4OC3A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cfibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(furan-2-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc3A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc3A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc3A02
5IB9A 2I3CA 1CBXA 4PXEA 1R3NA 4R8FA 1Z2LA 3CT9A 1AYEA 4ZY0A 1LAPA 3V7ZA 4B6ZA 2OR4A 1DE4C 2DEAA 2CTBA 3LWUA 4UF4A 4OIDA 4YWYA 2QVPA 5K8PA 2F7VA 4TWEA 3HUVA 4YU9A 6CPAA 1PYTB 4F9UA 4C86A 4A38A 4MXUA 3B3VA 3IEHA 2O53A 2Q51A 5HXDA 4H2KA 3SJEA 2HC9A 4IAVA 4C84A 3D7FA 1Z5RA 3SI2A 3SJXA 3D66A 2HB6A 5LYDA 1LANA 7CPAA 3IO1A 1LAMA 4NGNA 3IIBA 2F8HA 2POKA 3TC8A 2C6GA 3JRUA 3IJ3A 4BD9A 3H8FA 4MHZA 3MN8A 3B3CA 1BAVA 2ANPA 2PJ4A 1QQ9A 4ONWA 3D7HA 2PJ8A 5JM6A 1ZG9A 4C8PA 3B3TA 3NFZA 3EIFA 4UIAA 1TKJA 5DS0A 2XEIA 4X3RA 1Y0RA 4AXVA 1Z8LA 4MHYA 3KGQA 3RZAA 2PVVA 3T8WA 1HDUA 3H8GA 2PCUA 1BLLE 1H8LA 4MCSA 3IWWA 4PXBA 4CPAA 2QYVA 5LRGA 3GB0A 1F2OA 2XEJA 2AFXA 3PB8X 4PPZA 2AFSA 5D29A 3K2KA 2JBJA 4NGQA 4JYWA 5K8MA 2CTCA 2ZEOA 2C1CA 3SI0A 1Y9ZA 3IFEA 2RFHA 2WZNA 2OOTA 1XFOA 4FUUA 1CX8A 1NSAA 1HDQA 3BI0A 3FF3A 2V8HA 4A39A 1XJOA 2PJ1A 3SI1A 5K8NA 2G9DA 4CDJA 3NA6A 4ZY1A 2NSMA 3S9NA 2AFZA 1Y0YA 4NGPA 3N5FA 5JGFA 4EMEA 3KZWA 1PCAA 3WC7A 3DLJA 4NGRA 4MRIA 4PQAA 3VATA 2PJ0A 5CPAA 2PE3A 3PEIA 2EK8A 4C9VA 1ARMA 3CDXA 3IC1A 4W9YA 2ABZA 2RB7A 1CP7A 2WYRA 3PB7X 3PFOA 3PB6X 4P44A 2EWBA 4FAIA 5HVGA 2GLJA 3B7IA 4NGSA 2PJ9A 2ZEFA 3KQXA 3GUXA 4P4IA 3KR5A 3H8EA 4P4EA 4R6TA 3SJFA 1ZLIA 4OP4A 5LYLA 2ZEDA 3FMCA 2FVGA 1VGYA 4NJRA 4MCQA 4EFDA 4Q7AA 4DUKA 4IHMA 1VHOA 4TJXA 2O4HA 4TJVA 3LMSA 5HVHA 1DTDA 4C8FA 4OC5A 3B2YA 3QNVA 2GU2A 2XEGA 1CG2A 1LFWA 3FH4A 2XEFA 4OC1A 1YW6A 5I4MA 3KL9A 4MHPA 1YSJA 1FT7A 2BOAA 4Z65A 1XMBA 4C9UA 4P10A 2IJZA 2Q43A 2ZEHA 2PIZA 3CPXA 4K3NA 3NH5A 1FNOA 5K8OA 2JBKA 5THWA 2ZEMA 2PJCA 4C9RA 2BCOA 2ZEPA 3FX6A 1ZLHA 2JEWA 4UEEA 4FBEA 4C8TA 4OMEA 3I1UA 4P4JA 5J1QA 3DGVA 4C85A 1TKHA 4JZ0A 4C9EA 4MCPA 4OC0A 2ZEGA 4C8UA 2GLFA 3VH9A 3B3WA 3ICUA 2IMOA 1YLOA 1Q7LA 5LYIA 4NGTA 4OIWA 2PJ5A 1XF1A 1IGBA 5ELYA 2CIJA 1R43A 3PFEA 5LRJA 3ISXA 1TF8A 1QMUA 2ZELA 4ZYQA 4KSIA 3TX8A 4P4DA 2PVWA 3NH8A 4X2TA 5D8NA 2ZENA 4C9AA 2Q4ZA 2AFUA 1TKFA 1UWYA 4X8IA 3D4UA 3VARA 1WVMA 4ZY2A 3FVLA 2V8GA 2PJBA 1CPSA 1YW4A 3WC6A 3BI1A 2EK9A 3BHXA 3CPAA 5CBMA 3RAMA 1VHEA 4C8CA 4P45A 4YN3A 5HVFA 4C99A 3PRTA 4NJQA 2V77A 2PJ6A 4KNGE 4CDKA 2PJAA 4IK2A 4R76A 1CP6A 2V8DA 2PJ3A 3FECA 4A37A 2ZOFA 3I74A 4FWUA 4UEFA 2V8VA 4OC4A 4GM5A 4MMOA 4ZI6A 2PIYA 2C6CA 3SJGA 1JQGA 1Y7EA 4UEZA 3BXMA 1ELMP 3PBBA 4RUHA 3WC5A 2QJ8A 3B35A 3D7DA 3KASA 3NH4A 4F9VA 3KQZA 3D7GA 4OC2A 3PB9X 2AFOA 3PB4X 3WABA 3WT4A 3L2NA 3D67A 3ISZA 4LQGA 4A94A 1LOKA 1AMPA 1ZG7A 8CPAA 3FEEA 4MCRA 1GYTA 4TNUA 2BO9A 4P6YA 4ZX9A 3B3SA 4PXDA 1F57A 3MRUA 4MHNA 4OC3A 4UIBA 2NYQA 4C8AA 4EWTA 3GLJA 3RBUA 2ZEEA 3HLPA 4NFRA 1YMEA 1TF9A 3S9LA 1M4LA 4ZX8A 3S9MA 3K9TA 2AFWA 3VTAA 1ARLA 2ZOGA 2PJ2A 2AFMA 1LCPA 2PRQA 5LYFA 1TXRA 1OBRA 4F8ZA 1ZG8A 2IQ6A 4P4FA 4DYOA 4WWVA 3I6SA 3KHXA 2VL1A 1XRYA 1ELLP 1KWMA 3KI9A 1CPXA 4WJBA 3FEDA 4NGMA 3PBEA 4R7MA 1BPMA 2CF4A 4OKOA 5LRKA 1V6CA 3KHZA 3FJUA 3D68A 5JH9A 4P4BA 1IY7A 5F09A 4G1PA 1BPNA 1F2PA 4PXCA 3KR4A 4DJLA 1RTQA 2C6PA 1XBUA 1VIXA 2PJ7A 4O23A 2GREA 2J9AA 1HEEA 3V38A 1EE3P
chains in the Genus database with same CATH superfamily
3VRPA 3GJZA 5IB9A 5HH1A 2I3CA 4B11A 1CBXA 3VRNA 4PXEA 5EC4A 4COBA 2ODFA 4LQ6A 2ZW4A 1R3NA 4R8FA 5FD8A 3S6KA 1C30B 2Z10A 1Z2LA 1Z4EA 4UCPA 3R9FA 4A32A 3CT9A 4RS2A 1AYEA 4ZY0A 1LAPA 2VZYA 1YREA 3V7ZA 4B6ZA 2OR4A 3IGRA 1DE4C 1QSTA 2DEAA 2GIVA 4CYQA 4JLYA 1GGOA 3C26A 5A28A 2CTBA 3LWUA 3PZJA 4UF4A 4OIDA 1VI4A 4F6AA 2Z11A 2Z3MA 4A4CA 4RR2B 4UCNA 4YWYA 2QVPA 5A27A 1JDBC 1V0CA 3ZJ0A 1GHEA 2Y0MA 5K8PA 2F7VA 1YLEA 1XIXA 4H1HA 4BTFA 4TWEA 3HUVA 1X10A 4JXRA 1SQHA 4YU9A 6CPAA 1PU9A 4QC6A 4B10A 4QB9A 3H4QA 2ZXVA 3N7ZA 3NFQA 3F9KC 1M4GA 1PYTB 1YX0A 5KTAA 4F9UA 5K99A 4C86A 2Z3OA 4A38A 2DIKA 3PGPA 4MXUA 4UFWA 4C2ZA 3B3VA 1KBLA 3EFAA 3IEHA 3PFVA 1VHSA 2O53A 2DPTA 2Q51A 3NE7A 1LRZA 5HXDA 4H2KA 3SJEA 2EO8A 2HC9A 4IAVA 2YJVA 3D7FA 3KRVA 1Z5RA 1M4DA 4MI4A 4ONUA 3SJXA 3D66A 2GE3A 3SI2A 2Q04A 2GP4A 2HB6A 5LYDA 3RO0A 1QSRA 2Q0YA 1A2ZA 1LANA 1CJWA 1Y7RA 3PLFB 7CPAA 2B5GA 2B3VA 4CAXA 1MJ9A 3VROA 3IO1A 1LAMA 4NGNA 4E0AA 3OAKA 3IIBA 2F8HA 4MY3A 2B4BA 2JEVA 2POKA 4JVOA 3TC8A 1Q2YA 2Z3NA 2C6GA 3JRUA 4XPDB 2HI6A 3IJ3A 4BD9A 3H8FA 4MHZA 3MN8A 3B3CA 3NE8A 3S6HA 3HPGG 4QBJA 1BAVA 1YR0A 2F5IA 2OZGA 2ANPA 3BJ7A 2D4OA 1QQ9A 2P0WA 2PJ4A 4ONWA 3D7HA 1IB1E 4GPLB 2PJ8A 5GCNA 2P6GA 5JM6A 1ZG9A 3B8GA 4C8PA 3B3TA 3NFZA 1S3ZA 1NSLA 3EIFA 4JWPA 4UIAA 1TKJA 2HUZA 5EMIA 4BINA 1EZAA 1NBWA 5DS0A 2XEIA 4X3RA 1Y0RA 4AXVA 1Z8LA 3OB2B 4MHYA 3KGQA 3RZAA 3F0AA 2PVVA 4AB7A 2VEZA 3T8WA 3FRMA 4CYOA 5KTDA 2X0SA 2B3UA 3R96A 4MHDA 5G22A 1HDUA 3H8GA 2PCUA 1BLLE 1H8LA 4GS4A 2D4PA 4KOUA 3T90A 1VKCA 4MCSA 3IWWA 4PXBA 5G21A 4A2ZA 4CPAA 2QYVA 4Q36A 5DWNA 5HKYA 4Q38A 3GB0A 5LRGA 2XPLA 1F2OA 2XEJA 2AFXA 2GANA 4UWIA 3IWEA 3PB8X 4PPZA 3FB3A 2AFSA 4AVCA 3SR3A 5D29A 3K2KA 2JBJA 1KC7A 4NGQA 1YVKA 1XOVA 2Q4VA 2H5MA 4JYWA 4C7IA 4KSAA 3S6GA 2FT0A 1FY7A 2YNCA 5K8MA 2EZAA 4JXQA 2CTCA 3R9EA 2ZEOA 2C1CA 3SI0A 2OZHA 3IFEA 4AG7A 1Y9ZA 3EZBA 3TO7A 4C84A 4CYNA 3JTKA 2RFHA 4LUAA 4II9A 2WZNA 3TLCA 5AG6A 2OOTA 1XFOA 2BEIA 4K30A 4FUUA 1CX8A 2WPWA 4QUSA 1XE4A 2REEA 1NSAA 2FIAA 1HDQA 4CGOA 4E8OA 4IF5A 2DLAA 3BI0A 3WR7A 3ZNIA 5CNPA 3TO6A 3FF3A 1BOBA 2V8HA 1XJOA 3W91A 3WC5A 4A39A 5IX3A 2PJ1A 3SI1A 5K8NA 2G9DA 4I49A 4CDJA 2B4JC 1ON0A 1Z4RA 4CYPA 3QAYA 4MJXA 3NA6A 3TCVA 4ZY1A 1I21A 1JWQA 2NSMA 3S9NA 1J4JA 2AFZA 1Y0YA 2FS5A 2WPXA 4NGPA 5FVJA 3N5FA 2JLMA 5JGFA 3OP0A 4EMEA 1Z8TA 3IWGA 3FYNA 3KZWA 1PCAA 3WC7A 4CAVA 3DLJA 4CRYB 4NGRA 1IICA 2OH1A 4MRIA 4PQAA 4UWJA 3H5ZA 3VATA 2VKZG 4COGA 1ZRSA 2PJ0A 5CPAA 1IU8A 2PE3A 4UA3A 4MFPA 4KSFA 1KEEB 3OWCA 3CXPA 3PEIA 2EK8A 4YGOA 1ARMA 3CDXA 4C9VA 4CRZB 3IC1A 4W9YA 2EUIA 3QB8A 1JDEA 4MFKA 1MJBA 5HKWA 2ABZA 2HQYA 2OZUA 2RB7A 4UCMA 5KTCA 1CP7A 3FNCA 1C3OB 1EO0A 2CNMA 2WYRA 3P2FA 3PB7X 3PFOA 3PB6X 4HNWB 4XPKA 1NXJA 4P44A 2B58A 2EWBA 5AGEA 4FAIA 5F49A 3P2HA 1TIQA 4M6HA 2BSWA 4CAWA 5HVGA 3BUMB 2GLJA 3B7IA 1L0CA 4NGSA 3W6SA 2X7BA 2PJ9A 4AVAA 2ZEFA 1Y9KA 3KQXA 5G20A 4CGLA 5AXIA 2EBJA 3TFYA 2YJTA 3GUXA 1M44A 3R9GA 4P4IA 1XMTA 3KR5A 3H8EA 4P4EA 4R6TA 3DDDA 3SJFA 1ZLIA 4OP4A 5LYLA 3TLYA 1QSNA 1K4JA 2ZEDA 3FMCA 4NF1A 2FVGA 1P0HA 2WUUA 4INJA 5JYBA 1VGYA 3PT1A 4PK3A 1DIKA 4NJRA 3SXOA 4MCQA 4EFDA 4IIXA 4Q7AA 1U6MA 4CZ1A 4DUKA 3KKWA 4A30A 2PR8A 2QMLA 1VHOA 4IHMA 4TJXA 2O4HA 4OAEA 3D8PA 3K9UA 3UY5A 4J3GA 4TJVA 3LMSA 2Q7SA 5HVHA 3FIXA 1DTDA 4C8FA 4OC5A 2PSWA 1N71A 3B2YA 3QNVA 4AG9A 2GU2A 4ZBGA 2XEGA 1CG2A 1LFWA 2BUEA 3DR6A 5JPHA 3FH4A 2D0OA 3QAHA 2XEFA 4OC1A 3TT2A 4A4BA 1CS0B 1S60A 1YW6A 3R1KA 4OLLA 5I4MA 3CZXA 3KL9A 4QVTA 1XEBA 4MHPA 1S7FA 1YSJA 2NMTA 4IUSA 4R9MA 1FT7A 3LACA 2ZPAA 1NE9A 4LX9A 2VQYA 2CBLA 2BOAA 3EO4A 1XMBA 3F5BA 4Z65A 2ZW7A 3BJ8A 4P10A 1A9XB 3G23A 4IIYA 4C9UA 1Q5XA 2ZW6A 4ZGYB 1R57A 2IJZA 3LD2A 4BMHA 1OZPA 3VRRA 2Q43A 2ZEHA 3TLGB 4C2XA 2PIZA 3TOBA 5F46A 4JJXA 1S5KA 3TLEA 5J8CA 3V8IA 4CO9A 4MJ8A 2G0BA 3CPXA 4A31A 4MBUA 4K3NA 3NH5A 2J8MA 4H6UA 4ORFA 2Q7BA 3R95A 5G1ZA 1FNOA 2ARHA 3TOAA 2Z3LA 2I00A 4RI1A 3VWDA 1FBVA 1ZO0A 5K8OA 2JBKA 2YNEA 5THWA 2ZEMA 1Q2DA 2PJCA 1YVOA 5F13A 4FD5A 1IYLA 5BWAB 4C9RA 2BCOA 2ZEPA 4XNHB 1CE8B 3FX6A 4CGMA 1R61A 1ZLHA 4FD7A 1WJTA 1YVHA 2JEWA 4MY0A 4OADA 4UEEA 2HWGA 5F1YA 5J3XA 3BUOB 4FBEA 2R7HA 4BPWB 2VZZA 4C8TA 2K5TA 4L89A 4OMEA 4B5OA 3T0TA 3I1UA 3A9LA 3I3GA 4MFQA 5F9MA 4E5SA 4CGNA 4XPDC 4HNYB 4C7HA 4P4JA 3BLNA 4KORA 4Y49C 3DNSA 1S7LA 4U5YA 4C2YA 4NEXA 5F48A 5J1QA 2AUNA 2VBQA 4EYSA 3DGVA 5F5XA 2FCKA 1Z9UA 4C85A 1TKHA 4JZ0A 5C88A 2CXAA 4E94A 2PRBA 4C9EA 4MCPA 4OC0A 5BY0A 2ZEGA 2G3AA 2QECA 4C8UA 2GLFA 2KCWA 3VH9A 3B3WA 3ICUA 1T36B 2IMOA 1YLOA 1Q7LA 3EZAA 5LYIA 3TTHA 4NGTA 3C8OA 4OIWA 5I0CA 2PJ5A 3GYAA 5ISVA 1M4IA 1XF1A 1KUVA 3GIUA 1IGBA 1EZBA 2EZBA 3G3SA 5ELYA 2CIJA 3LODA 3TLBA 1YGHA 1R43A 1KUYA 3PFEA 5LRJA 3ISXA 1TF8A 1QMUA 2OB0A 5AG4A 3D2PA 4L8AA 2OU2A 2ZELA 4UBRA 4KOVA 2ATRA 4ZYQA 3SHPA 4KSIA 1IOIA 1P4NA 3TX8A 3T5MA 3IU2A 2FL4A 4P4DA 2PVWA 4F0YA 3TE4A 3FBUA 3NH8A 4X2TA 3T05A 3TLGA 5D8NA 4KLWA 3TLAA 4B12A 2ZENA 3SXNA 4DNCA 4C9AA 2Q4ZA 2AFUA 4KS9A 4MI1A 1TKFA 4KOYA 4CAFA 1UWYA 1RO5A 4X8IA 2PCNA 3D4UA 4MFZA 4B5PA 3VARA 1WVMA 3DSBA 5EBVA 4KOXA 3FVLA 2V8GA 4MFJA 4ZY2A 2PJBA 4KUAA 1CPSA 1YW4A 3WC6A 3BI1A 1IYKA 2EK9A 4UFXA 3BHXA 3CPAA 1MJAA 5CBMA 1Z9EA 3RAMA 5H84A 4E2AA 3ZZIA 3GY9A 1VHEA 3EY5A 3RNZA 4P45A 1KUXA 2I79A 4A33A 5HVFA 3T9YA 4YN3A 4C99A 3PRTA 3CXQA 2XPPA 2FIWA 4HKFA 3BUNB 2A4NA 4NJQA 2B4DB 1PUAA 2V77A 1WWZA 2PJ6A 3W6XA 3D2MA 2Z0ZA 4C8CA 5IV0A 4KNGE 4M6GA 4M3SA 4EVYA 4CDKA 2PJAA 3OB1B 4KVOE 4IK2A 1S7KA 3E0KA 4R76A 1VBGA 2JDDA 1CP6A 2V8DA 2PJ3A 3FECA 4FD6A 4M6IA 5AG7A 4A37A 1Q2CA 2ZOFA 4MFLA 3I74A 4FWUA 2J8RA 3TYXA 4FD4A 4R3KA 4UEFA 2V8VA 4OC4A 4R57A 1CM0A 2XPOA 3RYOA 2IL4A 2VI7A 3GKRA 5HMNA 4HNXB 4GM5A 4B13A 4MMOA 3D3SA 2FXFA 4XNHC 4ZI6A 1RXTA 2PIYA 3HMJG 4UFVA 5H86A 1Y9WA 2EZCA 2C6CA 1B47A 2RC4A 1NMTA 3BUXB 4KLVA 2AUMA 4H89A 3SJGA 1JQGA 2XPNA 4F0XA 3EZEA 3VGOA 1Y7EA 4Y49B 4U9YA 4UEZA 3BXMA 2HV2A 4AVBA 3EXNA 1ELMP 2Q44A 2PDOA 3PBBA 2AE6A 3EC4A 2Z3PA 4CS0B 2WSAA 2D0PA 1YK3A 3TO9A 1UFHA 4RUHA 4JD6A 2QJ8A 3B35A 3D7DA 3KASA 3NH4A 4HPSA 3KQZA 3D7GA 4KOSA 4F9VA 4OC2A 5F47A 3PB9X 2AFOA 1QSOA 3PB4X 3WABA 3WT4A 3L2NA 3D67A 4XPLA 1XF8A 3ISZA 3JVNA 4A95A 4LQGA 4A94A 1LOKA 1AMPA 1ZG7A 2Z3KA 4PSXA 3FEEA 4BBHA 3U88C 8CPAA 4MCRA 1GYTA 5AG5A 4X5KA 4TNUA 1QSMA 2BO9A 4P6YA 4PK2A 5JQ4A 1M1DA 4KVME 4YFJA 4ZX9A 4CGPA 1BXRB 2MP0A 3B3SA 4PXDA 1VBHA 1F57A 2YGWA 2YNDA 3MRUA 4MHNA 4PV6A 4PSWA 4OC3A 4UIBA 2NYQA 2R82A 4C8AA 4EWTA 2CNTA 4U9ZA 3GLJA 2B4DA 4KZTA 3RBUA 2ZEEA 3HLPA 2YNCC 3F8KA 2DF5A 3FXTA 3PP9A 4NFRA 1YMEA 2PQ8A 2Q4YA 1TF9A 1ZL0A 3HPHE 2E28A 3NOJA 3S9LA 1M4LA 4KOTA 5IB0A 4ZX8A 3S9MA 4R87A 5HKZA 3K9TA 2AFWA 3K4IA 3VTAA 1ARLA 1I12A 2ZOGA 3VWEA 1J3LA 3T07A 5C82A 2Y1NA 2PJ2A 2VXKA 4C68A 2AFMA 5J8FA 4M85A 3TLZA 3U1BA 1BO4A 1LCPA 2J8NA 2PRQA 5LYFA 1IIDA 4RN7A 1Z8WA 1TXRA 1OBRA 1Z8XA 4F8ZA 3O8ZA 1ZG8A 2IQ6A 1IOFA 3G8WA 4P4FA 2CNSA 2GFQA 4B14A 1I1DA 2QIRA 4WWVA 4DYOA 4GXHA 4NSQA 3BUWB 5E96A 3I6SA 5JVLA 1MK4A 3I9SA 4NXYA 2B0AA 2UV8G 2C5QA 4KUBA 1B87A 2FSRA 1WK4A 2DXQA 1ZYMA 3S6FA 3KHXA 2VL1A 5DWMA 2DPSA 1XRYA 2G3TA 1ELLP 2HROA 1KWMA 2REFA 3KI9A 1CPXA 4WJBA 4KOWA 1S7NA 3FEDA 4NGMA 4BPXB 3PBEA 1BPMA 2CF4A 4OKOA 4R7MA 2OLSA 2AJ6A 2EVNA 4YRHA 2FM4A 2PR1A 1KZFA 5LRKA 1M6VB 1V6CA 5IR2A 3VRQA 2Y1MA 4NCZA 4BPUB 3KHZA 1X12A 2R1IA 3FJUA 2N3AB 3D68A 4H6ZA 4KVXA 5JH9A 3DR8A 1B6BA 4P4BA 2B5GB 5F09A 1IY7A 3CXSA 4G1PA 1BPNA 1F2PA 2CY2A 3KR4A 4PXCA 4DJLA 2P6FA 2BL1A 2O28A 3JUWA 4CAEA 1RTQA 2C6PA 2R98A 3IU1A 2PC1A 4R3LA 1XBUA 2P6EA 2R8VA 4M8DA 1VIXA 2PJ7A 2C27A 4O23A 1YQEA 4B5PB 2JDCA 2GREA 2J9AA 3MGDA 1HEEA 4J0NA 1AUGA 2FE7A 3V38A 2ZW5A 1EE3P
chains in the Genus database with same CATH topology
5IB9A 2I3CA 1CBXA 4PXEA 1R3NA 4R8FA 1Z2LA 3CT9A 1AYEA 4ZY0A 1LAPA 3V7ZA 4B6ZA 2OR4A 1DE4C 2DEAA 2CTBA 3LWUA 4UF4A 4OIDA 4YWYA 2QVPA 5K8PA 2F7VA 4TWEA 3HUVA 4YU9A 6CPAA 1PYTB 4F9UA 4C86A 4A38A 4MXUA 3B3VA 3IEHA 2O53A 2Q51A 5HXDA 4H2KA 3SJEA 2HC9A 4IAVA 4C84A 3D7FA 1Z5RA 2GP4A 3SI2A 3SJXA 3D66A 2HB6A 5LYDA 1LANA 7CPAA 3IO1A 1LAMA 4NGNA 3IIBA 2F8HA 2POKA 3TC8A 2C6GA 3JRUA 3IJ3A 4BD9A 3H8FA 4MHZA 3MN8A 3B3CA 1BAVA 2ANPA 2PJ4A 1QQ9A 4ONWA 3D7HA 2PJ8A 5JM6A 1ZG9A 4C8PA 3B3TA 3NFZA 3EIFA 4UIAA 1TKJA 5DS0A 2XEIA 4X3RA 1Y0RA 4AXVA 1Z8LA 4MHYA 3KGQA 3RZAA 2PVVA 3T8WA 1HDUA 3H8GA 2PCUA 1BLLE 1H8LA 4MCSA 3IWWA 4PXBA 4CPAA 2QYVA 5LRGA 3GB0A 1F2OA 2XEJA 2AFXA 3PB8X 4PPZA 2AFSA 5D29A 3K2KA 2JBJA 4NGQA 4JYWA 5K8MA 2CTCA 2ZEOA 2C1CA 3SI0A 1Y9ZA 3IFEA 2RFHA 2WZNA 2OOTA 1XFOA 4FUUA 1CX8A 1NSAA 1HDQA 3BI0A 3FF3A 2V8HA 4A39A 1XJOA 2PJ1A 3SI1A 5K8NA 2G9DA 4CDJA 3NA6A 4ZY1A 2NSMA 3S9NA 2AFZA 1Y0YA 4NGPA 3N5FA 5JGFA 4EMEA 3KZWA 1PCAA 3WC7A 3DLJA 4NGRA 4MRIA 4PQAA 3VATA 2PJ0A 5CPAA 2PE3A 3PEIA 2EK8A 4C9VA 1ARMA 3CDXA 3IC1A 4W9YA 2ABZA 2RB7A 1CP7A 2WYRA 3PB7X 3PFOA 3PB6X 4P44A 2EWBA 4FAIA 5HVGA 2GLJA 3B7IA 4NGSA 2PJ9A 2ZEFA 3KQXA 3GUXA 4P4IA 3KR5A 3H8EA 4P4EA 4R6TA 3SJFA 1ZLIA 4OP4A 5LYLA 2ZEDA 3FMCA 2FVGA 1VGYA 4NJRA 4MCQA 4EFDA 4Q7AA 4DUKA 4IHMA 1VHOA 4TJXA 2O4HA 4TJVA 3LMSA 5HVHA 1DTDA 4C8FA 4OC5A 3B2YA 3QNVA 2GU2A 2XEGA 1CG2A 1LFWA 3FH4A 2XEFA 4OC1A 1YW6A 5I4MA 3KL9A 4MHPA 1YSJA 1FT7A 2BOAA 4Z65A 1XMBA 4C9UA 4P10A 2IJZA 2Q43A 2ZEHA 2PIZA 3CPXA 4K3NA 3NH5A 1FNOA 5K8OA 2JBKA 5THWA 2ZEMA 2PJCA 4C9RA 2BCOA 2ZEPA 3FX6A 1ZLHA 2JEWA 4UEEA 4FBEA 4C8TA 4OMEA 3I1UA 4P4JA 5J1QA 3DGVA 4C85A 1TKHA 4JZ0A 4C9EA 4MCPA 4OC0A 2ZEGA 4C8UA 2GLFA 3VH9A 3B3WA 3ICUA 2IMOA 1YLOA 1Q7LA 5LYIA 4NGTA 4OIWA 2PJ5A 1XF1A 1IGBA 5ELYA 2CIJA 1R43A 3PFEA 5LRJA 3ISXA 1TF8A 1QMUA 2ZELA 4ZYQA 4KSIA 3TX8A 4P4DA 2PVWA 3NH8A 4X2TA 5D8NA 2ZENA 4C9AA 2Q4ZA 2AFUA 1TKFA 1UWYA 4X8IA 3D4UA 3VARA 1WVMA 4ZY2A 3FVLA 2V8GA 2PJBA 1CPSA 1YW4A 3WC6A 3BI1A 2EK9A 3BHXA 3CPAA 5CBMA 3RAMA 1VHEA 4C8CA 4P45A 4YN3A 5HVFA 4C99A 3PRTA 4NJQA 2V77A 2PJ6A 4KNGE 4CDKA 2PJAA 4IK2A 4R76A 1CP6A 2V8DA 2PJ3A 3FECA 4A37A 2ZOFA 3I74A 4FWUA 4UEFA 2V8VA 4OC4A 4GM5A 4MMOA 4ZI6A 2PIYA 2C6CA 3SJGA 1JQGA 1Y7EA 4UEZA 3BXMA 1ELMP 3PBBA 4RUHA 3WC5A 2QJ8A 3B35A 3D7DA 3KASA 3NH4A 4F9VA 3KQZA 3D7GA 4OC2A 3PB9X 2AFOA 3PB4X 3WABA 3WT4A 3L2NA 3D67A 3ISZA 4LQGA 4A94A 1LOKA 1AMPA 1ZG7A 8CPAA 3FEEA 4MCRA 1GYTA 4TNUA 2BO9A 4P6YA 4ZX9A 3B3SA 4PXDA 1F57A 3MRUA 4MHNA 4OC3A 4UIBA 2NYQA 4C8AA 4EWTA 3GLJA 3RBUA 2ZEEA 3HLPA 4NFRA 1YMEA 1TF9A 3S9LA 1M4LA 4ZX8A 3S9MA 3K9TA 2AFWA 3VTAA 1ARLA 2ZOGA 2PJ2A 2AFMA 1LCPA 2PRQA 5LYFA 1TXRA 1OBRA 4F8ZA 1ZG8A 2IQ6A 4P4FA 4DYOA 4WWVA 3I6SA 2C5QA 3KHXA 2VL1A 1XRYA 1ELLP 1KWMA 3KI9A 1CPXA 4WJBA 3FEDA 4NGMA 3PBEA 4R7MA 1BPMA 2CF4A 4OKOA 5LRKA 1V6CA 5IR2A 3KHZA 3FJUA 3D68A 5JH9A 4P4BA 1IY7A 5F09A 4G1PA 1BPNA 1F2PA 4PXCA 3KR4A 4DJLA 1RTQA 2C6PA 1XBUA 1VIXA 2PJ7A 4O23A 2GREA 2J9AA 1HEEA 3V38A 1EE3P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IB9 A;  2I3C A;  1CBX A;  4PXE A;  1R3N A;  4R8F A;  1Z2L A;  3CT9 A;  1AYE A;  4ZY0 A;  1LAP A;  3V7Z A;  4B6Z A;  2OR4 A;  1DE4 C;  2DEA A;  2CTB A;  3LWU A;  4UF4 A;  4OID A;  4YWY A;  2QVP A;  5K8P A;  2F7V A;  4TWE A;  3HUV A;  4YU9 A;  6CPA A;  1PYT B;  4F9U A;  4C86 A;  4A38 A;  4MXU A;  3B3V A;  3IEH A;  2O53 A;  2Q51 A;  5HXD A;  4H2K A;  3SJE A;  2HC9 A;  4IAV A;  4C84 A;  3D7F A;  1Z5R A;  3SI2 A;  3SJX A;  3D66 A;  2HB6 A;  5LYD A;  1LAN A;  7CPA A;  3IO1 A;  1LAM A;  4NGN A;  3IIB A;  2F8H A;  2POK A;  3TC8 A;  2C6G A;  3JRU A;  3IJ3 A;  4BD9 A;  3H8F A;  4MHZ A;  3MN8 A;  3B3C A;  1BAV A;  2ANP A;  2PJ4 A;  1QQ9 A;  4ONW A;  3D7H A;  2PJ8 A;  5JM6 A;  1ZG9 A;  4C8P A;  3B3T A;  3NFZ A;  3EIF A;  4UIA A;  1TKJ A;  5DS0 A;  2XEI A;  4X3R A;  1Y0R A;  4AXV A;  1Z8L A;  4MHY A;  3KGQ A;  3RZA A;  2PVV A;  3T8W A;  1HDU A;  3H8G A;  2PCU A;  1BLL E;  1H8L A;  4MCS A;  3IWW A;  4PXB A;  4CPA A;  2QYV A;  5LRG A;  3GB0 A;  1F2O A;  2XEJ A;  2AFX A;  3PB8 X;  4PPZ A;  2AFS A;  5D29 A;  3K2K A;  2JBJ A;  4NGQ A;  4JYW A;  5K8M A;  2CTC A;  2ZEO A;  2C1C A;  3SI0 A;  1Y9Z A;  3IFE A;  2RFH A;  2WZN A;  2OOT A;  1XFO A;  4FUU A;  1CX8 A;  1NSA A;  1HDQ A;  3BI0 A;  3FF3 A;  2V8H A;  4A39 A;  1XJO A;  2PJ1 A;  3SI1 A;  5K8N A;  2G9D A;  4CDJ A;  3NA6 A;  4ZY1 A;  2NSM A;  3S9N A;  2AFZ A;  1Y0Y A;  4NGP A;  3N5F A;  5JGF A;  4EME A;  3KZW A;  1PCA A;  3WC7 A;  3DLJ A;  4NGR A;  4MRI A;  4PQA A;  3VAT A;  2PJ0 A;  5CPA A;  2PE3 A;  3PEI A;  2EK8 A;  4C9V A;  1ARM A;  3CDX A;  3IC1 A;  4W9Y A;  2ABZ A;  2RB7 A;  1CP7 A;  2WYR A;  3PB7 X;  3PFO A;  3PB6 X;  4P44 A;  2EWB A;  4FAI A;  5HVG A;  2GLJ A;  3B7I A;  4NGS A;  2PJ9 A;  2ZEF A;  3KQX A;  3GUX A;  4P4I A;  3KR5 A;  3H8E A;  4P4E A;  4R6T A;  3SJF A;  1ZLI A;  4OP4 A;  5LYL A;  2ZED A;  3FMC A;  2FVG A;  1VGY A;  4NJR A;  4MCQ A;  4EFD A;  4Q7A A;  4DUK A;  4IHM A;  1VHO A;  4TJX A;  2O4H A;  4TJV A;  3LMS A;  5HVH A;  1DTD A;  4C8F A;  4OC5 A;  3B2Y A;  3QNV A;  2GU2 A;  2XEG A;  1CG2 A;  1LFW A;  3FH4 A;  2XEF A;  4OC1 A;  1YW6 A;  5I4M A;  3KL9 A;  4MHP A;  1YSJ A;  1FT7 A;  2BOA A;  4Z65 A;  1XMB A;  4C9U A;  4P10 A;  2IJZ A;  2Q43 A;  2ZEH A;  2PIZ A;  3CPX A;  4K3N A;  3NH5 A;  1FNO A;  5K8O A;  2JBK A;  5THW A;  2ZEM A;  2PJC A;  4C9R A;  2BCO A;  2ZEP A;  3FX6 A;  1ZLH A;  2JEW A;  4UEE A;  4FBE A;  4C8T A;  4OME A;  3I1U A;  4P4J A;  5J1Q A;  3DGV A;  4C85 A;  1TKH A;  4JZ0 A;  4C9E A;  4MCP A;  4OC0 A;  2ZEG A;  4C8U A;  2GLF A;  3VH9 A;  3B3W A;  3ICU A;  2IMO A;  1YLO A;  1Q7L A;  5LYI A;  4NGT A;  4OIW A;  2PJ5 A;  1XF1 A;  1IGB A;  5ELY A;  2CIJ A;  1R43 A;  3PFE A;  5LRJ A;  3ISX A;  1TF8 A;  1QMU A;  2ZEL A;  4ZYQ A;  4KSI A;  3TX8 A;  4P4D A;  2PVW A;  3NH8 A;  4X2T A;  5D8N A;  2ZEN A;  4C9A A;  2Q4Z A;  2AFU A;  1TKF A;  1UWY A;  4X8I A;  3D4U A;  3VAR A;  1WVM A;  4ZY2 A;  3FVL A;  2V8G A;  2PJB A;  1CPS A;  1YW4 A;  3WC6 A;  3BI1 A;  2EK9 A;  3BHX A;  3CPA A;  5CBM A;  3RAM A;  1VHE A;  4C8C A;  4P45 A;  4YN3 A;  5HVF A;  4C99 A;  3PRT A;  4NJQ A;  2V77 A;  2PJ6 A;  4KNG E;  4CDK A;  2PJA A;  4IK2 A;  4R76 A;  1CP6 A;  2V8D A;  2PJ3 A;  3FEC A;  4A37 A;  2ZOF A;  3I74 A;  4FWU A;  4UEF A;  2V8V A;  4OC4 A;  4GM5 A;  4MMO A;  4ZI6 A;  2PIY A;  2C6C A;  3SJG A;  1JQG A;  1Y7E A;  4UEZ A;  3BXM A;  1ELM P;  3PBB A;  4RUH A;  3WC5 A;  2QJ8 A;  3B35 A;  3D7D A;  3KAS A;  3NH4 A;  4F9V A;  3KQZ A;  3D7G A;  4OC2 A;  3PB9 X;  2AFO A;  3PB4 X;  3WAB A;  3WT4 A;  3L2N A;  3D67 A;  3ISZ A;  4LQG A;  4A94 A;  1LOK A;  1AMP A;  1ZG7 A;  8CPA A;  3FEE A;  4MCR A;  1GYT A;  4TNU A;  2BO9 A;  4P6Y A;  4ZX9 A;  3B3S A;  4PXD A;  1F57 A;  3MRU A;  4MHN A;  4OC3 A;  4UIB A;  2NYQ A;  4C8A A;  4EWT A;  3GLJ A;  3RBU A;  2ZEE A;  3HLP A;  4NFR A;  1YME A;  1TF9 A;  3S9L A;  1M4L A;  4ZX8 A;  3S9M A;  3K9T A;  2AFW A;  3VTA A;  1ARL A;  2ZOG A;  2PJ2 A;  2AFM A;  1LCP A;  2PRQ A;  5LYF A;  1TXR A;  1OBR A;  4F8Z A;  1ZG8 A;  2IQ6 A;  4P4F A;  4DYO A;  4WWV A;  3I6S A;  3KHX A;  2VL1 A;  1XRY A;  1ELL P;  1KWM A;  3KI9 A;  1CPX A;  4WJB A;  3FED A;  4NGM A;  3PBE A;  4R7M A;  1BPM A;  2CF4 A;  4OKO A;  5LRK A;  1V6C A;  3KHZ A;  3FJU A;  3D68 A;  5JH9 A;  4P4B A;  1IY7 A;  5F09 A;  4G1P A;  1BPN A;  1F2P A;  4PXC A;  3KR4 A;  4DJL A;  1RTQ A;  2C6P A;  1XBU A;  1VIX A;  2PJ7 A;  4O23 A;  2GRE A;  2J9A A;  1HEE A;  3V38 A;  1EE3 P; 
#chains in the Genus database with same CATH topology
 3VRP A;  3GJZ A;  5IB9 A;  5HH1 A;  2I3C A;  4B11 A;  1CBX A;  3VRN A;  4PXE A;  5EC4 A;  4COB A;  2ODF A;  4LQ6 A;  2ZW4 A;  1R3N A;  4R8F A;  5FD8 A;  3S6K A;  1C30 B;  2Z10 A;  1Z2L A;  1Z4E A;  4UCP A;  3R9F A;  4A32 A;  3CT9 A;  4RS2 A;  1AYE A;  4ZY0 A;  1LAP A;  2VZY A;  1YRE A;  3V7Z A;  4B6Z A;  2OR4 A;  3IGR A;  1DE4 C;  1QST A;  2DEA A;  2GIV A;  4CYQ A;  4JLY A;  1GGO A;  3C26 A;  5A28 A;  2CTB A;  3LWU A;  3PZJ A;  4UF4 A;  4OID A;  1VI4 A;  4F6A A;  2Z11 A;  2Z3M A;  4A4C A;  4RR2 B;  4UCN A;  4YWY A;  2QVP A;  5A27 A;  1JDB C;  1V0C A;  3ZJ0 A;  1GHE A;  2Y0M A;  5K8P A;  2F7V A;  1YLE A;  1XIX A;  4H1H A;  4BTF A;  4TWE A;  3HUV A;  1X10 A;  4JXR A;  1SQH A;  4YU9 A;  6CPA A;  1PU9 A;  4QC6 A;  4B10 A;  4QB9 A;  3H4Q A;  2ZXV A;  3N7Z A;  3NFQ A;  3F9K C;  1M4G A;  1PYT B;  1YX0 A;  5KTA A;  4F9U A;  5K99 A;  4C86 A;  2Z3O A;  4A38 A;  2DIK A;  3PGP A;  4MXU A;  4UFW A;  4C2Z A;  3B3V A;  1KBL A;  3EFA A;  3IEH A;  3PFV A;  1VHS A;  2O53 A;  2DPT A;  2Q51 A;  3NE7 A;  1LRZ A;  5HXD A;  4H2K A;  3SJE A;  2EO8 A;  2HC9 A;  4IAV A;  2YJV A;  3D7F A;  3KRV A;  1Z5R A;  1M4D A;  4MI4 A;  4ONU A;  3SJX A;  3D66 A;  2GE3 A;  3SI2 A;  2Q04 A;  2GP4 A;  2HB6 A;  5LYD A;  3RO0 A;  1QSR A;  2Q0Y A;  1A2Z A;  1LAN A;  1CJW A;  1Y7R A;  3PLF B;  7CPA A;  2B5G A;  2B3V A;  4CAX A;  1MJ9 A;  3VRO A;  3IO1 A;  1LAM A;  4NGN A;  4E0A A;  3OAK A;  3IIB A;  2F8H A;  4MY3 A;  2B4B A;  2JEV A;  2POK A;  4JVO A;  3TC8 A;  1Q2Y A;  2Z3N A;  2C6G A;  3JRU A;  4XPD B;  2HI6 A;  3IJ3 A;  4BD9 A;  3H8F A;  4MHZ A;  3MN8 A;  3B3C A;  3NE8 A;  3S6H A;  3HPG G;  4QBJ A;  1BAV A;  1YR0 A;  2F5I A;  2OZG A;  2ANP A;  3BJ7 A;  2D4O A;  1QQ9 A;  2P0W A;  2PJ4 A;  4ONW A;  3D7H A;  1IB1 E;  4GPL B;  2PJ8 A;  5GCN A;  2P6G A;  5JM6 A;  1ZG9 A;  3B8G A;  4C8P A;  3B3T A;  3NFZ A;  1S3Z A;  1NSL A;  3EIF A;  4JWP A;  4UIA A;  1TKJ A;  2HUZ A;  5EMI A;  4BIN A;  1EZA A;  1NBW A;  5DS0 A;  2XEI A;  4X3R A;  1Y0R A;  4AXV A;  1Z8L A;  3OB2 B;  4MHY A;  3KGQ A;  3RZA A;  3F0A A;  2PVV A;  4AB7 A;  2VEZ A;  3T8W A;  3FRM A;  4CYO A;  5KTD A;  2X0S A;  2B3U A;  3R96 A;  4MHD A;  5G22 A;  1HDU A;  3H8G A;  2PCU A;  1BLL E;  1H8L A;  4GS4 A;  2D4P A;  4KOU A;  3T90 A;  1VKC A;  4MCS A;  3IWW A;  4PXB A;  5G21 A;  4A2Z A;  4CPA A;  2QYV A;  4Q36 A;  5DWN A;  5HKY A;  4Q38 A;  3GB0 A;  5LRG A;  2XPL A;  1F2O A;  2XEJ A;  2AFX A;  2GAN A;  4UWI A;  3IWE A;  3PB8 X;  4PPZ A;  3FB3 A;  2AFS A;  4AVC A;  3SR3 A;  5D29 A;  3K2K A;  2JBJ A;  1KC7 A;  4NGQ A;  1YVK A;  1XOV A;  2Q4V A;  2H5M A;  4JYW A;  4C7I A;  4KSA A;  3S6G A;  2FT0 A;  1FY7 A;  2YNC A;  5K8M A;  2EZA A;  4JXQ A;  2CTC A;  3R9E A;  2ZEO A;  2C1C A;  3SI0 A;  2OZH A;  3IFE A;  4AG7 A;  1Y9Z A;  3EZB A;  3TO7 A;  4C84 A;  4CYN A;  3JTK A;  2RFH A;  4LUA A;  4II9 A;  2WZN A;  3TLC A;  5AG6 A;  2OOT A;  1XFO A;  2BEI A;  4K30 A;  4FUU A;  1CX8 A;  2WPW A;  4QUS A;  1XE4 A;  2REE A;  1NSA A;  2FIA A;  1HDQ A;  4CGO A;  4E8O A;  4IF5 A;  2DLA A;  3BI0 A;  3WR7 A;  3ZNI A;  5CNP A;  3TO6 A;  3FF3 A;  1BOB A;  2V8H A;  1XJO A;  3W91 A;  3WC5 A;  4A39 A;  5IX3 A;  2PJ1 A;  3SI1 A;  5K8N A;  2G9D A;  4I49 A;  4CDJ A;  2B4J C;  1ON0 A;  1Z4R A;  4CYP A;  3QAY A;  4MJX A;  3NA6 A;  3TCV A;  4ZY1 A;  1I21 A;  1JWQ A;  2NSM A;  3S9N A;  1J4J A;  2AFZ A;  1Y0Y A;  2FS5 A;  2WPX A;  4NGP A;  5FVJ A;  3N5F A;  2JLM A;  5JGF A;  3OP0 A;  4EME A;  1Z8T A;  3IWG A;  3FYN A;  3KZW A;  1PCA A;  3WC7 A;  4CAV A;  3DLJ A;  4CRY B;  4NGR A;  1IIC A;  2OH1 A;  4MRI A;  4PQA A;  4UWJ A;  3H5Z A;  3VAT A;  2VKZ G;  4COG A;  1ZRS A;  2PJ0 A;  5CPA A;  1IU8 A;  2PE3 A;  4UA3 A;  4MFP A;  4KSF A;  1KEE B;  3OWC A;  3CXP A;  3PEI A;  2EK8 A;  4YGO A;  1ARM A;  3CDX A;  4C9V A;  4CRZ B;  3IC1 A;  4W9Y A;  2EUI A;  3QB8 A;  1JDE A;  4MFK A;  1MJB A;  5HKW A;  2ABZ A;  2HQY A;  2OZU A;  2RB7 A;  4UCM A;  5KTC A;  1CP7 A;  3FNC A;  1C3O B;  1EO0 A;  2CNM A;  2WYR A;  3P2F A;  3PB7 X;  3PFO A;  3PB6 X;  4HNW B;  4XPK A;  1NXJ A;  4P44 A;  2B58 A;  2EWB A;  5AGE A;  4FAI A;  5F49 A;  3P2H A;  1TIQ A;  4M6H A;  2BSW A;  4CAW A;  5HVG A;  3BUM B;  2GLJ A;  3B7I A;  1L0C A;  4NGS A;  3W6S A;  2X7B A;  2PJ9 A;  4AVA A;  2ZEF A;  1Y9K A;  3KQX A;  5G20 A;  4CGL A;  5AXI A;  2EBJ A;  3TFY A;  2YJT A;  3GUX A;  1M44 A;  3R9G A;  4P4I A;  1XMT A;  3KR5 A;  3H8E A;  4P4E A;  4R6T A;  3DDD A;  3SJF A;  1ZLI A;  4OP4 A;  5LYL A;  3TLY A;  1QSN A;  1K4J A;  2ZED A;  3FMC A;  4NF1 A;  2FVG A;  1P0H A;  2WUU A;  4INJ A;  5JYB A;  1VGY A;  3PT1 A;  4PK3 A;  1DIK A;  4NJR A;  3SXO A;  4MCQ A;  4EFD A;  4IIX A;  4Q7A A;  1U6M A;  4CZ1 A;  4DUK A;  3KKW A;  4A30 A;  2PR8 A;  2QML A;  1VHO A;  4IHM A;  4TJX A;  2O4H A;  4OAE A;  3D8P A;  3K9U A;  3UY5 A;  4J3G A;  4TJV A;  3LMS A;  2Q7S A;  5HVH A;  3FIX A;  1DTD A;  4C8F A;  4OC5 A;  2PSW A;  1N71 A;  3B2Y A;  3QNV A;  4AG9 A;  2GU2 A;  4ZBG A;  2XEG A;  1CG2 A;  1LFW A;  2BUE A;  3DR6 A;  5JPH A;  3FH4 A;  2D0O A;  3QAH A;  2XEF A;  4OC1 A;  3TT2 A;  4A4B A;  1CS0 B;  1S60 A;  1YW6 A;  3R1K A;  4OLL A;  5I4M A;  3CZX A;  3KL9 A;  4QVT A;  1XEB A;  4MHP A;  1S7F A;  1YSJ A;  2NMT A;  4IUS A;  4R9M A;  1FT7 A;  3LAC A;  2ZPA A;  1NE9 A;  4LX9 A;  2VQY A;  2CBL A;  2BOA A;  3EO4 A;  1XMB A;  3F5B A;  4Z65 A;  2ZW7 A;  3BJ8 A;  4P10 A;  1A9X B;  3G23 A;  4IIY A;  4C9U A;  1Q5X A;  2ZW6 A;  4ZGY B;  1R57 A;  2IJZ A;  3LD2 A;  4BMH A;  1OZP A;  3VRR A;  2Q43 A;  2ZEH A;  3TLG B;  4C2X A;  2PIZ A;  3TOB A;  5F46 A;  4JJX A;  1S5K A;  3TLE A;  5J8C A;  3V8I A;  4CO9 A;  4MJ8 A;  2G0B A;  3CPX A;  4A31 A;  4MBU A;  4K3N A;  3NH5 A;  2J8M A;  4H6U A;  4ORF A;  2Q7B A;  3R95 A;  5G1Z A;  1FNO A;  2ARH A;  3TOA A;  2Z3L A;  2I00 A;  4RI1 A;  3VWD A;  1FBV A;  1ZO0 A;  5K8O A;  2JBK A;  2YNE A;  5THW A;  2ZEM A;  1Q2D A;  2PJC A;  1YVO A;  5F13 A;  4FD5 A;  1IYL A;  5BWA B;  4C9R A;  2BCO A;  2ZEP A;  4XNH B;  1CE8 B;  3FX6 A;  4CGM A;  1R61 A;  1ZLH A;  4FD7 A;  1WJT A;  1YVH A;  2JEW A;  4MY0 A;  4OAD A;  4UEE A;  2HWG A;  5F1Y A;  5J3X A;  3BUO B;  4FBE A;  2R7H A;  4BPW B;  2VZZ A;  4C8T A;  2K5T A;  4L89 A;  4OME A;  4B5O A;  3T0T A;  3I1U A;  3A9L A;  3I3G A;  4MFQ A;  5F9M A;  4E5S A;  4CGN A;  4XPD C;  4HNY B;  4C7H A;  4P4J A;  3BLN A;  4KOR A;  4Y49 C;  3DNS A;  1S7L A;  4U5Y A;  4C2Y A;  4NEX A;  5F48 A;  5J1Q A;  2AUN A;  2VBQ A;  4EYS A;  3DGV A;  5F5X A;  2FCK A;  1Z9U A;  4C85 A;  1TKH A;  4JZ0 A;  5C88 A;  2CXA A;  4E94 A;  2PRB A;  4C9E A;  4MCP A;  4OC0 A;  5BY0 A;  2ZEG A;  2G3A A;  2QEC A;  4C8U A;  2GLF A;  2KCW A;  3VH9 A;  3B3W A;  3ICU A;  1T36 B;  2IMO A;  1YLO A;  1Q7L A;  3EZA A;  5LYI A;  3TTH A;  4NGT A;  3C8O A;  4OIW A;  5I0C A;  2PJ5 A;  3GYA A;  5ISV A;  1M4I A;  1XF1 A;  1KUV A;  3GIU A;  1IGB A;  1EZB A;  2EZB A;  3G3S A;  5ELY A;  2CIJ A;  3LOD A;  3TLB A;  1YGH A;  1R43 A;  1KUY A;  3PFE A;  5LRJ A;  3ISX A;  1TF8 A;  1QMU A;  2OB0 A;  5AG4 A;  3D2P A;  4L8A A;  2OU2 A;  2ZEL A;  4UBR A;  4KOV A;  2ATR A;  4ZYQ A;  3SHP A;  4KSI A;  1IOI A;  1P4N A;  3TX8 A;  3T5M A;  3IU2 A;  2FL4 A;  4P4D A;  2PVW A;  4F0Y A;  3TE4 A;  3FBU A;  3NH8 A;  4X2T A;  3T05 A;  3TLG A;  5D8N A;  4KLW A;  3TLA A;  4B12 A;  2ZEN A;  3SXN A;  4DNC A;  4C9A A;  2Q4Z A;  2AFU A;  4KS9 A;  4MI1 A;  1TKF A;  4KOY A;  4CAF A;  1UWY A;  1RO5 A;  4X8I A;  2PCN A;  3D4U A;  4MFZ A;  4B5P A;  3VAR A;  1WVM A;  3DSB A;  5EBV A;  4KOX A;  3FVL A;  2V8G A;  4MFJ A;  4ZY2 A;  2PJB A;  4KUA A;  1CPS A;  1YW4 A;  3WC6 A;  3BI1 A;  1IYK A;  2EK9 A;  4UFX A;  3BHX A;  3CPA A;  1MJA A;  5CBM A;  1Z9E A;  3RAM A;  5H84 A;  4E2A A;  3ZZI A;  3GY9 A;  1VHE A;  3EY5 A;  3RNZ A;  4P45 A;  1KUX A;  2I79 A;  4A33 A;  5HVF A;  3T9Y A;  4YN3 A;  4C99 A;  3PRT A;  3CXQ A;  2XPP A;  2FIW A;  4HKF A;  3BUN B;  2A4N A;  4NJQ A;  2B4D B;  1PUA A;  2V77 A;  1WWZ A;  2PJ6 A;  3W6X A;  3D2M A;  2Z0Z A;  4C8C A;  5IV0 A;  4KNG E;  4M6G A;  4M3S A;  4EVY A;  4CDK A;  2PJA A;  3OB1 B;  4KVO E;  4IK2 A;  1S7K A;  3E0K A;  4R76 A;  1VBG A;  2JDD A;  1CP6 A;  2V8D A;  2PJ3 A;  3FEC A;  4FD6 A;  4M6I A;  5AG7 A;  4A37 A;  1Q2C A;  2ZOF A;  4MFL A;  3I74 A;  4FWU A;  2J8R A;  3TYX A;  4FD4 A;  4R3K A;  4UEF A;  2V8V A;  4OC4 A;  4R57 A;  1CM0 A;  2XPO A;  3RYO A;  2IL4 A;  2VI7 A;  3GKR A;  5HMN A;  4HNX B;  4GM5 A;  4B13 A;  4MMO A;  3D3S A;  2FXF A;  4XNH C;  4ZI6 A;  1RXT A;  2PIY A;  3HMJ G;  4UFV A;  5H86 A;  1Y9W A;  2EZC A;  2C6C A;  1B47 A;  2RC4 A;  1NMT A;  3BUX B;  4KLV A;  2AUM A;  4H89 A;  3SJG A;  1JQG A;  2XPN A;  4F0X A;  3EZE A;  3VGO A;  1Y7E A;  4Y49 B;  4U9Y A;  4UEZ A;  3BXM A;  2HV2 A;  4AVB A;  3EXN A;  1ELM P;  2Q44 A;  2PDO A;  3PBB A;  2AE6 A;  3EC4 A;  2Z3P A;  4CS0 B;  2WSA A;  2D0P A;  1YK3 A;  3TO9 A;  1UFH A;  4RUH A;  4JD6 A;  2QJ8 A;  3B35 A;  3D7D A;  3KAS A;  3NH4 A;  4HPS A;  3KQZ A;  3D7G A;  4KOS A;  4F9V A;  4OC2 A;  5F47 A;  3PB9 X;  2AFO A;  1QSO A;  3PB4 X;  3WAB A;  3WT4 A;  3L2N A;  3D67 A;  4XPL A;  1XF8 A;  3ISZ A;  3JVN A;  4A95 A;  4LQG A;  4A94 A;  1LOK A;  1AMP A;  1ZG7 A;  2Z3K A;  4PSX A;  3FEE A;  4BBH A;  3U88 C;  8CPA A;  4MCR A;  1GYT A;  5AG5 A;  4X5K A;  4TNU A;  1QSM A;  2BO9 A;  4P6Y A;  4PK2 A;  5JQ4 A;  1M1D A;  4KVM E;  4YFJ A;  4ZX9 A;  4CGP A;  1BXR B;  2MP0 A;  3B3S A;  4PXD A;  1VBH A;  1F57 A;  2YGW A;  2YND A;  3MRU A;  4MHN A;  4PV6 A;  4PSW A;  4OC3 A;  4UIB A;  2NYQ A;  2R82 A;  4C8A A;  4EWT A;  2CNT A;  4U9Z A;  3GLJ A;  2B4D A;  4KZT A;  3RBU A;  2ZEE A;  3HLP A;  2YNC C;  3F8K A;  2DF5 A;  3FXT A;  3PP9 A;  4NFR A;  1YME A;  2PQ8 A;  2Q4Y A;  1TF9 A;  1ZL0 A;  3HPH E;  2E28 A;  3NOJ A;  3S9L A;  1M4L A;  4KOT A;  5IB0 A;  4ZX8 A;  3S9M A;  4R87 A;  5HKZ A;  3K9T A;  2AFW A;  3K4I A;  3VTA A;  1ARL A;  1I12 A;  2ZOG A;  3VWE A;  1J3L A;  3T07 A;  5C82 A;  2Y1N A;  2PJ2 A;  2VXK A;  4C68 A;  2AFM A;  5J8F A;  4M85 A;  3TLZ A;  3U1B A;  1BO4 A;  1LCP A;  2J8N A;  2PRQ A;  5LYF A;  1IID A;  4RN7 A;  1Z8W A;  1TXR A;  1OBR A;  1Z8X A;  4F8Z A;  3O8Z A;  1ZG8 A;  2IQ6 A;  1IOF A;  3G8W A;  4P4F A;  2CNS A;  2GFQ A;  4B14 A;  1I1D A;  2QIR A;  4WWV A;  4DYO A;  4GXH A;  4NSQ A;  3BUW B;  5E96 A;  3I6S A;  5JVL A;  1MK4 A;  3I9S A;  4NXY A;  2B0A A;  2UV8 G;  2C5Q A;  4KUB A;  1B87 A;  2FSR A;  1WK4 A;  2DXQ A;  1ZYM A;  3S6F A;  3KHX A;  2VL1 A;  5DWM A;  2DPS A;  1XRY A;  2G3T A;  1ELL P;  2HRO A;  1KWM A;  2REF A;  3KI9 A;  1CPX A;  4WJB A;  4KOW A;  1S7N A;  3FED A;  4NGM A;  4BPX B;  3PBE A;  1BPM A;  2CF4 A;  4OKO A;  4R7M A;  2OLS A;  2AJ6 A;  2EVN A;  4YRH A;  2FM4 A;  2PR1 A;  1KZF A;  5LRK A;  1M6V B;  1V6C A;  5IR2 A;  3VRQ A;  2Y1M A;  4NCZ A;  4BPU B;  3KHZ A;  1X12 A;  2R1I A;  3FJU A;  2N3A B;  3D68 A;  4H6Z A;  4KVX A;  5JH9 A;  3DR8 A;  1B6B A;  4P4B A;  2B5G B;  5F09 A;  1IY7 A;  3CXS A;  4G1P A;  1BPN A;  1F2P A;  2CY2 A;  3KR4 A;  4PXC A;  4DJL A;  2P6F A;  2BL1 A;  2O28 A;  3JUW A;  4CAE A;  1RTQ A;  2C6P A;  2R98 A;  3IU1 A;  2PC1 A;  4R3L A;  1XBU A;  2P6E A;  2R8V A;  4M8D A;  1VIX A;  2PJ7 A;  2C27 A;  4O23 A;  1YQE A;  4B5P B;  2JDC A;  2GRE A;  2J9A A;  3MGD A;  1HEE A;  4J0N A;  1AUG A;  2FE7 A;  3V38 A;  2ZW5 A;  1EE3 P; 
#chains in the Genus database with same CATH homology
 5IB9 A;  2I3C A;  1CBX A;  4PXE A;  1R3N A;  4R8F A;  1Z2L A;  3CT9 A;  1AYE A;  4ZY0 A;  1LAP A;  3V7Z A;  4B6Z A;  2OR4 A;  1DE4 C;  2DEA A;  2CTB A;  3LWU A;  4UF4 A;  4OID A;  4YWY A;  2QVP A;  5K8P A;  2F7V A;  4TWE A;  3HUV A;  4YU9 A;  6CPA A;  1PYT B;  4F9U A;  4C86 A;  4A38 A;  4MXU A;  3B3V A;  3IEH A;  2O53 A;  2Q51 A;  5HXD A;  4H2K A;  3SJE A;  2HC9 A;  4IAV A;  4C84 A;  3D7F A;  1Z5R A;  2GP4 A;  3SI2 A;  3SJX A;  3D66 A;  2HB6 A;  5LYD A;  1LAN A;  7CPA A;  3IO1 A;  1LAM A;  4NGN A;  3IIB A;  2F8H A;  2POK A;  3TC8 A;  2C6G A;  3JRU A;  3IJ3 A;  4BD9 A;  3H8F A;  4MHZ A;  3MN8 A;  3B3C A;  1BAV A;  2ANP A;  2PJ4 A;  1QQ9 A;  4ONW A;  3D7H A;  2PJ8 A;  5JM6 A;  1ZG9 A;  4C8P A;  3B3T A;  3NFZ A;  3EIF A;  4UIA A;  1TKJ A;  5DS0 A;  2XEI A;  4X3R A;  1Y0R A;  4AXV A;  1Z8L A;  4MHY A;  3KGQ A;  3RZA A;  2PVV A;  3T8W A;  1HDU A;  3H8G A;  2PCU A;  1BLL E;  1H8L A;  4MCS A;  3IWW A;  4PXB A;  4CPA A;  2QYV A;  5LRG A;  3GB0 A;  1F2O A;  2XEJ A;  2AFX A;  3PB8 X;  4PPZ A;  2AFS A;  5D29 A;  3K2K A;  2JBJ A;  4NGQ A;  4JYW A;  5K8M A;  2CTC A;  2ZEO A;  2C1C A;  3SI0 A;  1Y9Z A;  3IFE A;  2RFH A;  2WZN A;  2OOT A;  1XFO A;  4FUU A;  1CX8 A;  1NSA A;  1HDQ A;  3BI0 A;  3FF3 A;  2V8H A;  4A39 A;  1XJO A;  2PJ1 A;  3SI1 A;  5K8N A;  2G9D A;  4CDJ A;  3NA6 A;  4ZY1 A;  2NSM A;  3S9N A;  2AFZ A;  1Y0Y A;  4NGP A;  3N5F A;  5JGF A;  4EME A;  3KZW A;  1PCA A;  3WC7 A;  3DLJ A;  4NGR A;  4MRI A;  4PQA A;  3VAT A;  2PJ0 A;  5CPA A;  2PE3 A;  3PEI A;  2EK8 A;  4C9V A;  1ARM A;  3CDX A;  3IC1 A;  4W9Y A;  2ABZ A;  2RB7 A;  1CP7 A;  2WYR A;  3PB7 X;  3PFO A;  3PB6 X;  4P44 A;  2EWB A;  4FAI A;  5HVG A;  2GLJ A;  3B7I A;  4NGS A;  2PJ9 A;  2ZEF A;  3KQX A;  3GUX A;  4P4I A;  3KR5 A;  3H8E A;  4P4E A;  4R6T A;  3SJF A;  1ZLI A;  4OP4 A;  5LYL A;  2ZED A;  3FMC A;  2FVG A;  1VGY A;  4NJR A;  4MCQ A;  4EFD A;  4Q7A A;  4DUK A;  4IHM A;  1VHO A;  4TJX A;  2O4H A;  4TJV A;  3LMS A;  5HVH A;  1DTD A;  4C8F A;  4OC5 A;  3B2Y A;  3QNV A;  2GU2 A;  2XEG A;  1CG2 A;  1LFW A;  3FH4 A;  2XEF A;  4OC1 A;  1YW6 A;  5I4M A;  3KL9 A;  4MHP A;  1YSJ A;  1FT7 A;  2BOA A;  4Z65 A;  1XMB A;  4C9U A;  4P10 A;  2IJZ A;  2Q43 A;  2ZEH A;  2PIZ A;  3CPX A;  4K3N A;  3NH5 A;  1FNO A;  5K8O A;  2JBK A;  5THW A;  2ZEM A;  2PJC A;  4C9R A;  2BCO A;  2ZEP A;  3FX6 A;  1ZLH A;  2JEW A;  4UEE A;  4FBE A;  4C8T A;  4OME A;  3I1U A;  4P4J A;  5J1Q A;  3DGV A;  4C85 A;  1TKH A;  4JZ0 A;  4C9E A;  4MCP A;  4OC0 A;  2ZEG A;  4C8U A;  2GLF A;  3VH9 A;  3B3W A;  3ICU A;  2IMO A;  1YLO A;  1Q7L A;  5LYI A;  4NGT A;  4OIW A;  2PJ5 A;  1XF1 A;  1IGB A;  5ELY A;  2CIJ A;  1R43 A;  3PFE A;  5LRJ A;  3ISX A;  1TF8 A;  1QMU A;  2ZEL A;  4ZYQ A;  4KSI A;  3TX8 A;  4P4D A;  2PVW A;  3NH8 A;  4X2T A;  5D8N A;  2ZEN A;  4C9A A;  2Q4Z A;  2AFU A;  1TKF A;  1UWY A;  4X8I A;  3D4U A;  3VAR A;  1WVM A;  4ZY2 A;  3FVL A;  2V8G A;  2PJB A;  1CPS A;  1YW4 A;  3WC6 A;  3BI1 A;  2EK9 A;  3BHX A;  3CPA A;  5CBM A;  3RAM A;  1VHE A;  4C8C A;  4P45 A;  4YN3 A;  5HVF A;  4C99 A;  3PRT A;  4NJQ A;  2V77 A;  2PJ6 A;  4KNG E;  4CDK A;  2PJA A;  4IK2 A;  4R76 A;  1CP6 A;  2V8D A;  2PJ3 A;  3FEC A;  4A37 A;  2ZOF A;  3I74 A;  4FWU A;  4UEF A;  2V8V A;  4OC4 A;  4GM5 A;  4MMO A;  4ZI6 A;  2PIY A;  2C6C A;  3SJG A;  1JQG A;  1Y7E A;  4UEZ A;  3BXM A;  1ELM P;  3PBB A;  4RUH A;  3WC5 A;  2QJ8 A;  3B35 A;  3D7D A;  3KAS A;  3NH4 A;  4F9V A;  3KQZ A;  3D7G A;  4OC2 A;  3PB9 X;  2AFO A;  3PB4 X;  3WAB A;  3WT4 A;  3L2N A;  3D67 A;  3ISZ A;  4LQG A;  4A94 A;  1LOK A;  1AMP A;  1ZG7 A;  8CPA A;  3FEE A;  4MCR A;  1GYT A;  4TNU A;  2BO9 A;  4P6Y A;  4ZX9 A;  3B3S A;  4PXD A;  1F57 A;  3MRU A;  4MHN A;  4OC3 A;  4UIB A;  2NYQ A;  4C8A A;  4EWT A;  3GLJ A;  3RBU A;  2ZEE A;  3HLP A;  4NFR A;  1YME A;  1TF9 A;  3S9L A;  1M4L A;  4ZX8 A;  3S9M A;  3K9T A;  2AFW A;  3VTA A;  1ARL A;  2ZOG A;  2PJ2 A;  2AFM A;  1LCP A;  2PRQ A;  5LYF A;  1TXR A;  1OBR A;  4F8Z A;  1ZG8 A;  2IQ6 A;  4P4F A;  4DYO A;  4WWV A;  3I6S A;  2C5Q A;  3KHX A;  2VL1 A;  1XRY A;  1ELL P;  1KWM A;  3KI9 A;  1CPX A;  4WJB A;  3FED A;  4NGM A;  3PBE A;  4R7M A;  1BPM A;  2CF4 A;  4OKO A;  5LRK A;  1V6C A;  5IR2 A;  3KHZ A;  3FJU A;  3D68 A;  5JH9 A;  4P4B A;  1IY7 A;  5F09 A;  4G1P A;  1BPN A;  1F2P A;  4PXC A;  3KR4 A;  4DJL A;  1RTQ A;  2C6P A;  1XBU A;  1VIX A;  2PJ7 A;  4O23 A;  2GRE A;  2J9A A;  1HEE A;  3V38 A;  1EE3 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...