 1VHSA 3T07A 5JYBA 3B8GA 2VXKA 4MI1A 2GLFA 4X3RA 4II9A 2A4NA 3B3VA 4MRIA 4ZI6A 1YW4A 3TC8A 3VRPA 4UCPA 4M8DA 4PXCA 1CM0A 5F9MA 3VWDA 3V7ZA 2PCNA 3H8EA 4OKOA 4RUHA 4A33A 2Q43A 2XEFA 2PR8A 2WSAA 2VQYA 1XF8A 4P4IA 2AE6A 5KTAA 2PJ1A 4OAEA 3PT1A 1MJ9A 2OB0A 1Y0RA 4MBUA 4MFQA 4B5PA 1YGHA 3G23A 2N3AB 4EFDA 4MCRA 1QQ9A 3JVNA 5FVJA 4A30A 4W9YA 1DTDA 1YX0A 2KCWA 2Q4VA 3PGPA 5DWNA 1A2ZA 4KORA 5HVFA 4FD4A 4AG9A 2G9DA 3TX8A 2JLMA 1LRZA 1UWYA 5F09A 1VI4A 3PFOA 4NGMA 4ZX9A 2VEZA 4P4DA 4X5KA 5D8NA 1Y7EA 3VRQA 2ZEGA 3D3SA 2XPLA 1NSLA 3TLCA 4QB9A 1ZG9A 5F1YA 4C99A 4YGOA 2ZOFA 4INJA 3I9SA 4FD6A 4OC5A 3B7IA 1ZLIA 4BPWB 2IMOA 1LAMA 4UFXA 2PJ9A 2PRBA 4ONUA 3T05A 2GE3A 4NGTA 4KSIA 4P4FA 3TOAA 3TYXA 1M1DA 4NJRA 4PXDA 4P6YA 3DDDA 4R7MA 4XNHC 2Z10A 2ATRA 4EYSA 2ZEDA 3FNCA 1QSNA 2JDDA 3DR8A 4XPKA 2O28A 4TWEA 3H8GA 4J0NA 2JBJA 2ZPAA 5K8OA 3GYAA 3SJEA 4JXQA 4BPXB 5C82A 3SJFA 4JZ0A 2AFXA 2R1IA 5G1ZA 5J1QA 3BI0A 4OIWA 2R82A 4MFPA 3EC4A 1FBVA 2X0SA 4NFRA 4UIAA 3D7FA 2FIAA 4QBJA 1C3OB 2HC9A 5K8PA 2OH1A 3HLPA 4E2AA 2Q04A 4M6GA 3EFAA 4Z65A 4YRHA 4FUUA 5EBVA 4GS4A 2VKZG 2D0OA 4M3SA 2YJVA 1Q2CA 2C6CA 1CE8B 4P4BA 2PJAA 4C9UA 4TNUA 4CYOA 4NGQA 2PJ6A 1I12A 4NSQA 3A9LA 3GJZA 1IOFA 1AMPA 2J8NA 2ZW4A 3F8KA 4JWPA 4UFWA 3C26A 4MY0A 3IWGA 4CGNA 1NXJA 4FAIA 3B3WA 2JBKA 1XBUA 4K3NA 4C2ZA 4ZY0A 1U6MA 4MFZA 5LRGA 3R95A 3RZAA 2C6GA 2HI6A 1KUXA 5HMNA 3T9YA 4XPDC 4AVAA 2V8DA 3PFVA 2F5IA 4R9MA 3FJUA 2OOTA 3VRNA 3R9GA 4JD6A 3ISZA 2AUNA 3D7GA 1S3ZA 3NH5A 5K99A 5K8NA 2CIJA 2R8VA 1CBXA 1YK3A 4A95A 4B10A 2GU2A 1XIXA 4YWYA 3LODA 3IJ3A 5IB0A 5K8MA 1IU8A 2GFQA 3K9UA 4ZX8A 2Q4ZA 1H8LA 3JTKA 4MHPA 3LMSA 5JPHA 2Q51A 1M6VB 2E28A 1DE4C 2P6FA 2FM4A 2Q44A 3B2YA 4NEXA 4C8UA 2ZEEA 3NOJA 4MJ8A 3BI1A 3IC1A 3RAMA 1Q2DA 1JDBC 2VL1A 4CS0B 4B12A 1M4GA 4YFJA 3C8OA 4XNHB 2HV2A 2Z0ZA 2QYVA 2C27A 3CDXA 4P10A 3U1BA 1VHEA 6CPAA 5D29A 3SJXA 1S7FA 2EZCA 4CRZB 3K9TA 2GANA 5F5XA 1XJOA 2ZEOA 5EMIA 5HXDA 4ONWA 5F13A 1VGYA 2BSWA 2ZOGA 3EZAA 4B11A 4CYQA 4HPSA 2B3UA 4QVTA 2CNMA 4HNXB 5BWAB 2GLJA 5IV0A 4KVOE 2I3CA 2HUZA 3B3CA 4A37A 1M4LA 2I00A 3NFQA 4NGRA 4CAXA 4RI1A 3GIUA 7CPAA 3I1UA 4HNWB 2PCUA 2BUEA 2VZYA 4C9VA 3FEEA 3VRRA 5IR2A 1OBRA 1B6BA 1UFHA 2PJ8A 3ZZIA 1S60A 4Y49C 2AUMA 1RTQA 5F47A 5HH1A 3CXPA 1ZLHA 4OP4A 4H2KA 5AG6A 4A32A 4B13A 3I6SA 1KUVA 2C5QA 4E5SA 2YNCA 3OWCA 4AG7A 1NMTA 1M4IA 3W6XA 4A39A 1XMBA 2J9AA 2WZNA 4KOYA 3R9FA 1CP6A 4L8AA 3H8FA 4OLLA 4UEFA 5AGEA 4BINA 3CZXA 2PJ7A 3IU2A 1Z8WA 3GUXA 4E8OA 4KUAA 1Q7LA 3GKRA 1X12A 4KS9A 4KSAA 4ORFA 1CPXA 4KUBA 4CAEA 2EZAA 4AB7A 5AXIA 3IO1A 1HDUA 4KLWA 4H89A 4NF1A 4P4JA 2FE7A 4P44A 3PB4X 1JWQA 4Q36A 3V8IA 1Z9EA 4B5OA 4G1PA 2FXFA 3RNZA 3NE8A 4C7IA 4C85A 1N71A 4C68A 5H86A 3UY5A 3VATA 4NGPA 5IX3A 4F9VA 1ZRSA 4O23A 2EO8A 2BEIA 1ELMP 4MCSA 4PSXA 4PXBA 1FY7A 3EZBA 2AFWA 3ISXA 3S9NA 1AYEA 2QECA 4C8FA 1P0HA 3MRUA 1BAVA
chains in the Genus database with same CATH topology
2F7VA 2PIYA 4NJQA 3SI2A 4UEEA 2PJCA 3RBUA 2EK8A 3NH8A 3D68A 3D7DA 4PXEA 3PB7X 3KR4A 1CX8A 1ARMA 5CPAA 1TKHA 1BPNA 3KGQA 2XEJA 4A38A 1CP7A 1TKFA 2PVVA 2PJ5A 1CPSA 4Q7AA 1ARLA 3PRTA 3SI1A 2V77A 4C9RA 1Z5RA 2AFZA 3VTAA 2ZENA 4X8IA 1LAPA 2CTCA 4OMEA 2PJ2A 4X2TA 2C6PA 2PJ3A 1CG2A 2WYRA 4ZYQA 1FNOA 3D7HA 3PFEA 1TKJA 3EIFA 5LRJA 3D4UA 3DGVA 3B3SA 2NSMA 4IAVA 3FF3A 4CDJA 1PYTB 1Z8LA 4C86A 2ZEMA 3VH9A 3NA6A 2O53A 1F57A 4P4EA 5THWA 1GYTA 1ZG8A 4LQGA 5LRKA 3PB6X 1TXRA 4DUKA 5DS0A 2BO9A 3CPXA 4DJLA 2ZEHA 1R43A 4OC4A 3GLJA 3PBBA 5JH9A 3PB8X 4MXUA 4R76A 2AFMA 3SI0A 4P45A 4ZY1A 3SJGA 3ICUA 1HDQA 5HVHA 2ANPA 2ZELA 3V38A 3PB9X 1VIXA 2RB7A 3FEDA 1NSAA 4TJXA 2V8VA 4OIDA 1YMEA 3N5FA 2BCOA 4MHNA 5LYDA 2PE3A 1TF9A 4AXVA 4MCPA 2PRQA 4C8PA 1FT7A 4C8TA 5I4MA 3D66A 3GB0A 2IQ6A 2DEAA 2GREA 1LOKA 4OC2A 3CT9A 1QMUA 1YSJA 3LWUA 4CDKA 4MMOA 3IEHA 4C8CA 3KHZA 2V8HA 4MCQA 3HUVA 4F8ZA 4ZY2A 1HEEA 3JRUA 1EE3P 1LANA 4UF4A 3PBEA 3B35A 4OC1A 3BHXA 1XRYA 2POKA 4GM5A 5LYIA 4CPAA 3KQZA 5HVGA 2JEWA 2ZEFA 4R6TA 4BD9A 3VARA 1XFOA 5IB9A 2BOAA 1VHOA 4MHZA 3K2KA 2PJBA 3FVLA 5JM6A 4OC3A 3MN8A 3KASA 2QVPA 3BXMA 3PEIA 4PPZA 4YU9A 2EK9A 3IFEA 3KZWA 2IJZA 2EWBA 4TJVA 4KNGE 1F2OA 3FX6A 4R8FA 3S9MA 3NFZA 1IY7A 3L2NA 3T8WA 4NGNA 4DYOA 4EMEA 4F9UA 1LCPA 1Y9ZA 3WC7A 1TF8A 1PCAA 2RFHA 3WC6A 1XF1A 1R3NA 4PQAA 5ELYA 2ZEPA 4C9EA 2PJ0A 4IHMA 1V6CA 8CPAA 3IIBA 3KI9A 1ZG7A 3WC5A 4IK2A 5LYFA 1LFWA 4B6ZA 2AFSA 1ELLP 4FBEA 1F2PA 4C84A 1YW6A 4UIBA 2HB6A 2AFOA 2QJ8A 3D67A 2CF4A 3FMCA 2PVWA 2V8GA 3S9LA 2PJ4A 2XEIA 3NH4A 1JQGA 3IWWA 2NYQA 3I74A 4JYWA 2XEGA 3B3TA 3DLJA 3KR5A 2O4HA 4C9AA 2CTBA 1BPMA 3WT4A 4YN3A 1WVMA 2F8HA 1KWMA 3CPAA 4MHYA 3KL9A 2AFUA 3FECA 1Z2LA 4A94A 4EWTA 2C1CA 4WJBA 1YLOA 4FWUA 4WWVA 5JGFA 4C8AA 4OC0A 2FVGA 2OR4A 2PIZA 3KHXA 4UEZA 3FH4A 2GP4A 2ABZA 1IGBA 3QNVA 5LYLA 3KQXA 1Y0YA 3WABA 4NGSA 5CBMA 1BLLE 2GLFA 4X3RA 3B3VA 4MRIA 4ZI6A 1YW4A 3TC8A 4PXCA 3V7ZA 3H8EA 4OKOA 4RUHA 2Q43A 2XEFA 4P4IA 2PJ1A 1Y0RA 4EFDA 4MCRA 1QQ9A 4W9YA 1DTDA 5HVFA 2G9DA 3TX8A 1UWYA 5F09A 3PFOA 4NGMA 4ZX9A 4P4DA 5D8NA 1Y7EA 2ZEGA 4C99A 1ZG9A 2ZOFA 4OC5A 3B7IA 1ZLIA 2IMOA 1LAMA 2PJ9A 4NGTA 4KSIA 4P4FA 4NJRA 4PXDA 4P6YA 4R7MA 2ZEDA 4TWEA 3H8GA 2JBJA 5K8OA 3SJEA 3SJFA 4JZ0A 2AFXA 5J1QA 3BI0A 4OIWA 4NFRA 4UIAA 3D7FA 2HC9A 5K8PA 3HLPA 4Z65A 4FUUA 4C9UA 2C6CA 4P4BA 2PJAA 4TNUA 4NGQA 2PJ6A 1AMPA 4FAIA 3B3WA 2JBKA 1XBUA 4K3NA 4ZY0A 3RZAA 5LRGA 2C6GA 2V8DA 3FJUA 2OOTA 3ISZA 3D7GA 3NH5A 5K8NA 2CIJA 1CBXA 2GU2A 4YWYA 3IJ3A 5K8MA 4ZX8A 2Q4ZA 1H8LA 4MHPA 3LMSA 2Q51A 1DE4C 3B2YA 4C8UA 2ZEEA 3BI1A 3IC1A 3RAMA 2VL1A 2QYVA 4P10A 3CDXA 1VHEA 6CPAA 5D29A 3SJXA 3K9TA 1XJOA 2ZEOA 5HXDA 4ONWA 1VGYA 2ZOGA 2GLJA 2I3CA 4A37A 1M4LA 4NGRA 7CPAA 3I1UA 2PCUA 4C9VA 3FEEA 5IR2A 1OBRA 2PJ8A 1RTQA 1ZLHA 4OP4A 4H2KA 3I6SA 2C5QA 4A39A 1XMBA 2J9AA 2WZNA 1CP6A 4UEFA 3H8FA 2PJ7A 3GUXA 1Q7LA 1CPXA 3IO1A 1HDUA 4P4JA 4P44A 3PB4X 4G1PA 4C85A 3VATA 4NGPA 4F9VA 4O23A 1ELMP 4MCSA 4PXBA 2AFWA 3ISXA 3S9NA 1AYEA 4C8FA 3B3CA 3MRUA 1BAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7V A;  2PIY A;  4NJQ A;  3SI2 A;  4UEE A;  2PJC A;  3RBU A;  2EK8 A;  3NH8 A;  3D68 A;  3D7D A;  4PXE A;  3PB7 X;  3KR4 A;  1CX8 A;  1ARM A;  5CPA A;  1TKH A;  1BPN A;  3KGQ A;  2XEJ A;  4A38 A;  1CP7 A;  1TKF A;  2PVV A;  2PJ5 A;  1CPS A;  4Q7A A;  1ARL A;  3PRT A;  3SI1 A;  2V77 A;  4C9R A;  1Z5R A;  2AFZ A;  3VTA A;  2ZEN A;  4X8I A;  1LAP A;  2CTC A;  4OME A;  2PJ2 A;  4X2T A;  2C6P A;  2PJ3 A;  1CG2 A;  2WYR A;  4ZYQ A;  1FNO A;  3D7H A;  3PFE A;  1TKJ A;  3EIF A;  5LRJ A;  3D4U A;  3DGV A;  3B3S A;  2NSM A;  4IAV A;  3FF3 A;  4CDJ A;  1PYT B;  1Z8L A;  4C86 A;  2ZEM A;  3VH9 A;  3NA6 A;  2O53 A;  1F57 A;  4P4E A;  5THW A;  1GYT A;  1ZG8 A;  4LQG A;  5LRK A;  3PB6 X;  1TXR A;  4DUK A;  5DS0 A;  2BO9 A;  3CPX A;  4DJL A;  2ZEH A;  1R43 A;  4OC4 A;  3GLJ A;  3PBB A;  5JH9 A;  3PB8 X;  4MXU A;  4R76 A;  2AFM A;  3SI0 A;  4P45 A;  4ZY1 A;  3SJG A;  3ICU A;  1HDQ A;  5HVH A;  2ANP A;  2ZEL A;  3V38 A;  3PB9 X;  1VIX A;  2RB7 A;  3FED A;  1NSA A;  4TJX A;  2V8V A;  4OID A;  1YME A;  3N5F A;  2BCO A;  4MHN A;  5LYD A;  2PE3 A;  1TF9 A;  4AXV A;  4MCP A;  2PRQ A;  4C8P A;  1FT7 A;  4C8T A;  5I4M A;  3D66 A;  3GB0 A;  2IQ6 A;  2DEA A;  2GRE A;  1LOK A;  4OC2 A;  3CT9 A;  1QMU A;  1YSJ A;  3LWU A;  4CDK A;  4MMO A;  3IEH A;  4C8C A;  3KHZ A;  2V8H A;  4MCQ A;  3HUV A;  4F8Z A;  4ZY2 A;  1HEE A;  3JRU A;  1EE3 P;  1LAN A;  4UF4 A;  3PBE A;  3B35 A;  4OC1 A;  3BHX A;  1XRY A;  2POK A;  4GM5 A;  5LYI A;  4CPA A;  3KQZ A;  5HVG A;  2JEW A;  2ZEF A;  4R6T A;  4BD9 A;  3VAR A;  1XFO A;  5IB9 A;  2BOA A;  1VHO A;  4MHZ A;  3K2K A;  2PJB A;  3FVL A;  5JM6 A;  4OC3 A;  3MN8 A;  3KAS A;  2QVP A;  3BXM A;  3PEI A;  4PPZ A;  4YU9 A;  2EK9 A;  3IFE A;  3KZW A;  2IJZ A;  2EWB A;  4TJV A;  4KNG E;  1F2O A;  3FX6 A;  4R8F A;  3S9M A;  3NFZ A;  1IY7 A;  3L2N A;  3T8W A;  4NGN A;  4DYO A;  4EME A;  4F9U A;  1LCP A;  1Y9Z A;  3WC7 A;  1TF8 A;  1PCA A;  2RFH A;  3WC6 A;  1XF1 A;  1R3N A;  4PQA A;  5ELY A;  2ZEP A;  4C9E A;  2PJ0 A;  4IHM A;  1V6C A;  8CPA A;  3IIB A;  3KI9 A;  1ZG7 A;  3WC5 A;  4IK2 A;  5LYF A;  1LFW A;  4B6Z A;  2AFS A;  1ELL P;  4FBE A;  1F2P A;  4C84 A;  1YW6 A;  4UIB A;  2HB6 A;  2AFO A;  2QJ8 A;  3D67 A;  2CF4 A;  3FMC A;  2PVW A;  2V8G A;  3S9L A;  2PJ4 A;  2XEI A;  3NH4 A;  1JQG A;  3IWW A;  2NYQ A;  3I74 A;  4JYW A;  2XEG A;  3B3T A;  3DLJ A;  3KR5 A;  2O4H A;  4C9A A;  2CTB A;  1BPM A;  3WT4 A;  4YN3 A;  1WVM A;  2F8H A;  1KWM A;  3CPA A;  4MHY A;  3KL9 A;  2AFU A;  3FEC A;  1Z2L A;  4A94 A;  4EWT A;  2C1C A;  4WJB A;  1YLO A;  4FWU A;  4WWV A;  5JGF A;  4C8A A;  4OC0 A;  2FVG A;  2OR4 A;  2PIZ A;  3KHX A;  4UEZ A;  3FH4 A;  2ABZ A;  1IGB A;  3QNV A;  5LYL A;  3KQX A;  1Y0Y A;  3WAB A;  4NGS A;  5CBM A;  1BLL E;  2GLF A;  4X3R A;  3B3V A;  4MRI A;  4ZI6 A;  1YW4 A;  3TC8 A;  4PXC A;  3V7Z A;  3H8E A;  4OKO A;  4RUH A;  2Q43 A;  2XEF A;  4P4I A;  2PJ1 A;  1Y0R A;  4EFD A;  4MCR A;  1QQ9 A;  4W9Y A;  1DTD A;  5HVF A;  2G9D A;  3TX8 A;  1UWY A;  5F09 A;  3PFO A;  4NGM A;  4ZX9 A;  4P4D A;  5D8N A;  1Y7E A;  2ZEG A;  4C99 A;  1ZG9 A;  2ZOF A;  4OC5 A;  3B7I A;  1ZLI A;  2IMO A;  1LAM A;  2PJ9 A;  4NGT A;  4KSI A;  4P4F A;  4NJR A;  4PXD A;  4P6Y A;  4R7M A;  2ZED A;  4TWE A;  3H8G A;  2JBJ A;  5K8O A;  3SJE A;  3SJF A;  4JZ0 A;  2AFX A;  5J1Q A;  3BI0 A;  4OIW A;  4NFR A;  4UIA A;  3D7F A;  2HC9 A;  5K8P A;  3HLP A;  4Z65 A;  4FUU A;  4C9U A;  2C6C A;  4P4B A;  2PJA A;  4TNU A;  4NGQ A;  2PJ6 A;  1AMP A;  4FAI A;  3B3W A;  2JBK A;  1XBU A;  4K3N A;  4ZY0 A;  3RZA A;  5LRG A;  2C6G A;  2V8D A;  3FJU A;  2OOT A;  3ISZ A;  3D7G A;  3NH5 A;  5K8N A;  2CIJ A;  1CBX A;  2GU2 A;  4YWY A;  3IJ3 A;  5K8M A;  4ZX8 A;  2Q4Z A;  1H8L A;  4MHP A;  3LMS A;  2Q51 A;  1DE4 C;  3B2Y A;  4C8U A;  2ZEE A;  3BI1 A;  3IC1 A;  3RAM A;  2VL1 A;  2QYV A;  4P10 A;  3CDX A;  1VHE A;  6CPA A;  5D29 A;  3SJX A;  3K9T A;  1XJO A;  2ZEO A;  5HXD A;  4ONW A;  1VGY A;  2ZOG A;  2GLJ A;  2I3C A;  4A37 A;  1M4L A;  4NGR A;  7CPA A;  3I1U A;  2PCU A;  4C9V A;  3FEE A;  1OBR A;  2PJ8 A;  1RTQ A;  1ZLH A;  4OP4 A;  4H2K A;  3I6S A;  4A39 A;  1XMB A;  2J9A A;  2WZN A;  1CP6 A;  4UEF A;  3H8F A;  2PJ7 A;  3GUX A;  1Q7L A;  1CPX A;  3IO1 A;  1HDU A;  4P4J A;  4P44 A;  3PB4 X;  4G1P A;  4C85 A;  3VAT A;  4NGP A;  4F9V A;  4O23 A;  1ELM P;  4MCS A;  4PXB A;  2AFW A;  3ISX A;  3S9N A;  1AYE A;  4C8F A;  3B3C A;  3MRU A;  1BAV A; 
#chains in the Genus database with same CATH topology
 2FSR A;  2F7V A;  1Y9K A;  2PIY A;  4NJQ A;  3MGD A;  5AG5 A;  1Z8T A;  5G21 A;  3SI2 A;  4U9Y A;  4J3G A;  4UEE A;  2PJC A;  3W6S A;  3RBU A;  4BMH A;  1J4J A;  3BUX B;  2EK8 A;  3FXT A;  3NH8 A;  2B0A A;  3D68 A;  2XPP A;  1C30 B;  3D7D A;  2XPO A;  2ZW5 A;  3TLY A;  1M44 A;  2GIV A;  4PXE A;  2UV8 G;  3O8Z A;  3IU1 A;  2DF5 A;  3PB7 X;  4KSF A;  3KR4 A;  3GY9 A;  1CX8 A;  1ARM A;  5CPA A;  1TKH A;  4CGL A;  3SR3 A;  2EBJ A;  2Z3O A;  1BPN A;  4Q38 A;  3KGQ A;  1B87 A;  3S6F A;  2XEJ A;  4A38 A;  4ZGY B;  1CP7 A;  1TKF A;  2PVV A;  2PJ5 A;  4H1H A;  1CPS A;  1ZO0 A;  4Q7A A;  1ARL A;  3PRT A;  3SI1 A;  2V77 A;  4M6I A;  4CAW A;  4CRY B;  4C9R A;  1Z5R A;  1V0C A;  2AFZ A;  4MI4 A;  4NCZ A;  4A2Z A;  5J8F A;  3JUW A;  3U88 C;  4M85 A;  3VTA A;  2ZEN A;  5HKW A;  4X8I A;  1LAP A;  2CTC A;  2D4O A;  3H5Z A;  3WR7 A;  2YNC C;  4IIX A;  4OME A;  2PJ2 A;  4X2T A;  2C6P A;  2PJ3 A;  3PP9 A;  4PK2 A;  3TO7 A;  3TLZ A;  1CG2 A;  2OU2 A;  2WYR A;  4ZYQ A;  1FNO A;  2CXA A;  2OZH A;  4OAD A;  1ZYM A;  2FIW A;  1KBL A;  2HRO A;  3D7H A;  3PFE A;  1TKJ A;  3DNS A;  4UWI A;  1YVH A;  5GCN A;  5DWM A;  4F6A A;  2B4D A;  3EIF A;  2J8M A;  2JEV A;  5LRJ A;  3D4U A;  1EZB A;  3DGV A;  3SXN A;  3S6H A;  3B3S A;  1WJT A;  3TOB A;  3F0A A;  2NSM A;  4IAV A;  3FF3 A;  1MK4 A;  2X7B A;  4UBR A;  2P0W A;  3FIX A;  1PYT B;  4CDJ A;  1Z8L A;  3HPH E;  1IB1 E;  1YRE A;  2WUU A;  4C86 A;  2ZEM A;  2DPT A;  3BLN A;  5KTD A;  3VH9 A;  3SXO A;  3NA6 A;  4L89 A;  2CNS A;  3PLF B;  2O53 A;  1BXR B;  4LUA A;  1F57 A;  1Z4E A;  4UCM A;  4P4E A;  5THW A;  3QB8 A;  1GYT A;  3TLG A;  1ZG8 A;  4FD5 A;  4LQG A;  5LRK A;  2Z3N A;  2CBL A;  2Y1M A;  3FBU A;  3PB6 X;  2YJT A;  1TXR A;  2FS5 A;  4MJX A;  4DUK A;  2CY2 A;  2DXQ A;  2D0P A;  5DS0 A;  4UFV A;  1R57 A;  2BO9 A;  3CPX A;  4DJL A;  2ZEH A;  1R43 A;  2VI7 A;  4COG A;  3TE4 A;  4KLV A;  4OC4 A;  3GLJ A;  2YND A;  1GHE A;  5A28 A;  3PBB A;  5JH9 A;  3PB8 X;  4MXU A;  4R76 A;  1A9X B;  4H6U A;  3LD2 A;  2R98 A;  2Z3L A;  4JLY A;  2AFM A;  3SI0 A;  3K4I A;  4P45 A;  4HKF A;  4ZY1 A;  3SJG A;  2B3V A;  4GXH A;  4PV6 A;  2HQY A;  5AG7 A;  3QAY A;  1CS0 B;  1HDQ A;  3ICU A;  1EZA A;  5HVH A;  3BUN B;  2ANP A;  3DSB A;  2ZEL A;  2XPN A;  3ZNI A;  3HMJ G;  3SHP A;  4MFL A;  1Z8X A;  3OB1 B;  2PQ8 A;  3R1K A;  3W91 A;  3V38 A;  3T5M A;  4CGP A;  3PB9 X;  1VIX A;  2P6E A;  3DR6 A;  3FYN A;  2RB7 A;  4KOW A;  3FED A;  1NSA A;  2B4B A;  4KVM E;  1OZP A;  2OZU A;  1S5K A;  1YQE A;  4M6H A;  4TJX A;  3EXN A;  5BY0 A;  2V8V A;  4OID A;  1YME A;  2QIR A;  3BJ7 A;  3N5F A;  2BCO A;  4COB A;  5HKZ A;  4MHN A;  5EC4 A;  5LYD A;  2PE3 A;  5G22 A;  1TF9 A;  4H6Z A;  4UCN A;  4AVB A;  4A4B A;  4MCP A;  3S6K A;  3VWE A;  4AXV A;  1Z9U A;  2ODF A;  2YGW A;  1I21 A;  2PRQ A;  4CGO A;  1J3L A;  4JXR A;  1S7K A;  2FCK A;  4C8P A;  1FT7 A;  3KRV A;  4QC6 A;  4C8T A;  1AUG A;  2OLS A;  2ARH A;  3D66 A;  3GB0 A;  4KOT A;  5I4M A;  1BO4 A;  4CYN A;  4BTF A;  1GGO A;  2IQ6 A;  1I1D A;  2DEA A;  2GRE A;  2REF A;  3CXQ A;  1RO5 A;  3OAK A;  1CJW A;  2ZW7 A;  3EY5 A;  1LOK A;  4OC2 A;  3D2M A;  3CT9 A;  3FB3 A;  2J8R A;  4XPD B;  4B5P B;  3OP0 A;  1QMU A;  2Z3P A;  1YSJ A;  3LWU A;  4IUS A;  4UWJ A;  2B5G A;  3EZE A;  4CDK A;  4MMO A;  1DIK A;  2ZW6 A;  3IEH A;  1Y9W A;  3F9K C;  4C2Y A;  4C8C A;  3KHZ A;  4MY3 A;  1ZL0 A;  2V8H A;  4CYP A;  5H84 A;  4MCQ A;  3TCV A;  2Z3K A;  4B14 A;  3HUV A;  4F8Z A;  4ZY2 A;  1NE9 A;  1HEE A;  3JRU A;  1EE3 P;  1LAN A;  1XEB A;  5C88 A;  3I3G A;  4UF4 A;  3PBE A;  3B35 A;  4OC1 A;  1K4J A;  2AJ6 A;  4CGM A;  3BHX A;  2NMT A;  1XRY A;  1IYK A;  4LQ6 A;  2HWG A;  1MJA A;  2POK A;  4MHD A;  1YR0 A;  3TTH A;  4R3K A;  2Y1N A;  4GM5 A;  4EVY A;  1R61 A;  5LYI A;  4CPA A;  1B47 A;  1NBW A;  3KQZ A;  3BUM B;  3TT2 A;  1PU9 A;  4IIY A;  1Y7R A;  5HVG A;  2JEW A;  2ZEF A;  2P6G A;  4R6T A;  4BD9 A;  3VAR A;  4DNC A;  3TLE A;  4E0A A;  1XFO A;  3TLB A;  3VGO A;  2BOA A;  3F5B A;  5IB9 A;  1VHO A;  4MHZ A;  3K2K A;  2PJB A;  3FVL A;  4ZBG A;  2R7H A;  4NXY A;  5JM6 A;  4OC3 A;  1Q2Y A;  3KAS A;  3MN8 A;  2QVP A;  3BXM A;  2OZG A;  3PEI A;  4PPZ A;  2EK9 A;  2FL4 A;  4YU9 A;  4KOS A;  3TO9 A;  2D4P A;  3IFE A;  3KZW A;  5KTC A;  4Y49 B;  2IJZ A;  4R3L A;  2EWB A;  3IWE A;  4KNG E;  4TJV A;  5JVL A;  1F2O A;  2G3A A;  1QSM A;  2B4D B;  1IOI A;  2Z3M A;  3FX6 A;  5A27 A;  1VBH A;  4R8F A;  1YVK A;  3S9M A;  3S6G A;  1XOV A;  1IY7 A;  3L2N A;  3NFZ A;  3T8W A;  4NGN A;  5I0C A;  1IIC A;  5J8C A;  2RC4 A;  1KUY A;  4HNY B;  4MFJ A;  1M4D A;  4DYO A;  3BUW B;  2WPX A;  4EME A;  1ON0 A;  4F0X A;  2EZB A;  1JDE A;  2EUI A;  1IID A;  1WWZ A;  2YNE A;  4F9U A;  3TFY A;  1LCP A;  2B58 A;  1QST A;  1Y9Z A;  3FRM A;  3WC7 A;  3PZJ A;  4CAF A;  4XPL A;  5ISV A;  3TLG B;  1TF8 A;  2MP0 A;  1PCA A;  4FD7 A;  2Q7S A;  2RFH A;  2PSW A;  3WC6 A;  1XF1 A;  4UA3 A;  3H4Q A;  1R3N A;  4PQA A;  3P2H A;  4F0Y A;  5ELY A;  2ZEP A;  4RN7 A;  4RS2 A;  2I79 A;  4C9E A;  5F46 A;  3T0T A;  2PJ0 A;  4IHM A;  4R87 A;  1V6C A;  4IF5 A;  3P2F A;  8CPA A;  2Y0M A;  1VBG A;  4KOV A;  4KVX A;  4LX9 A;  1T36 B;  2PDO A;  1WK4 A;  2BL1 A;  3IIB A;  2VBQ A;  1TIQ A;  1ZG7 A;  3KI9 A;  4I49 A;  3R96 A;  1XE4 A;  1PUA A;  4IK2 A;  4KOX A;  3WC5 A;  5JQ4 A;  5LYF A;  1LFW A;  3E0K A;  1S7L A;  4B6Z A;  3VRO A;  2AFS A;  1ELL P;  4FBE A;  1F2P A;  4C84 A;  2CNT A;  1KEE B;  2Q0Y A;  4CO9 A;  1YW6 A;  4UIB A;  2HB6 A;  4GPL B;  4QUS A;  2AFO A;  1VKC A;  2QJ8 A;  3D67 A;  1YLE A;  2CF4 A;  3NE7 A;  2H5M A;  1S7N A;  4A31 A;  2VZZ A;  4PK3 A;  5F48 A;  3FMC A;  2PVW A;  2EVN A;  2V8G A;  3LAC A;  1KZF A;  3S9L A;  3N7Z A;  3ZJ0 A;  2PJ4 A;  2XEI A;  3NH4 A;  4C2X A;  2B4J C;  2DIK A;  1JQG A;  3T90 A;  3IWW A;  2NYQ A;  3I74 A;  3TO6 A;  4JYW A;  2QML A;  2G3T A;  2XEG A;  3B3T A;  3DLJ A;  3KR5 A;  2O4H A;  2PR1 A;  4BBH A;  4C9A A;  4R57 A;  4MFK A;  4CZ1 A;  1P4N A;  1BOB A;  4A4C A;  2CTB A;  1X10 A;  1BPM A;  3WT4 A;  3HPG G;  1Q5X A;  4PSW A;  4YN3 A;  1WVM A;  2DPS A;  2F8H A;  5F49 A;  5HKY A;  4AVC A;  1KWM A;  2Q4Y A;  2B5G B;  3CPA A;  3CXS A;  3IGR A;  3KL9 A;  2ZXV A;  3QAH A;  4K30 A;  4MHY A;  2AFU A;  4U5Y A;  4JJX A;  5CNP A;  1YVO A;  3FEC A;  5E96 A;  4BPU B;  1Z2L A;  4A94 A;  5FD8 A;  2DLA A;  2PC1 A;  4EWT A;  2C1C A;  3KKW A;  4WJB A;  1YLO A;  5AG4 A;  1IYL A;  2Q7B A;  4U9Z A;  4FWU A;  4WWV A;  3OB2 B;  1SQH A;  5JGF A;  4C8A A;  4OC0 A;  4KZT A;  2FVG A;  1KC7 A;  2Z11 A;  3TLA A;  2JDC A;  2OR4 A;  2FT0 A;  2PIZ A;  3D8P A;  3KHX A;  4C7H A;  3G3S A;  3G8W A;  4UEZ A;  1Z4R A;  1L0C A;  3FH4 A;  3EO4 A;  4JVO A;  2GP4 A;  2G0B A;  1QSR A;  2ABZ A;  4KOU A;  1IGB A;  4CAV A;  3BJ8 A;  3RYO A;  1QSO A;  3QNV A;  5G20 A;  3R9E A;  5LYL A;  3RO0 A;  4RR2 B;  2IL4 A;  1MJB A;  3D2P A;  3KQX A;  4E94 A;  1Y0Y A;  1XMT A;  2WPW A;  5J3X A;  2K5T A;  3WAB A;  3BUO B;  4NGS A;  1RXT A;  2REE A;  5CBM A;  1BLL E;  1EO0 A;  1VHS A;  3T07 A;  5JYB A;  3B8G A;  2VXK A;  4MI1 A;  2GLF A;  4X3R A;  4II9 A;  2A4N A;  3B3V A;  4MRI A;  4ZI6 A;  1YW4 A;  3TC8 A;  3VRP A;  4UCP A;  4M8D A;  4PXC A;  1CM0 A;  5F9M A;  3VWD A;  3V7Z A;  2PCN A;  3H8E A;  4OKO A;  4RUH A;  4A33 A;  2Q43 A;  2XEF A;  2PR8 A;  2WSA A;  2VQY A;  1XF8 A;  4P4I A;  2AE6 A;  5KTA A;  2PJ1 A;  4OAE A;  3PT1 A;  1MJ9 A;  2OB0 A;  1Y0R A;  4MBU A;  4MFQ A;  4B5P A;  1YGH A;  3G23 A;  2N3A B;  4EFD A;  4MCR A;  1QQ9 A;  3JVN A;  5FVJ A;  4A30 A;  4W9Y A;  1DTD A;  1YX0 A;  2KCW A;  2Q4V A;  3PGP A;  5DWN A;  1A2Z A;  4KOR A;  5HVF A;  4FD4 A;  4AG9 A;  2G9D A;  3TX8 A;  2JLM A;  1LRZ A;  1UWY A;  5F09 A;  1VI4 A;  3PFO A;  4NGM A;  4ZX9 A;  2VEZ A;  4P4D A;  4X5K A;  5D8N A;  1Y7E A;  3VRQ A;  2ZEG A;  3D3S A;  2XPL A;  1NSL A;  3TLC A;  4QB9 A;  1ZG9 A;  5F1Y A;  4C99 A;  4YGO A;  2ZOF A;  4INJ A;  3I9S A;  4FD6 A;  4OC5 A;  3B7I A;  1ZLI A;  4BPW B;  2IMO A;  1LAM A;  4UFX A;  2PJ9 A;  2PRB A;  4ONU A;  3T05 A;  2GE3 A;  4NGT A;  4KSI A;  4P4F A;  3TOA A;  3TYX A;  1M1D A;  4NJR A;  4PXD A;  4P6Y A;  3DDD A;  4R7M A;  4XNH C;  2Z10 A;  2ATR A;  4EYS A;  2ZED A;  3FNC A;  1QSN A;  2JDD A;  3DR8 A;  4XPK A;  2O28 A;  4TWE A;  3H8G A;  4J0N A;  2JBJ A;  2ZPA A;  5K8O A;  3GYA A;  3SJE A;  4JXQ A;  4BPX B;  5C82 A;  3SJF A;  4JZ0 A;  2AFX A;  2R1I A;  5G1Z A;  5J1Q A;  3BI0 A;  4OIW A;  2R82 A;  4MFP A;  3EC4 A;  1FBV A;  2X0S A;  4NFR A;  4UIA A;  3D7F A;  2FIA A;  4QBJ A;  1C3O B;  2HC9 A;  5K8P A;  2OH1 A;  3HLP A;  4E2A A;  2Q04 A;  4M6G A;  3EFA A;  4Z65 A;  4YRH A;  4FUU A;  5EBV A;  4GS4 A;  2VKZ G;  2D0O A;  4M3S A;  2YJV A;  1Q2C A;  2C6C A;  1CE8 B;  4P4B A;  2PJA A;  4C9U A;  4TNU A;  4CYO A;  4NGQ A;  2PJ6 A;  1I12 A;  4NSQ A;  3A9L A;  3GJZ A;  1IOF A;  1AMP A;  2J8N A;  2ZW4 A;  3F8K A;  4JWP A;  4UFW A;  3C26 A;  4MY0 A;  3IWG A;  4CGN A;  1NXJ A;  4FAI A;  3B3W A;  2JBK A;  1XBU A;  4K3N A;  4C2Z A;  4ZY0 A;  1U6M A;  4MFZ A;  5LRG A;  3R95 A;  3RZA A;  2C6G A;  2HI6 A;  1KUX A;  5HMN A;  3T9Y A;  4XPD C;  4AVA A;  2V8D A;  3PFV A;  2F5I A;  4R9M A;  3FJU A;  2OOT A;  3VRN A;  3R9G A;  4JD6 A;  3ISZ A;  2AUN A;  3D7G A;  1S3Z A;  3NH5 A;  5K99 A;  5K8N A;  2CIJ A;  2R8V A;  1CBX A;  1YK3 A;  4A95 A;  4B10 A;  2GU2 A;  1XIX A;  4YWY A;  3LOD A;  3IJ3 A;  5IB0 A;  5K8M A;  1IU8 A;  2GFQ A;  3K9U A;  4ZX8 A;  2Q4Z A;  1H8L A;  3JTK A;  4MHP A;  3LMS A;  5JPH A;  2Q51 A;  1M6V B;  2E28 A;  1DE4 C;  2P6F A;  2FM4 A;  2Q44 A;  3B2Y A;  4NEX A;  4C8U A;  2ZEE A;  3NOJ A;  4MJ8 A;  3BI1 A;  3IC1 A;  3RAM A;  1Q2D A;  1JDB C;  2VL1 A;  4CS0 B;  4B12 A;  1M4G A;  4YFJ A;  3C8O A;  4XNH B;  2HV2 A;  2Z0Z A;  2QYV A;  2C27 A;  3CDX A;  4P10 A;  3U1B A;  1VHE A;  6CPA A;  5D29 A;  3SJX A;  1S7F A;  2EZC A;  4CRZ B;  3K9T A;  2GAN A;  5F5X A;  1XJO A;  2ZEO A;  5EMI A;  5HXD A;  4ONW A;  5F13 A;  1VGY A;  2BSW A;  2ZOG A;  3EZA A;  4B11 A;  4CYQ A;  4HPS A;  2B3U A;  4QVT A;  2CNM A;  4HNX B;  5BWA B;  2GLJ A;  5IV0 A;  4KVO E;  2I3C A;  2HUZ A;  3B3C A;  4A37 A;  1M4L A;  2I00 A;  3NFQ A;  4NGR A;  4CAX A;  4RI1 A;  3GIU A;  7CPA A;  3I1U A;  4HNW B;  2PCU A;  2BUE A;  2VZY A;  4C9V A;  3FEE A;  3VRR A;  5IR2 A;  1OBR A;  1B6B A;  1UFH A;  2PJ8 A;  3ZZI A;  1S60 A;  4Y49 C;  2AUM A;  1RTQ A;  5F47 A;  5HH1 A;  3CXP A;  1ZLH A;  4OP4 A;  4H2K A;  5AG6 A;  4A32 A;  4B13 A;  3I6S A;  1KUV A;  2C5Q A;  4E5S A;  2YNC A;  3OWC A;  4AG7 A;  1NMT A;  1M4I A;  3W6X A;  4A39 A;  1XMB A;  2J9A A;  2WZN A;  4KOY A;  3R9F A;  1CP6 A;  4L8A A;  3H8F A;  4OLL A;  4UEF A;  5AGE A;  4BIN A;  3CZX A;  2PJ7 A;  3IU2 A;  1Z8W A;  3GUX A;  4E8O A;  4KUA A;  1Q7L A;  3GKR A;  1X12 A;  4KS9 A;  4KSA A;  4ORF A;  1CPX A;  4KUB A;  4CAE A;  2EZA A;  4AB7 A;  5AXI A;  3IO1 A;  1HDU A;  4KLW A;  4H89 A;  4NF1 A;  4P4J A;  2FE7 A;  4P44 A;  3PB4 X;  1JWQ A;  4Q36 A;  3V8I A;  1Z9E A;  4B5O A;  4G1P A;  2FXF A;  3RNZ A;  3NE8 A;  4C7I A;  4C85 A;  1N71 A;  4C68 A;  5H86 A;  3UY5 A;  3VAT A;  4NGP A;  5IX3 A;  4F9V A;  1ZRS A;  4O23 A;  2EO8 A;  2BEI A;  1ELM P;  4MCS A;  4PSX A;  4PXB A;  1FY7 A;  3EZB A;  2AFW A;  3ISX A;  3S9N A;  1AYE A;  2QEC A;  4C8F A;  1P0H A;  3MRU A;  1BAV A; 
#chains in the Genus database with same CATH homology
 2F7V A;  2PIY A;  4NJQ A;  3SI2 A;  4UEE A;  2PJC A;  3RBU A;  2EK8 A;  3NH8 A;  3D68 A;  3D7D A;  4PXE A;  3PB7 X;  3KR4 A;  1CX8 A;  1ARM A;  5CPA A;  1TKH A;  1BPN A;  3KGQ A;  2XEJ A;  4A38 A;  1CP7 A;  1TKF A;  2PVV A;  2PJ5 A;  1CPS A;  4Q7A A;  1ARL A;  3PRT A;  3SI1 A;  2V77 A;  4C9R A;  1Z5R A;  2AFZ A;  3VTA A;  2ZEN A;  4X8I A;  1LAP A;  2CTC A;  4OME A;  2PJ2 A;  4X2T A;  2C6P A;  2PJ3 A;  1CG2 A;  2WYR A;  4ZYQ A;  1FNO A;  3D7H A;  3PFE A;  1TKJ A;  3EIF A;  5LRJ A;  3D4U A;  3DGV A;  3B3S A;  2NSM A;  4IAV A;  3FF3 A;  4CDJ A;  1PYT B;  1Z8L A;  4C86 A;  2ZEM A;  3VH9 A;  3NA6 A;  2O53 A;  1F57 A;  4P4E A;  5THW A;  1GYT A;  1ZG8 A;  4LQG A;  5LRK A;  3PB6 X;  1TXR A;  4DUK A;  5DS0 A;  2BO9 A;  3CPX A;  4DJL A;  2ZEH A;  1R43 A;  4OC4 A;  3GLJ A;  3PBB A;  5JH9 A;  3PB8 X;  4MXU A;  4R76 A;  2AFM A;  3SI0 A;  4P45 A;  4ZY1 A;  3SJG A;  3ICU A;  1HDQ A;  5HVH A;  2ANP A;  2ZEL A;  3V38 A;  3PB9 X;  1VIX A;  2RB7 A;  3FED A;  1NSA A;  4TJX A;  2V8V A;  4OID A;  1YME A;  3N5F A;  2BCO A;  4MHN A;  5LYD A;  2PE3 A;  1TF9 A;  4AXV A;  4MCP A;  2PRQ A;  4C8P A;  1FT7 A;  4C8T A;  5I4M A;  3D66 A;  3GB0 A;  2IQ6 A;  2DEA A;  2GRE A;  1LOK A;  4OC2 A;  3CT9 A;  1QMU A;  1YSJ A;  3LWU A;  4CDK A;  4MMO A;  3IEH A;  4C8C A;  3KHZ A;  2V8H A;  4MCQ A;  3HUV A;  4F8Z A;  4ZY2 A;  1HEE A;  3JRU A;  1EE3 P;  1LAN A;  4UF4 A;  3PBE A;  3B35 A;  4OC1 A;  3BHX A;  1XRY A;  2POK A;  4GM5 A;  5LYI A;  4CPA A;  3KQZ A;  5HVG A;  2JEW A;  2ZEF A;  4R6T A;  4BD9 A;  3VAR A;  1XFO A;  5IB9 A;  2BOA A;  1VHO A;  4MHZ A;  3K2K A;  2PJB A;  3FVL A;  5JM6 A;  4OC3 A;  3MN8 A;  3KAS A;  2QVP A;  3BXM A;  3PEI A;  4PPZ A;  4YU9 A;  2EK9 A;  3IFE A;  3KZW A;  2IJZ A;  2EWB A;  4TJV A;  4KNG E;  1F2O A;  3FX6 A;  4R8F A;  3S9M A;  3NFZ A;  1IY7 A;  3L2N A;  3T8W A;  4NGN A;  4DYO A;  4EME A;  4F9U A;  1LCP A;  1Y9Z A;  3WC7 A;  1TF8 A;  1PCA A;  2RFH A;  3WC6 A;  1XF1 A;  1R3N A;  4PQA A;  5ELY A;  2ZEP A;  4C9E A;  2PJ0 A;  4IHM A;  1V6C A;  8CPA A;  3IIB A;  3KI9 A;  1ZG7 A;  3WC5 A;  4IK2 A;  5LYF A;  1LFW A;  4B6Z A;  2AFS A;  1ELL P;  4FBE A;  1F2P A;  4C84 A;  1YW6 A;  4UIB A;  2HB6 A;  2AFO A;  2QJ8 A;  3D67 A;  2CF4 A;  3FMC A;  2PVW A;  2V8G A;  3S9L A;  2PJ4 A;  2XEI A;  3NH4 A;  1JQG A;  3IWW A;  2NYQ A;  3I74 A;  4JYW A;  2XEG A;  3B3T A;  3DLJ A;  3KR5 A;  2O4H A;  4C9A A;  2CTB A;  1BPM A;  3WT4 A;  4YN3 A;  1WVM A;  2F8H A;  1KWM A;  3CPA A;  4MHY A;  3KL9 A;  2AFU A;  3FEC A;  1Z2L A;  4A94 A;  4EWT A;  2C1C A;  4WJB A;  1YLO A;  4FWU A;  4WWV A;  5JGF A;  4C8A A;  4OC0 A;  2FVG A;  2OR4 A;  2PIZ A;  3KHX A;  4UEZ A;  3FH4 A;  2GP4 A;  2ABZ A;  1IGB A;  3QNV A;  5LYL A;  3KQX A;  1Y0Y A;  3WAB A;  4NGS A;  5CBM A;  1BLL E;  2GLF A;  4X3R A;  3B3V A;  4MRI A;  4ZI6 A;  1YW4 A;  3TC8 A;  4PXC A;  3V7Z A;  3H8E A;  4OKO A;  4RUH A;  2Q43 A;  2XEF A;  4P4I A;  2PJ1 A;  1Y0R A;  4EFD A;  4MCR A;  1QQ9 A;  4W9Y A;  1DTD A;  5HVF A;  2G9D A;  3TX8 A;  1UWY A;  5F09 A;  3PFO A;  4NGM A;  4ZX9 A;  4P4D A;  5D8N A;  1Y7E A;  2ZEG A;  4C99 A;  1ZG9 A;  2ZOF A;  4OC5 A;  3B7I A;  1ZLI A;  2IMO A;  1LAM A;  2PJ9 A;  4NGT A;  4KSI A;  4P4F A;  4NJR A;  4PXD A;  4P6Y A;  4R7M A;  2ZED A;  4TWE A;  3H8G A;  2JBJ A;  5K8O A;  3SJE A;  3SJF A;  4JZ0 A;  2AFX A;  5J1Q A;  3BI0 A;  4OIW A;  4NFR A;  4UIA A;  3D7F A;  2HC9 A;  5K8P A;  3HLP A;  4Z65 A;  4FUU A;  4C9U A;  2C6C A;  4P4B A;  2PJA A;  4TNU A;  4NGQ A;  2PJ6 A;  1AMP A;  4FAI A;  3B3W A;  2JBK A;  1XBU A;  4K3N A;  4ZY0 A;  3RZA A;  5LRG A;  2C6G A;  2V8D A;  3FJU A;  2OOT A;  3ISZ A;  3D7G A;  3NH5 A;  5K8N A;  2CIJ A;  1CBX A;  2GU2 A;  4YWY A;  3IJ3 A;  5K8M A;  4ZX8 A;  2Q4Z A;  1H8L A;  4MHP A;  3LMS A;  2Q51 A;  1DE4 C;  3B2Y A;  4C8U A;  2ZEE A;  3BI1 A;  3IC1 A;  3RAM A;  2VL1 A;  2QYV A;  4P10 A;  3CDX A;  1VHE A;  6CPA A;  5D29 A;  3SJX A;  3K9T A;  1XJO A;  2ZEO A;  5HXD A;  4ONW A;  1VGY A;  2ZOG A;  2GLJ A;  2I3C A;  4A37 A;  1M4L A;  4NGR A;  7CPA A;  3I1U A;  2PCU A;  4C9V A;  3FEE A;  5IR2 A;  1OBR A;  2PJ8 A;  1RTQ A;  1ZLH A;  4OP4 A;  4H2K A;  3I6S A;  2C5Q A;  4A39 A;  1XMB A;  2J9A A;  2WZN A;  1CP6 A;  4UEF A;  3H8F A;  2PJ7 A;  3GUX A;  1Q7L A;  1CPX A;  3IO1 A;  1HDU A;  4P4J A;  4P44 A;  3PB4 X;  4G1P A;  4C85 A;  3VAT A;  4NGP A;  4F9V A;  4O23 A;  1ELM P;  4MCS A;  4PXB A;  2AFW A;  3ISX A;  3S9N A;  1AYE A;  4C8F A;  3B3C A;  3MRU A;  1BAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...