4OC3A

X-ray structure of of human glutamate carboxypeptidase ii (gcpii) in a complex with cfibzl, a urea-based inhibitor n~2~-{[(1s)-1-carboxy-2-(furan-2-yl)ethyl]carbamoyl}-n~6~-(4-iodobenzoyl)-l-lysine
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
696
structure length
694
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structural characterization of P1'-diversified urea-based inhibitors of glutamate carboxypeptidase II.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 265
structure length 694
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4oc3A03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4oc3A01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4oc3A02
4MHZA 4ZY2A 2PJAA 3QNVA 2PIZA 4MCRA 3RZAA 3VATA 1CPXA 4ONWA 1PCAA 2PJ4A 5K8PA 1Y0RA 1BPNA 1VGYA 2NYQA 8CPAA 2AFXA 3B3CA 2QYVA 3VARA 2XEIA 4P10A 3SI2A 2GU2A 3D67A 2CIJA 2BO9A 1M4LA 2AFUA 4GM5A 4WJBA 2XEFA 1Q7LA 1CG2A 2FVGA 2V8GA 3NFZA 3PB9X 4OP4A 3WC5A 3BHXA 3KGQA 4MCPA 3BXMA 1LCPA 1ARMA 1LAMA 1YW6A 1ELLP 3PBEA 3IO1A 1QMUA 3KHZA 1Z2LA 3TC8A 4P4EA 2RFHA 2AFSA 1DE4C 3SI0A 2EK8A 4YU9A 2PJ7A 2AFZA 5HXDA 4F9UA 3IC1A 2PJ2A 2GLJA 2ZEDA 1ZG7A 3EIFA 4P4IA 3V7ZA 3SJGA 4P4JA 4P4BA 2PJ0A 1HEEA 1LFWA 2ZOFA 2PVWA 3WABA 3B35A 5K8MA 5K8OA 4EMEA 3LMSA 4OKOA 4PXCA 4UEEA 4TNUA 4A38A 3GUXA 4NFRA 4RUHA 2V8HA 3ISZA 2XEJA 3D7FA 2IQ6A 2O4HA 3NH4A 4O23A 4TJXA 2PJ6A 2PJ3A 2WYRA 4UIBA 4OC3A 4PPZA 4OC4A 4IAVA 2PCUA 1FT7A 1CP7A 2Q51A 4P4DA 1RTQA 3IJ3A 3HUVA 4C9VA 4C8PA 3KQXA 2PJBA 3V38A 2PJ9A 1Y9ZA 2PJ5A 3LWUA 2WZNA 4MHPA 3VTAA 4PQAA 1NSAA 4DJLA 5JGFA 1ZG9A 2ZOGA 1XMBA 3FH4A 2V77A 1LANA 3PB6X 2PE3A 3KR4A 1AYEA 2HB6A 3KZWA 3N5FA 4F8ZA 2PJ1A 1VIXA 4C85A 1IGBA 2AFMA 3L2NA 3I1UA 1WVMA 1OBRA 4OIWA 4A39A 4MHYA 1TF8A 4ZX8A 1AMPA 4F9VA 3FECA 3RAMA 1XBUA 4H2KA 2EWBA 4X3RA 1XJOA 3K9TA 2RB7A 3I74A 4FBEA 1TKHA 3H8FA 1F2PA 4TWEA 4OC0A 2O53A 4NGSA 4MMOA 4P6YA 1YW4A 2AFOA 5F09A 1HDQA 1F2OA 2F8HA 5LYIA 1JQGA 4C86A 4MRIA 2BOAA 4UIAA 2PVVA 1CPSA 4C9UA 4CPAA 4C8AA 2PJ8A 2ZEEA 4C9EA 4WWVA 3D66A 4C8FA 5LRGA 2AFWA 1YLOA 5CBMA 3KI9A 5IB9A 4C99A 4BD9A 1V6CA 1XF1A 3D68A 5LYFA 1R43A 4X2TA 1ZG8A 2CTBA 4AXVA 4ZYQA 2ZEHA 1CX8A 3GB0A 4EFDA 5THWA 2F7VA 3GLJA 2PJCA 3B7IA 2OR4A 4NGQA 1H8LA 3SJXA 3WC7A 4OC2A 3IWWA 3S9NA 2ZENA 2VL1A 5CPAA 4ZY0A 4FAIA 3PB7X 3B3WA 2C6CA 3WT4A 1LOKA 3MN8A 4X8IA 3B3SA 4R8FA 1CBXA 5LYDA 2OOTA 3BI0A 1R3NA 1TF9A 2GLFA 1KWMA 3MRUA 3VH9A 3KR5A 2I3CA 2QJ8A 2HC9A 4NGTA 4NGMA 3S9LA 3D7DA 2CF4A 3SJEA 2BCOA 3WC6A 3T8WA 2J9AA 4NJRA 5DS0A 1XRYA 3KQZA 3FJUA 1EE3P 1BAVA 2ABZA 5K8NA 3SI1A 3D7GA 4UEFA 2V8VA 4DYOA 2ZEPA 3KL9A 2ZEGA 1VHOA 3PB8X 1TKJA 4C8CA 2IMOA 4P44A 5JM6A 1YSJA 1TKFA 3IIBA 4K3NA 5HVFA 5ELYA 1ELMP 4IK2A 3DGVA 3K2KA 4B6ZA 4OIDA 3D7HA 3ISXA 2QVPA 4ZY1A 3FMCA 4P45A 2CTCA 3PFOA 2Q4ZA 4LQGA 5JH9A 1Y7EA 3TX8A 4PXEA 3DLJA 4MCQA 1Y0YA 2C6GA 3RBUA 3PEIA 2XEGA 3PFEA 1DTDA 4C9RA 4OC5A 4C8UA 4NGPA 3PRTA 5D29A 3FEDA 3B3VA 3PBBA 2JBJA 4G1PA 3IFEA 3PB4X 4MHNA 1UWYA 4C84A 3NA6A 3D4UA 3SJFA 4FUUA 4JYWA 1LAPA 4ZI6A 4JZ0A 1ARLA 1TXRA 5HVHA 4NJQA 4NGNA 4UF4A 4R7MA 4MXUA 4EWTA 4R6TA 3KASA 7CPAA 4A37A 2C1CA 4TJVA 5D8NA 1BLLE 3FVLA 2G9DA 2C6PA 3FEEA 3S9MA 1CP6A 1ZLHA 4DUKA 4IHMA 1Z8LA 1FNOA 3B2YA 2V8DA 4W9YA 1QQ9A 2Q43A 3KHXA 3NH8A 4ZX9A 1VHEA 4P4FA 5J1QA 5LRJA 2GREA 4KNGE 1XFOA 3CPAA 2PIYA 2JEWA 2IJZA 3FX6A 1F57A 2ZEOA 2PRQA 3CDXA 5LYLA 4NGRA 2JBKA 4CDKA 3H8GA 4Q7AA 1HDUA 4UEZA 2POKA 4A94A 1PYTB 6CPAA 2ZELA 4YN3A 3FF3A 3H8EA 1ZLIA 4C8TA 5HVGA 3NH5A 5LRKA 3I6SA 3HLPA 1Z5RA 4Z65A 3CT9A 2ZEMA 4KSIA 2ANPA 4YWYA 1GYTA 2ZEFA 3CPXA 3BI1A 4R76A 3JRUA 2EK9A 3ICUA 4CDJA 4C9AA 3B3TA 1BPMA 1YMEA 4OC1A 4MCSA 5I4MA 4OMEA 3IEHA 4PXBA 4PXDA 1IY7A 2NSMA 2DEAA 4FWUA
chains in the Genus database with same CATH superfamily
2Z3KA 3VRPA 2Z3PA 4PV6A 4MHZA 3F0AA 2PJAA 3C26A 2DF5A 3QNVA 2PIZA 4KSAA 4ZY2A 4FD7A 1ZL0A 4J0NA 3PLFB 4MCRA 3RZAA 3VATA 1CPXA 1V0CA 4ONWA 4FD6A 4NXYA 5JQ4A 1PCAA 2PJ4A 2FM4A 2GIVA 5K8PA 1Y0RA 1BPNA 2J8RA 4QB9A 5JPHA 2WUUA 1VGYA 4F6AA 1KEEB 3FXTA 2NYQA 3TO9A 8CPAA 2AFXA 2FXFA 3B3CA 1YVOA 4CGMA 2QYVA 3VARA 2XEIA 4KOSA 5G22A 1RXTA 2YNCA 4P10A 3SI2A 4UCMA 5G21A 2G0BA 2JDDA 2GU2A 3D67A 4LQ6A 3SHPA 1GHEA 4E2AA 3U1BA 5A27A 3E0KA 2CIJA 4OADA 1WJTA 2BO9A 4JJXA 1M4LA 2AFUA 4GM5A 5IX3A 4COGA 4WJBA 3ZJ0A 4PSXA 2DPSA 2XEFA 4CRYB 1NMTA 1Q7LA 4NF1A 4ZGYB 1CG2A 1YGHA 2FVGA 2V8GA 3GKRA 2FSRA 2HQYA 4Y49C 3NFZA 2FS5A 1NXJA 1IICA 1ZYMA 3PB9X 2YNDA 4OP4A 3WC5A 3BHXA 3KGQA 4KLVA 4CYPA 4MCPA 3BXMA 1LCPA 3PGPA 1JDBC 4KOUA 1ARMA 1LAMA 1S5KA 1YW6A 3PZJA 4X5KA 1ELLP 3PBEA 2Z11A 3IO1A 2F5IA 1QMUA 3KHZA 1Z2LA 4KOYA 2Z3OA 4UFXA 3TC8A 4P4EA 2RFHA 2X0SA 2AFSA 2CNTA 2C27A 1DE4C 3SI0A 2ZW5A 3TLAA 4H6UA 3V8IA 3SXNA 2VEZA 2EK8A 2VZYA 3TLCA 4YU9A 2EZAA 3EY5A 2PJ7A 4JXQA 3PT1A 4MJ8A 2AFZA 4KUAA 5HXDA 3QB8A 4F9UA 1P0HA 2PJ2A 3DR8A 3IC1A 2AJ6A 4B14A 5A28A 2GLJA 4MFKA 1FBVA 2ZEDA 1ZG7A 3EIFA 4P4IA 2P6GA 4ONUA 3IU2A 4C2YA 3FB3A 4CGOA 3V7ZA 3SJGA 4P4JA 4P4BA 3OP0A 2EUIA 1PU9A 2PJ0A 4A31A 2GP4A 5F1YA 3PP9A 4HNWB 2KCWA 4RR2B 5KTCA 1CS0B 1I1DA 2PC1A 4C7HA 4QC6A 3O8ZA 1HEEA 1XF8A 2Z3MA 4UCNA 4E8OA 5J8FA 1Y7RA 1LFWA 4IF5A 3CXPA 2ZOFA 5CNPA 2PVWA 3WABA 3B35A 1S3ZA 5K8MA 5K8OA 5EMIA 1GGOA 4KUBA 2ZXVA 4EMEA 1YREA 5IV0A 3LMSA 4OKOA 2AUNA 4PXCA 4UEEA 3KRVA 5F5XA 2R1IA 2C5QA 1IIDA 3FBUA 4TNUA 4CGNA 4KORA 2EZCA 4A38A 4MFQA 1C3OB 1S60A 5J3XA 2ZW4A 4XPLA 3GUXA 4L89A 4NFRA 1KUVA 3T0TA 3NE8A 3VWDA 4HNXB 1J4JA 1X12A 2IL4A 4RUHA 2V8HA 3F5BA 1KUYA 2PQ8A 4CAEA 3ISZA 3BUNB 2XEJA 3D7FA 2FIWA 2IQ6A 2O4HA 1CM0A 4R3LA 3LODA 3NH4A 4O23A 2B58A 4TJXA 2J8MA 3A9LA 2PJ6A 2PJ3A 4BPUB 4HKFA 1YVKA 2WYRA 4UIBA 4OC3A 1I12A 4PPZA 1YX0A 2EVNA 3TO7A 4YRHA 4OC4A 4IAVA 3OB1B 2PRBA 1FT7A 2PCUA 1CP7A 2Q51A 2PR1A 1Z8WA 5H86A 2YJVA 4P4DA 1RTQA 3IJ3A 3F8KA 1MK4A 2D0OA 3HUVA 5AG4A 2B5GB 3S6KA 5F48A 4E94A 4KS9A 4C9VA 3IU1A 3OB2B 4M6HA 3VGOA 4C8PA 4JD6A 2ODFA 2R8VA 3KQXA 2PJBA 4MI4A 4AG7A 4M85A 4UCPA 3V38A 5IR2A 2PJ9A 1Y9ZA 4UFWA 2JDCA 2PJ5A 1EZBA 3LWUA 4Q38A 1MJBA 2UV8G 2Q4VA 2WPXA 3K4IA 5AG5A 1UFHA 2WZNA 4MHPA 5FVJA 4A30A 3IWGA 4PQAA 3VTAA 3TFYA 1NSAA 4KVOE 4XPDC 4DJLA 2DIKA 4NCZA 1ZG9A 5JGFA 4Q36A 2ZOGA 2XPLA 2CNMA 1XMBA 3FH4A 2V77A 4U5YA 1AUGA 3B8GA 4C2XA 3BJ8A 1Z9EA 1LANA 2REEA 3NOJA 3BUWB 3PB6X 2Q44A 2PE3A 3KR4A 1AYEA 1OZPA 2HB6A 3KZWA 3N5FA 4PK3A 4CAXA 2O28A 4F8ZA 4M8DA 3S6HA 4UBRA 3VWEA 2PJ1A 1VIXA 4C85A 1IGBA 3KKWA 2AFMA 3L2NA 3DR6A 3I1UA 5F13A 1WVMA 1RO5A 1OBRA 4OIWA 4A39A 4MHYA 2OZUA 4AVCA 2D4OA 1TF8A 3DSBA 3TLEA 4ZX8A 1AMPA 4FD5A 3FECA 4F9VA 4U9YA 4YGOA 4Y49B 3RAMA 3S6FA 1XBUA 5KTDA 2FT0A 2XPOA 2EWBA 2RC4A 4H2KA 2QMLA 5DWNA 3FIXA 4X3RA 1NSLA 2R82A 1QSOA 4BPXB 4MJXA 5FD8A 1XJOA 1JDEA 3K9TA 3TOAA 2NMTA 3UY5A 4ORFA 2HI6A 4AB7A 2RB7A 3I74A 5JYBA 4FBEA 4CO9A 1TKHA 4B5PA 3H8FA 1NBWA 4INJA 1F2PA 1IU8A 3FRMA 4OC0A 1ON0A 4NGSA 4BTFA 2O53A 1VKCA 4MMOA 4P6YA 4TWEA 4CAVA 2OB0A 4C7IA 1YW4A 2AFOA 5AXIA 5F09A 1HDQA 1F2OA 2F8HA 2DLAA 2ZPAA 4KOXA 3D2PA 5LYIA 4B5PB 2HROA 1JQGA 1L0CA 2H5MA 3W91A 4C86A 4HPSA 3VRRA 5ISVA 4MRIA 2ATRA 3T9YA 2GE3A 1LRZA 1B47A 2BOAA 2Q7SA 4A95A 2G3TA 4UIAA 4MI1A 2PVVA 1CPSA 5C82A 4C9UA 4CPAA 4H1HA 1T36B 1Q2CA 2G3AA 1EZAA 1M6VB 4C8AA 2PJ8A 2VXKA 4OLLA 2ZEEA 4C9EA 4WWVA 3D66A 4C8FA 5LRGA 2AFWA 1YLOA 3H5ZA 4XNHC 4L8AA 4MFPA 4COBA 5CBMA 3KI9A 4KVXA 5IB9A 4C99A 5HKZA 1IB1E 4KZTA 4UWJA 1VHSA 4BD9A 1V6CA 3BUXB 5C88A 3D68A 3GY9A 5LYFA 1R43A 4CYOA 1XF1A 3EXNA 4K30A 4X2TA 1ZG8A 2CTBA 4AXVA 4QBJA 4ZYQA 2ZEHA 1CX8A 4RS2A 3GB0A 4EFDA 1QSTA 5THWA 3VRNA 4M6GA 1YLEA 4A32A 2F7VA 3CXQA 2AUMA 3GLJA 1WK4A 1Z4RA 2PJCA 3B7IA 4LX9A 2XPNA 1X10A 2WPWA 3GYAA 4I49A 4XPKA 2OR4A 3TLGA 4NGQA 1H8LA 3SJXA 1YQEA 2E28A 1N71A 3WC7A 3H4QA 4OC2A 3IWWA 3TLGB 3S9NA 4UA3A 2ZENA 2VL1A 5CPAA 4ZY0A 3I3GA 4FAIA 3TO6A 2J8NA 2BUEA 1CJWA 2I00A 3PB7X 4A4CA 4FD4A 2R7HA 2C6CA 3B3WA 2VZZA 3R9GA 1M44A 1LOKA 3U88C 4M6IA 2OH1A 4BBHA 1KBLA 3D2MA 2B0AA 1FY7A 3MN8A 3R9EA 2OLSA 2BSWA 2B4BA 3P2HA 2REFA 4X8IA 3B3SA 1IOIA 3LACA 3G8WA 3TE4A 4R8FA 1R57A 1B6BA 2Y0MA 3FNCA 3OWCA 4CYNA 1CBXA 4BPWB 3K9UA 4CZ1A 1YVHA 5LYDA 2OOTA 4MFZA 3BI0A 1R3NA 3TYXA 1TF9A 4UWIA 3BUMB 2GLFA 4CYQA 1KC7A 4OAEA 5DWMA 5F49A 3JTKA 4AVBA 5K99A 4XPDB 1KWMA 2VBQA 3ZNIA 3MRUA 2X7BA 3TLYA 3VH9A 1DIKA 4CGPA 3KR5A 5IB0A 4YFJA 1P4NA 3TOBA 3G23A 3HPHE 3TCVA 3NE7A 1I21A 4LUAA 2I3CA 2QJ8A 2HC9A 4NGTA 2FL4A 4BINA 3RNZA 2Z3NA 2ZW6A 1EO0A 4EVYA 2P6FA 3EO4A 4NGMA 1M4DA 3S9LA 3G3SA 3D7DA 2CF4A 1A9XB 1BO4A 3SJEA 2BCOA 3PFVA 2B3UA 2J9AA 3T8WA 4MHDA 4NJRA 3WC6A 3WR7A 4A4BA 3CXSA 4NEXA 5DS0A 1XRYA 2HWGA 2BEIA 3KQZA 3FJUA 2B4JC 1EE3P 1KUXA 3R95A 4RI1A 2DXQA 1BAVA 3I9SA 2ABZA 5JVLA 5K8NA 3SI1A 4MBUA 3D7GA 4UEFA 1VBGA 2V8VA 1VBHA 4DYOA 2ZEPA 2Q4YA 3BUOB 3WT4A 3KL9A 4F0YA 2ZEGA 4QVTA 3VROA 1J3LA 1VHOA 2QIRA 2ARHA 2EZBA 4KLWA 5F46A 2A4NA 3PB8X 1MJAA 1TKJA 4CGLA 4C8CA 2IMOA 3R96A 2JLMA 4JVOA 3T05A 3C8OA 4P44A 4UFVA 1M4IA 1Y9WA 5JM6A 1Q5XA 1YSJA 1TKFA 1ZO0A 2P6EA 3IIBA 4AVAA 4CRZB 4K3NA 5HVFA 2WSAA 5ELYA 1ELMP 4GXHA 4JXRA 4IK2A 3R9FA 3DGVA 2Q7BA 2YNEA 3K2KA 5J8CA 4B6ZA 1Q2YA 2VI7A 4OIDA 3W6SA 3D7HA 3ISXA 2PSWA 3SXOA 2GANA 2K5TA 1TIQA 2QVPA 3JVNA 3TT2A 3D3SA 4ZY1A 3MGDA 1XIXA 3BLNA 4B10A 2B4DA 2P0WA 2B3VA 3FMCA 1XEBA 2VQYA 1M1DA 4E0AA 4P45A 3IWEA 2CTCA 3T07A 1QSNA 3PFOA 2B4DB 2Q4ZA 4LQGA 4XNHB 4KSFA 4B11A 5JH9A 1MJ9A 1Y7EA 3TX8A 2XPPA 4PXEA 5G20A 3BJ7A 3EZAA 3DLJA 2YGWA 4EYSA 4U9ZA 4MCQA 4CS0B 2PDOA 1Y0YA 1XE4A 2C6GA 3RBUA 2CNSA 3PEIA 2XEGA 3PFEA 1DTDA 1Y9KA 4C9RA 5H84A 2AE6A 4OC5A 4C8UA 3W6XA 2ZW7A 2BL1A 4NGPA 5BWAB 1ZRSA 4PSWA 3PRTA 5D29A 2I79A 3FEDA 3B3VA 3PBBA 3QAYA 2YJTA 2JBJA 3OAKA 1YK3A 1R61A 3TLZA 1NE9A 4G1PA 3IFEA 2Y1NA 2D4PA 3PB4X 4KOVA 4MHNA 1UWYA 4C84A 3NA6A 3D4UA 3SJFA 3RYOA 1QSMA 4FUUA 4JYWA 4R87A 2R98A 1LAPA 4ZI6A 3EZEA 3D8PA 1S7FA 2DPTA 2YNCC 4JZ0A 3FYNA 1ARLA 5EBVA 4JLYA 1TXRA 5HVHA 4B12A 2D0PA 4KOWA 4NJQA 2CY2A 4IIXA 4NGNA 3EC4A 4B5OA 2CXAA 4UF4A 3TTHA 3TLBA 4R7MA 4MXUA 3LD2A 4EWTA 1YR0A 1S7NA 3DDDA 4PK2A 4R6TA 3F9KC 3KASA 5AG6A 7CPAA 2VKZG 2C1CA 4A37A 2HUZA 3HPGG 1BOBA 2HV2A 4R3KA 4KVME 5D8NA 4TJVA 1BLLE 3FVLA 2Z3LA 1M4GA 5I0CA 2G9DA 2C6PA 3FEEA 3CZXA 3S9MA 1CP6A 5F9MA 2FIAA 2OZGA 1A2ZA 1IYKA 5HKYA 4IUSA 4BMHA 4MFLA 4M3SA 1ZLHA 1KZFA 4DUKA 5HMNA 4E5SA 4IHMA 1IYLA 1Z8LA 1FNOA 2Q0YA 3B2YA 2V8DA 4RN7A 4W9YA 1QQ9A 2Q43A 3KHXA 3NH8A 4DNCA 3QAHA 4ZX9A 1PUAA 4ZBGA 1BXRB 1VHEA 2N3AB 4P4FA 4GPLB 2OZHA 5J1QA 5LRJA 3DNSA 4R57A 2GREA 2OU2A 4KNGE 3VRQA 4A2ZA 2GFQA 1VI4A 1XFOA 3CPAA 2PIYA 2PR8A 3ZZIA 4QUSA 3N7ZA 4II9A 1QSRA 3JUWA 2JEWA 4H89A 4GS4A 5AGEA 2IJZA 3FX6A 1JWQA 1F57A 1SQHA 2ZEOA 2PRQA 1CE8B 2CBLA 3R1KA 4MFJA 3CDXA 1Z9UA 3EFAA 2MP0A 5G1ZA 1IOFA 4AG9A 4NGRA 2JBKA 5BY0A 5LYLA 2PCNA 1K4JA 4CDKA 1Z8TA 3HMJG 3H8GA 2Z10A 1HDUA 2FCKA 4NSQA 4Q7AA 4UEZA 4F0XA 2POKA 2Z0ZA 1PYTB 4A94A 6CPAA 2ZELA 4YN3A 1Q2DA 3FF3A 4CAFA 3H8EA 3GIUA 1ZLIA 1B87A 1S7KA 4JWPA 5HVGA 2B5GA 2Q04A 3NH5A 3EZBA 4C8TA 2QECA 3IGRA 1WWZA 4A33A 4MY3A 4CAWA 5HH1A 5LRKA 5KTAA 3RO0A 4B13A 3I6SA 3HLPA 1Z4EA 4J3GA 1XMTA 1Z5RA 5AG7A 5E96A 4Z65A 3GJZA 4IIYA 3CT9A 2ZEMA 3T90A 3NFQA 4KOTA 4KSIA 2ANPA 4MY0A 4YWYA 2EBJA 2FE7A 5GCNA 1GYTA 1S7LA 1U6MA 2ZEFA 3CPXA 3SR3A 1Z8XA 3BI1A 1XOVA 4R76A 3JRUA 2EK9A 4HNYB 3ICUA 5F47A 4C2ZA 4C9AA 3B3TA 3P2FA 4CDJA 4H6ZA 1BPMA 1YMEA 4R9MA 2Y1MA 2JEVA 4OC1A 5EC4A 4C68A 4MCSA 5I4MA 3T5MA 4OMEA 3IEHA 4PXBA 1C30B 4PXDA 1IY7A 3S6GA 2NSMA 5HKWA 2DEAA 2EO8A 4FWUA
chains in the Genus database with same CATH topology
4MHZA 4ZY2A 2PJAA 3QNVA 2PIZA 4MCRA 3RZAA 3VATA 1CPXA 4ONWA 1PCAA 2PJ4A 5K8PA 1Y0RA 1BPNA 1VGYA 2NYQA 8CPAA 2AFXA 3B3CA 2QYVA 3VARA 2XEIA 4P10A 3SI2A 2GU2A 3D67A 2CIJA 2BO9A 1M4LA 2AFUA 4GM5A 4WJBA 2XEFA 1Q7LA 1CG2A 2FVGA 2V8GA 3NFZA 3PB9X 4OP4A 3WC5A 3BHXA 3KGQA 4MCPA 3BXMA 1LCPA 1ARMA 1LAMA 1YW6A 1ELLP 3PBEA 3IO1A 1QMUA 3KHZA 1Z2LA 3TC8A 4P4EA 2RFHA 2AFSA 1DE4C 3SI0A 2EK8A 4YU9A 2PJ7A 2AFZA 5HXDA 4F9UA 3IC1A 2PJ2A 2GLJA 2ZEDA 1ZG7A 3EIFA 4P4IA 3V7ZA 3SJGA 4P4JA 4P4BA 2PJ0A 2GP4A 1HEEA 1LFWA 2ZOFA 2PVWA 3WABA 3B35A 5K8MA 5K8OA 4EMEA 3LMSA 4OKOA 4PXCA 4UEEA 2C5QA 4TNUA 4A38A 3GUXA 4NFRA 4RUHA 2V8HA 3ISZA 2XEJA 3D7FA 2IQ6A 2O4HA 3NH4A 4O23A 4TJXA 2PJ6A 2PJ3A 2WYRA 4UIBA 4OC3A 4PPZA 4OC4A 4IAVA 2PCUA 1FT7A 1CP7A 2Q51A 4P4DA 1RTQA 3IJ3A 3HUVA 4C9VA 4C8PA 3KQXA 2PJBA 5IR2A 3V38A 2PJ9A 1Y9ZA 2PJ5A 3LWUA 2WZNA 4MHPA 3VTAA 4PQAA 1NSAA 4DJLA 5JGFA 1ZG9A 2ZOGA 1XMBA 3FH4A 2V77A 1LANA 3PB6X 2PE3A 3KR4A 1AYEA 2HB6A 3KZWA 3N5FA 4F8ZA 2PJ1A 1VIXA 4C85A 1IGBA 2AFMA 3L2NA 3I1UA 1WVMA 1OBRA 4OIWA 4A39A 4MHYA 1TF8A 4ZX8A 1AMPA 4F9VA 3FECA 3RAMA 1XBUA 4H2KA 2EWBA 4X3RA 1XJOA 3K9TA 2RB7A 3I74A 4FBEA 1TKHA 3H8FA 1F2PA 4TWEA 4OC0A 2O53A 4NGSA 4MMOA 4P6YA 1YW4A 2AFOA 5F09A 1HDQA 1F2OA 2F8HA 5LYIA 1JQGA 4C86A 4MRIA 2BOAA 4UIAA 2PVVA 1CPSA 4C9UA 4CPAA 4C8AA 2PJ8A 2ZEEA 4C9EA 4WWVA 3D66A 4C8FA 5LRGA 2AFWA 1YLOA 5CBMA 3KI9A 5IB9A 4C99A 4BD9A 1V6CA 1XF1A 3D68A 5LYFA 1R43A 4X2TA 1ZG8A 2CTBA 4AXVA 4ZYQA 2ZEHA 1CX8A 3GB0A 4EFDA 5THWA 2F7VA 3GLJA 2PJCA 3B7IA 2OR4A 4NGQA 1H8LA 3SJXA 3WC7A 4OC2A 3IWWA 3S9NA 2ZENA 2VL1A 5CPAA 4ZY0A 4FAIA 3PB7X 3B3WA 2C6CA 3WT4A 1LOKA 3MN8A 4X8IA 3B3SA 4R8FA 1CBXA 5LYDA 2OOTA 3BI0A 1R3NA 1TF9A 2GLFA 1KWMA 3MRUA 3VH9A 3KR5A 2I3CA 2QJ8A 2HC9A 4NGTA 4NGMA 3S9LA 3D7DA 2CF4A 3SJEA 2BCOA 3WC6A 3T8WA 2J9AA 4NJRA 5DS0A 1XRYA 3KQZA 3FJUA 1EE3P 1BAVA 2ABZA 5K8NA 3SI1A 3D7GA 4UEFA 2V8VA 4DYOA 2ZEPA 3KL9A 2ZEGA 1VHOA 3PB8X 1TKJA 4C8CA 2IMOA 4P44A 5JM6A 1YSJA 1TKFA 3IIBA 4K3NA 5HVFA 5ELYA 1ELMP 4IK2A 3DGVA 3K2KA 4B6ZA 4OIDA 3D7HA 3ISXA 2QVPA 4ZY1A 3FMCA 4P45A 2CTCA 3PFOA 2Q4ZA 4LQGA 5JH9A 1Y7EA 3TX8A 4PXEA 3DLJA 4MCQA 1Y0YA 2C6GA 3RBUA 3PEIA 2XEGA 3PFEA 1DTDA 4C9RA 4OC5A 4C8UA 4NGPA 3PRTA 5D29A 3FEDA 3B3VA 3PBBA 2JBJA 4G1PA 3IFEA 3PB4X 4MHNA 1UWYA 4C84A 3NA6A 3D4UA 3SJFA 4FUUA 4JYWA 1LAPA 4ZI6A 4JZ0A 1ARLA 1TXRA 5HVHA 4NJQA 4NGNA 4UF4A 4R7MA 4MXUA 4EWTA 4R6TA 3KASA 7CPAA 4A37A 2C1CA 4TJVA 5D8NA 1BLLE 3FVLA 2G9DA 2C6PA 3FEEA 3S9MA 1CP6A 1ZLHA 4DUKA 4IHMA 1Z8LA 1FNOA 3B2YA 2V8DA 4W9YA 1QQ9A 2Q43A 3KHXA 3NH8A 4ZX9A 1VHEA 4P4FA 5J1QA 5LRJA 2GREA 4KNGE 1XFOA 3CPAA 2PIYA 2JEWA 2IJZA 3FX6A 1F57A 2ZEOA 2PRQA 3CDXA 5LYLA 4NGRA 2JBKA 4CDKA 3H8GA 4Q7AA 1HDUA 4UEZA 2POKA 4A94A 1PYTB 6CPAA 2ZELA 4YN3A 3FF3A 3H8EA 1ZLIA 4C8TA 5HVGA 3NH5A 5LRKA 3I6SA 3HLPA 1Z5RA 4Z65A 3CT9A 2ZEMA 4KSIA 2ANPA 4YWYA 1GYTA 2ZEFA 3CPXA 3BI1A 4R76A 3JRUA 2EK9A 3ICUA 4CDJA 4C9AA 3B3TA 1BPMA 1YMEA 4OC1A 4MCSA 5I4MA 4OMEA 3IEHA 4PXBA 4PXDA 1IY7A 2NSMA 2DEAA 4FWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHZ A;  4ZY2 A;  2PJA A;  3QNV A;  2PIZ A;  4MCR A;  3RZA A;  3VAT A;  1CPX A;  4ONW A;  1PCA A;  2PJ4 A;  5K8P A;  1Y0R A;  1BPN A;  1VGY A;  2NYQ A;  8CPA A;  2AFX A;  3B3C A;  2QYV A;  3VAR A;  2XEI A;  4P10 A;  3SI2 A;  2GU2 A;  3D67 A;  2CIJ A;  2BO9 A;  1M4L A;  2AFU A;  4GM5 A;  4WJB A;  2XEF A;  1Q7L A;  1CG2 A;  2FVG A;  2V8G A;  3NFZ A;  3PB9 X;  4OP4 A;  3WC5 A;  3BHX A;  3KGQ A;  4MCP A;  3BXM A;  1LCP A;  1ARM A;  1LAM A;  1YW6 A;  1ELL P;  3PBE A;  3IO1 A;  1QMU A;  3KHZ A;  1Z2L A;  3TC8 A;  4P4E A;  2RFH A;  2AFS A;  1DE4 C;  3SI0 A;  2EK8 A;  4YU9 A;  2PJ7 A;  2AFZ A;  5HXD A;  4F9U A;  3IC1 A;  2PJ2 A;  2GLJ A;  2ZED A;  1ZG7 A;  3EIF A;  4P4I A;  3V7Z A;  3SJG A;  4P4J A;  4P4B A;  2PJ0 A;  1HEE A;  1LFW A;  2ZOF A;  2PVW A;  3WAB A;  3B35 A;  5K8M A;  5K8O A;  4EME A;  3LMS A;  4OKO A;  4PXC A;  4UEE A;  4TNU A;  4A38 A;  3GUX A;  4NFR A;  4RUH A;  2V8H A;  3ISZ A;  2XEJ A;  3D7F A;  2IQ6 A;  2O4H A;  3NH4 A;  4O23 A;  4TJX A;  2PJ6 A;  2PJ3 A;  2WYR A;  4UIB A;  4OC3 A;  4PPZ A;  4OC4 A;  4IAV A;  2PCU A;  1FT7 A;  1CP7 A;  2Q51 A;  4P4D A;  1RTQ A;  3IJ3 A;  3HUV A;  4C9V A;  4C8P A;  3KQX A;  2PJB A;  3V38 A;  2PJ9 A;  1Y9Z A;  2PJ5 A;  3LWU A;  2WZN A;  4MHP A;  3VTA A;  4PQA A;  1NSA A;  4DJL A;  5JGF A;  1ZG9 A;  2ZOG A;  1XMB A;  3FH4 A;  2V77 A;  1LAN A;  3PB6 X;  2PE3 A;  3KR4 A;  1AYE A;  2HB6 A;  3KZW A;  3N5F A;  4F8Z A;  2PJ1 A;  1VIX A;  4C85 A;  1IGB A;  2AFM A;  3L2N A;  3I1U A;  1WVM A;  1OBR A;  4OIW A;  4A39 A;  4MHY A;  1TF8 A;  4ZX8 A;  1AMP A;  4F9V A;  3FEC A;  3RAM A;  1XBU A;  4H2K A;  2EWB A;  4X3R A;  1XJO A;  3K9T A;  2RB7 A;  3I74 A;  4FBE A;  1TKH A;  3H8F A;  1F2P A;  4TWE A;  4OC0 A;  2O53 A;  4NGS A;  4MMO A;  4P6Y A;  1YW4 A;  2AFO A;  5F09 A;  1HDQ A;  1F2O A;  2F8H A;  5LYI A;  1JQG A;  4C86 A;  4MRI A;  2BOA A;  4UIA A;  2PVV A;  1CPS A;  4C9U A;  4CPA A;  4C8A A;  2PJ8 A;  2ZEE A;  4C9E A;  4WWV A;  3D66 A;  4C8F A;  5LRG A;  2AFW A;  1YLO A;  5CBM A;  3KI9 A;  5IB9 A;  4C99 A;  4BD9 A;  1V6C A;  1XF1 A;  3D68 A;  5LYF A;  1R43 A;  4X2T A;  1ZG8 A;  2CTB A;  4AXV A;  4ZYQ A;  2ZEH A;  1CX8 A;  3GB0 A;  4EFD A;  5THW A;  2F7V A;  3GLJ A;  2PJC A;  3B7I A;  2OR4 A;  4NGQ A;  1H8L A;  3SJX A;  3WC7 A;  4OC2 A;  3IWW A;  3S9N A;  2ZEN A;  2VL1 A;  5CPA A;  4ZY0 A;  4FAI A;  3PB7 X;  3B3W A;  2C6C A;  3WT4 A;  1LOK A;  3MN8 A;  4X8I A;  3B3S A;  4R8F A;  1CBX A;  5LYD A;  2OOT A;  3BI0 A;  1R3N A;  1TF9 A;  2GLF A;  1KWM A;  3MRU A;  3VH9 A;  3KR5 A;  2I3C A;  2QJ8 A;  2HC9 A;  4NGT A;  4NGM A;  3S9L A;  3D7D A;  2CF4 A;  3SJE A;  2BCO A;  3WC6 A;  3T8W A;  2J9A A;  4NJR A;  5DS0 A;  1XRY A;  3KQZ A;  3FJU A;  1EE3 P;  1BAV A;  2ABZ A;  5K8N A;  3SI1 A;  3D7G A;  4UEF A;  2V8V A;  4DYO A;  2ZEP A;  3KL9 A;  2ZEG A;  1VHO A;  3PB8 X;  1TKJ A;  4C8C A;  2IMO A;  4P44 A;  5JM6 A;  1YSJ A;  1TKF A;  3IIB A;  4K3N A;  5HVF A;  5ELY A;  1ELM P;  4IK2 A;  3DGV A;  3K2K A;  4B6Z A;  4OID A;  3D7H A;  3ISX A;  2QVP A;  4ZY1 A;  3FMC A;  4P45 A;  2CTC A;  3PFO A;  2Q4Z A;  4LQG A;  5JH9 A;  1Y7E A;  3TX8 A;  4PXE A;  3DLJ A;  4MCQ A;  1Y0Y A;  2C6G A;  3RBU A;  3PEI A;  2XEG A;  3PFE A;  1DTD A;  4C9R A;  4OC5 A;  4C8U A;  4NGP A;  3PRT A;  5D29 A;  3FED A;  3B3V A;  3PBB A;  2JBJ A;  4G1P A;  3IFE A;  3PB4 X;  4MHN A;  1UWY A;  4C84 A;  3NA6 A;  3D4U A;  3SJF A;  4FUU A;  4JYW A;  1LAP A;  4ZI6 A;  4JZ0 A;  1ARL A;  1TXR A;  5HVH A;  4NJQ A;  4NGN A;  4UF4 A;  4R7M A;  4MXU A;  4EWT A;  4R6T A;  3KAS A;  7CPA A;  4A37 A;  2C1C A;  4TJV A;  5D8N A;  1BLL E;  3FVL A;  2G9D A;  2C6P A;  3FEE A;  3S9M A;  1CP6 A;  1ZLH A;  4DUK A;  4IHM A;  1Z8L A;  1FNO A;  3B2Y A;  2V8D A;  4W9Y A;  1QQ9 A;  2Q43 A;  3KHX A;  3NH8 A;  4ZX9 A;  1VHE A;  4P4F A;  5J1Q A;  5LRJ A;  2GRE A;  4KNG E;  1XFO A;  3CPA A;  2PIY A;  2JEW A;  2IJZ A;  3FX6 A;  1F57 A;  2ZEO A;  2PRQ A;  3CDX A;  5LYL A;  4NGR A;  2JBK A;  4CDK A;  3H8G A;  4Q7A A;  1HDU A;  4UEZ A;  2POK A;  4A94 A;  1PYT B;  6CPA A;  2ZEL A;  4YN3 A;  3FF3 A;  3H8E A;  1ZLI A;  4C8T A;  5HVG A;  3NH5 A;  5LRK A;  3I6S A;  3HLP A;  1Z5R A;  4Z65 A;  3CT9 A;  2ZEM A;  4KSI A;  2ANP A;  4YWY A;  1GYT A;  2ZEF A;  3CPX A;  3BI1 A;  4R76 A;  3JRU A;  2EK9 A;  3ICU A;  4CDJ A;  4C9A A;  3B3T A;  1BPM A;  1YME A;  4OC1 A;  4MCS A;  5I4M A;  4OME A;  3IEH A;  4PXB A;  4PXD A;  1IY7 A;  2NSM A;  2DEA A;  4FWU A; 
#chains in the Genus database with same CATH topology
 2Z3K A;  3VRP A;  2Z3P A;  4PV6 A;  4MHZ A;  3F0A A;  2PJA A;  3C26 A;  2DF5 A;  3QNV A;  2PIZ A;  4KSA A;  4ZY2 A;  4FD7 A;  1ZL0 A;  4J0N A;  3PLF B;  4MCR A;  3RZA A;  3VAT A;  1CPX A;  1V0C A;  4ONW A;  4FD6 A;  4NXY A;  5JQ4 A;  1PCA A;  2PJ4 A;  2FM4 A;  2GIV A;  5K8P A;  1Y0R A;  1BPN A;  2J8R A;  4QB9 A;  5JPH A;  2WUU A;  1VGY A;  4F6A A;  1KEE B;  3FXT A;  2NYQ A;  3TO9 A;  8CPA A;  2AFX A;  2FXF A;  3B3C A;  1YVO A;  4CGM A;  2QYV A;  3VAR A;  2XEI A;  4KOS A;  5G22 A;  1RXT A;  2YNC A;  4P10 A;  3SI2 A;  4UCM A;  5G21 A;  2G0B A;  2JDD A;  2GU2 A;  3D67 A;  4LQ6 A;  3SHP A;  1GHE A;  4E2A A;  3U1B A;  5A27 A;  3E0K A;  2CIJ A;  4OAD A;  1WJT A;  2BO9 A;  4JJX A;  1M4L A;  2AFU A;  4GM5 A;  5IX3 A;  4COG A;  4WJB A;  3ZJ0 A;  4PSX A;  2DPS A;  2XEF A;  4CRY B;  1NMT A;  1Q7L A;  4NF1 A;  4ZGY B;  1CG2 A;  1YGH A;  2FVG A;  2V8G A;  3GKR A;  2FSR A;  2HQY A;  4Y49 C;  3NFZ A;  2FS5 A;  1NXJ A;  1IIC A;  1ZYM A;  3PB9 X;  2YND A;  4OP4 A;  3WC5 A;  3BHX A;  3KGQ A;  4KLV A;  4CYP A;  4MCP A;  3BXM A;  1LCP A;  3PGP A;  1JDB C;  4KOU A;  1ARM A;  1LAM A;  1S5K A;  1YW6 A;  3PZJ A;  4X5K A;  1ELL P;  3PBE A;  2Z11 A;  3IO1 A;  2F5I A;  1QMU A;  3KHZ A;  1Z2L A;  4KOY A;  2Z3O A;  4UFX A;  3TC8 A;  4P4E A;  2RFH A;  2X0S A;  2AFS A;  2CNT A;  2C27 A;  1DE4 C;  3SI0 A;  2ZW5 A;  3TLA A;  4H6U A;  3V8I A;  3SXN A;  2VEZ A;  2EK8 A;  2VZY A;  3TLC A;  4YU9 A;  2EZA A;  3EY5 A;  2PJ7 A;  4JXQ A;  3PT1 A;  4MJ8 A;  2AFZ A;  4KUA A;  5HXD A;  3QB8 A;  4F9U A;  1P0H A;  2PJ2 A;  3DR8 A;  3IC1 A;  2AJ6 A;  4B14 A;  5A28 A;  2GLJ A;  4MFK A;  1FBV A;  2ZED A;  1ZG7 A;  3EIF A;  4P4I A;  2P6G A;  4ONU A;  3IU2 A;  4C2Y A;  3FB3 A;  4CGO A;  3V7Z A;  3SJG A;  4P4J A;  4P4B A;  3OP0 A;  2EUI A;  1PU9 A;  2PJ0 A;  4A31 A;  2GP4 A;  5F1Y A;  3PP9 A;  4HNW B;  2KCW A;  4RR2 B;  5KTC A;  1CS0 B;  1I1D A;  2PC1 A;  4C7H A;  4QC6 A;  3O8Z A;  1HEE A;  1XF8 A;  2Z3M A;  4UCN A;  4E8O A;  5J8F A;  1Y7R A;  1LFW A;  4IF5 A;  3CXP A;  2ZOF A;  5CNP A;  2PVW A;  3WAB A;  3B35 A;  1S3Z A;  5K8M A;  5K8O A;  5EMI A;  1GGO A;  4KUB A;  2ZXV A;  4EME A;  1YRE A;  5IV0 A;  3LMS A;  4OKO A;  2AUN A;  4PXC A;  4UEE A;  3KRV A;  5F5X A;  2R1I A;  2C5Q A;  1IID A;  3FBU A;  4TNU A;  4CGN A;  4KOR A;  2EZC A;  4A38 A;  4MFQ A;  1C3O B;  1S60 A;  5J3X A;  2ZW4 A;  4XPL A;  3GUX A;  4L89 A;  4NFR A;  1KUV A;  3T0T A;  3NE8 A;  3VWD A;  4HNX B;  1J4J A;  1X12 A;  2IL4 A;  4RUH A;  2V8H A;  3F5B A;  1KUY A;  2PQ8 A;  4CAE A;  3ISZ A;  3BUN B;  2XEJ A;  3D7F A;  2FIW A;  2IQ6 A;  2O4H A;  1CM0 A;  4R3L A;  3LOD A;  3NH4 A;  4O23 A;  2B58 A;  4TJX A;  2J8M A;  3A9L A;  2PJ6 A;  2PJ3 A;  4BPU B;  4HKF A;  1YVK A;  2WYR A;  4UIB A;  4OC3 A;  1I12 A;  4PPZ A;  1YX0 A;  2EVN A;  3TO7 A;  4YRH A;  4OC4 A;  4IAV A;  3OB1 B;  2PRB A;  1FT7 A;  2PCU A;  1CP7 A;  2Q51 A;  2PR1 A;  1Z8W A;  5H86 A;  2YJV A;  4P4D A;  1RTQ A;  3IJ3 A;  3F8K A;  1MK4 A;  2D0O A;  3HUV A;  5AG4 A;  2B5G B;  3S6K A;  5F48 A;  4E94 A;  4KS9 A;  4C9V A;  3IU1 A;  3OB2 B;  4M6H A;  3VGO A;  4C8P A;  4JD6 A;  2ODF A;  2R8V A;  3KQX A;  2PJB A;  4MI4 A;  4AG7 A;  4M85 A;  4UCP A;  3V38 A;  5IR2 A;  2PJ9 A;  1Y9Z A;  4UFW A;  2JDC A;  2PJ5 A;  1EZB A;  3LWU A;  4Q38 A;  1MJB A;  2UV8 G;  2Q4V A;  2WPX A;  3K4I A;  5AG5 A;  1UFH A;  2WZN A;  4MHP A;  5FVJ A;  4A30 A;  3IWG A;  4PQA A;  3VTA A;  3TFY A;  1NSA A;  4KVO E;  4XPD C;  4DJL A;  2DIK A;  4NCZ A;  1ZG9 A;  5JGF A;  4Q36 A;  2ZOG A;  2XPL A;  2CNM A;  1XMB A;  3FH4 A;  2V77 A;  4U5Y A;  1AUG A;  3B8G A;  4C2X A;  3BJ8 A;  1Z9E A;  1LAN A;  2REE A;  3NOJ A;  3BUW B;  3PB6 X;  2Q44 A;  2PE3 A;  3KR4 A;  1AYE A;  1OZP A;  2HB6 A;  3KZW A;  3N5F A;  4PK3 A;  4CAX A;  2O28 A;  4F8Z A;  4M8D A;  3S6H A;  4UBR A;  3VWE A;  2PJ1 A;  1VIX A;  4C85 A;  1IGB A;  3KKW A;  2AFM A;  3L2N A;  3DR6 A;  3I1U A;  5F13 A;  1WVM A;  1RO5 A;  1OBR A;  4OIW A;  4A39 A;  4MHY A;  2OZU A;  4AVC A;  2D4O A;  1TF8 A;  3DSB A;  3TLE A;  4ZX8 A;  1AMP A;  4FD5 A;  3FEC A;  4F9V A;  4U9Y A;  4YGO A;  4Y49 B;  3RAM A;  3S6F A;  1XBU A;  5KTD A;  2FT0 A;  2XPO A;  2EWB A;  2RC4 A;  4H2K A;  2QML A;  5DWN A;  3FIX A;  4X3R A;  1NSL A;  2R82 A;  1QSO A;  4BPX B;  4MJX A;  5FD8 A;  1XJO A;  1JDE A;  3K9T A;  3TOA A;  2NMT A;  3UY5 A;  4ORF A;  2HI6 A;  4AB7 A;  2RB7 A;  3I74 A;  5JYB A;  4FBE A;  4CO9 A;  1TKH A;  4B5P A;  3H8F A;  1NBW A;  4INJ A;  1F2P A;  1IU8 A;  3FRM A;  4OC0 A;  1ON0 A;  4NGS A;  4BTF A;  2O53 A;  1VKC A;  4MMO A;  4P6Y A;  4TWE A;  4CAV A;  2OB0 A;  4C7I A;  1YW4 A;  2AFO A;  5AXI A;  5F09 A;  1HDQ A;  1F2O A;  2F8H A;  2DLA A;  2ZPA A;  4KOX A;  3D2P A;  5LYI A;  4B5P B;  2HRO A;  1JQG A;  1L0C A;  2H5M A;  3W91 A;  4C86 A;  4HPS A;  3VRR A;  5ISV A;  4MRI A;  2ATR A;  3T9Y A;  2GE3 A;  1LRZ A;  1B47 A;  2BOA A;  2Q7S A;  4A95 A;  2G3T A;  4UIA A;  4MI1 A;  2PVV A;  1CPS A;  5C82 A;  4C9U A;  4CPA A;  4H1H A;  1T36 B;  1Q2C A;  2G3A A;  1EZA A;  1M6V B;  4C8A A;  2PJ8 A;  2VXK A;  4OLL A;  2ZEE A;  4C9E A;  4WWV A;  3D66 A;  4C8F A;  5LRG A;  2AFW A;  1YLO A;  3H5Z A;  4XNH C;  4L8A A;  4MFP A;  4COB A;  5CBM A;  3KI9 A;  4KVX A;  5IB9 A;  4C99 A;  5HKZ A;  1IB1 E;  4KZT A;  4UWJ A;  1VHS A;  4BD9 A;  1V6C A;  3BUX B;  5C88 A;  3D68 A;  3GY9 A;  5LYF A;  1R43 A;  4CYO A;  1XF1 A;  3EXN A;  4K30 A;  4X2T A;  1ZG8 A;  2CTB A;  4AXV A;  4QBJ A;  4ZYQ A;  2ZEH A;  1CX8 A;  4RS2 A;  3GB0 A;  4EFD A;  1QST A;  5THW A;  3VRN A;  4M6G A;  1YLE A;  4A32 A;  2F7V A;  3CXQ A;  2AUM A;  3GLJ A;  1WK4 A;  1Z4R A;  2PJC A;  3B7I A;  4LX9 A;  2XPN A;  1X10 A;  2WPW A;  3GYA A;  4I49 A;  4XPK A;  2OR4 A;  3TLG A;  4NGQ A;  1H8L A;  3SJX A;  1YQE A;  2E28 A;  1N71 A;  3WC7 A;  3H4Q A;  4OC2 A;  3IWW A;  3TLG B;  3S9N A;  4UA3 A;  2ZEN A;  2VL1 A;  5CPA A;  4ZY0 A;  3I3G A;  4FAI A;  3TO6 A;  2J8N A;  2BUE A;  1CJW A;  2I00 A;  3PB7 X;  4A4C A;  4FD4 A;  2R7H A;  2C6C A;  3B3W A;  2VZZ A;  3R9G A;  1M44 A;  1LOK A;  3U88 C;  4M6I A;  2OH1 A;  4BBH A;  1KBL A;  3D2M A;  2B0A A;  1FY7 A;  3MN8 A;  3R9E A;  2OLS A;  2BSW A;  2B4B A;  3P2H A;  2REF A;  4X8I A;  3B3S A;  1IOI A;  3LAC A;  3G8W A;  3TE4 A;  4R8F A;  1R57 A;  1B6B A;  2Y0M A;  3FNC A;  3OWC A;  4CYN A;  1CBX A;  4BPW B;  3K9U A;  4CZ1 A;  1YVH A;  5LYD A;  2OOT A;  4MFZ A;  3BI0 A;  1R3N A;  3TYX A;  1TF9 A;  4UWI A;  3BUM B;  2GLF A;  4CYQ A;  1KC7 A;  4OAE A;  5DWM A;  5F49 A;  3JTK A;  4AVB A;  5K99 A;  4XPD B;  1KWM A;  2VBQ A;  3ZNI A;  3MRU A;  2X7B A;  3TLY A;  3VH9 A;  1DIK A;  4CGP A;  3KR5 A;  5IB0 A;  4YFJ A;  1P4N A;  3TOB A;  3G23 A;  3HPH E;  3TCV A;  3NE7 A;  1I21 A;  4LUA A;  2I3C A;  2QJ8 A;  2HC9 A;  4NGT A;  2FL4 A;  4BIN A;  3RNZ A;  2Z3N A;  2ZW6 A;  1EO0 A;  4EVY A;  2P6F A;  3EO4 A;  4NGM A;  1M4D A;  3S9L A;  3G3S A;  3D7D A;  2CF4 A;  1A9X B;  1BO4 A;  3SJE A;  2BCO A;  3PFV A;  2B3U A;  2J9A A;  3T8W A;  4MHD A;  4NJR A;  3WC6 A;  3WR7 A;  4A4B A;  3CXS A;  4NEX A;  5DS0 A;  1XRY A;  2HWG A;  2BEI A;  3KQZ A;  3FJU A;  2B4J C;  1EE3 P;  1KUX A;  3R95 A;  4RI1 A;  2DXQ A;  1BAV A;  3I9S A;  2ABZ A;  5JVL A;  5K8N A;  3SI1 A;  4MBU A;  3D7G A;  4UEF A;  1VBG A;  2V8V A;  1VBH A;  4DYO A;  2ZEP A;  2Q4Y A;  3BUO B;  3WT4 A;  3KL9 A;  4F0Y A;  2ZEG A;  4QVT A;  3VRO A;  1J3L A;  1VHO A;  2QIR A;  2ARH A;  2EZB A;  4KLW A;  5F46 A;  2A4N A;  3PB8 X;  1MJA A;  1TKJ A;  4CGL A;  4C8C A;  2IMO A;  3R96 A;  2JLM A;  4JVO A;  3T05 A;  3C8O A;  4P44 A;  4UFV A;  1M4I A;  1Y9W A;  5JM6 A;  1Q5X A;  1YSJ A;  1TKF A;  1ZO0 A;  2P6E A;  3IIB A;  4AVA A;  4CRZ B;  4K3N A;  5HVF A;  2WSA A;  5ELY A;  1ELM P;  4GXH A;  4JXR A;  4IK2 A;  3R9F A;  3DGV A;  2Q7B A;  2YNE A;  3K2K A;  5J8C A;  4B6Z A;  1Q2Y A;  2VI7 A;  4OID A;  3W6S A;  3D7H A;  3ISX A;  2PSW A;  3SXO A;  2GAN A;  2K5T A;  1TIQ A;  2QVP A;  3JVN A;  3TT2 A;  3D3S A;  4ZY1 A;  3MGD A;  1XIX A;  3BLN A;  4B10 A;  2B4D A;  2P0W A;  2B3V A;  3FMC A;  1XEB A;  2VQY A;  1M1D A;  4E0A A;  4P45 A;  3IWE A;  2CTC A;  3T07 A;  1QSN A;  3PFO A;  2B4D B;  2Q4Z A;  4LQG A;  4XNH B;  4KSF A;  4B11 A;  5JH9 A;  1MJ9 A;  1Y7E A;  3TX8 A;  2XPP A;  4PXE A;  5G20 A;  3BJ7 A;  3EZA A;  3DLJ A;  2YGW A;  4EYS A;  4U9Z A;  4MCQ A;  4CS0 B;  2PDO A;  1Y0Y A;  1XE4 A;  2C6G A;  3RBU A;  2CNS A;  3PEI A;  2XEG A;  3PFE A;  1DTD A;  1Y9K A;  4C9R A;  5H84 A;  2AE6 A;  4OC5 A;  4C8U A;  3W6X A;  2ZW7 A;  2BL1 A;  4NGP A;  5BWA B;  1ZRS A;  4PSW A;  3PRT A;  5D29 A;  2I79 A;  3FED A;  3B3V A;  3PBB A;  3QAY A;  2YJT A;  2JBJ A;  3OAK A;  1YK3 A;  1R61 A;  3TLZ A;  1NE9 A;  4G1P A;  3IFE A;  2Y1N A;  2D4P A;  3PB4 X;  4KOV A;  4MHN A;  1UWY A;  4C84 A;  3NA6 A;  3D4U A;  3SJF A;  3RYO A;  1QSM A;  4FUU A;  4JYW A;  4R87 A;  2R98 A;  1LAP A;  4ZI6 A;  3EZE A;  3D8P A;  1S7F A;  2DPT A;  2YNC C;  4JZ0 A;  3FYN A;  1ARL A;  5EBV A;  4JLY A;  1TXR A;  5HVH A;  4B12 A;  2D0P A;  4KOW A;  4NJQ A;  2CY2 A;  4IIX A;  4NGN A;  3EC4 A;  4B5O A;  2CXA A;  4UF4 A;  3TTH A;  3TLB A;  4R7M A;  4MXU A;  3LD2 A;  4EWT A;  1YR0 A;  1S7N A;  3DDD A;  4PK2 A;  4R6T A;  3F9K C;  3KAS A;  5AG6 A;  7CPA A;  2VKZ G;  2C1C A;  4A37 A;  2HUZ A;  3HPG G;  1BOB A;  2HV2 A;  4R3K A;  4KVM E;  5D8N A;  4TJV A;  1BLL E;  3FVL A;  2Z3L A;  1M4G A;  5I0C A;  2G9D A;  2C6P A;  3FEE A;  3CZX A;  3S9M A;  1CP6 A;  5F9M A;  2FIA A;  2OZG A;  1A2Z A;  1IYK A;  5HKY A;  4IUS A;  4BMH A;  4MFL A;  4M3S A;  1ZLH A;  1KZF A;  4DUK A;  5HMN A;  4E5S A;  4IHM A;  1IYL A;  1Z8L A;  1FNO A;  2Q0Y A;  3B2Y A;  2V8D A;  4RN7 A;  4W9Y A;  1QQ9 A;  2Q43 A;  3KHX A;  3NH8 A;  4DNC A;  3QAH A;  4ZX9 A;  1PUA A;  4ZBG A;  1BXR B;  1VHE A;  2N3A B;  4P4F A;  4GPL B;  2OZH A;  5J1Q A;  5LRJ A;  3DNS A;  4R57 A;  2GRE A;  2OU2 A;  4KNG E;  3VRQ A;  4A2Z A;  2GFQ A;  1VI4 A;  1XFO A;  3CPA A;  2PIY A;  2PR8 A;  3ZZI A;  4QUS A;  3N7Z A;  4II9 A;  1QSR A;  3JUW A;  2JEW A;  4H89 A;  4GS4 A;  5AGE A;  2IJZ A;  3FX6 A;  1JWQ A;  1F57 A;  1SQH A;  2ZEO A;  2PRQ A;  1CE8 B;  2CBL A;  3R1K A;  4MFJ A;  3CDX A;  1Z9U A;  3EFA A;  2MP0 A;  5G1Z A;  1IOF A;  4AG9 A;  4NGR A;  2JBK A;  5BY0 A;  5LYL A;  2PCN A;  1K4J A;  4CDK A;  1Z8T A;  3HMJ G;  3H8G A;  2Z10 A;  1HDU A;  2FCK A;  4NSQ A;  4Q7A A;  4UEZ A;  4F0X A;  2POK A;  2Z0Z A;  1PYT B;  4A94 A;  6CPA A;  2ZEL A;  4YN3 A;  1Q2D A;  3FF3 A;  4CAF A;  3H8E A;  3GIU A;  1ZLI A;  1B87 A;  1S7K A;  4JWP A;  5HVG A;  2B5G A;  2Q04 A;  3NH5 A;  3EZB A;  4C8T A;  2QEC A;  3IGR A;  1WWZ A;  4A33 A;  4MY3 A;  4CAW A;  5HH1 A;  5LRK A;  5KTA A;  3RO0 A;  4B13 A;  3I6S A;  3HLP A;  1Z4E A;  4J3G A;  1XMT A;  1Z5R A;  5AG7 A;  5E96 A;  4Z65 A;  3GJZ A;  4IIY A;  3CT9 A;  2ZEM A;  3T90 A;  3NFQ A;  4KOT A;  4KSI A;  2ANP A;  4MY0 A;  4YWY A;  2EBJ A;  2FE7 A;  5GCN A;  1GYT A;  1S7L A;  1U6M A;  2ZEF A;  3CPX A;  3SR3 A;  1Z8X A;  3BI1 A;  1XOV A;  4R76 A;  3JRU A;  2EK9 A;  4HNY B;  3ICU A;  5F47 A;  4C2Z A;  4C9A A;  3B3T A;  3P2F A;  4CDJ A;  4H6Z A;  1BPM A;  1YME A;  4R9M A;  2Y1M A;  2JEV A;  4OC1 A;  5EC4 A;  4C68 A;  4MCS A;  5I4M A;  3T5M A;  4OME A;  3IEH A;  4PXB A;  1C30 B;  4PXD A;  1IY7 A;  3S6G A;  2NSM A;  5HKW A;  2DEA A;  2EO8 A;  4FWU A; 
#chains in the Genus database with same CATH homology
 4MHZ A;  4ZY2 A;  2PJA A;  3QNV A;  2PIZ A;  4MCR A;  3RZA A;  3VAT A;  1CPX A;  4ONW A;  1PCA A;  2PJ4 A;  5K8P A;  1Y0R A;  1BPN A;  1VGY A;  2NYQ A;  8CPA A;  2AFX A;  3B3C A;  2QYV A;  3VAR A;  2XEI A;  4P10 A;  3SI2 A;  2GU2 A;  3D67 A;  2CIJ A;  2BO9 A;  1M4L A;  2AFU A;  4GM5 A;  4WJB A;  2XEF A;  1Q7L A;  1CG2 A;  2FVG A;  2V8G A;  3NFZ A;  3PB9 X;  4OP4 A;  3WC5 A;  3BHX A;  3KGQ A;  4MCP A;  3BXM A;  1LCP A;  1ARM A;  1LAM A;  1YW6 A;  1ELL P;  3PBE A;  3IO1 A;  1QMU A;  3KHZ A;  1Z2L A;  3TC8 A;  4P4E A;  2RFH A;  2AFS A;  1DE4 C;  3SI0 A;  2EK8 A;  4YU9 A;  2PJ7 A;  2AFZ A;  5HXD A;  4F9U A;  3IC1 A;  2PJ2 A;  2GLJ A;  2ZED A;  1ZG7 A;  3EIF A;  4P4I A;  3V7Z A;  3SJG A;  4P4J A;  4P4B A;  2PJ0 A;  2GP4 A;  1HEE A;  1LFW A;  2ZOF A;  2PVW A;  3WAB A;  3B35 A;  5K8M A;  5K8O A;  4EME A;  3LMS A;  4OKO A;  4PXC A;  4UEE A;  2C5Q A;  4TNU A;  4A38 A;  3GUX A;  4NFR A;  4RUH A;  2V8H A;  3ISZ A;  2XEJ A;  3D7F A;  2IQ6 A;  2O4H A;  3NH4 A;  4O23 A;  4TJX A;  2PJ6 A;  2PJ3 A;  2WYR A;  4UIB A;  4OC3 A;  4PPZ A;  4OC4 A;  4IAV A;  2PCU A;  1FT7 A;  1CP7 A;  2Q51 A;  4P4D A;  1RTQ A;  3IJ3 A;  3HUV A;  4C9V A;  4C8P A;  3KQX A;  2PJB A;  5IR2 A;  3V38 A;  2PJ9 A;  1Y9Z A;  2PJ5 A;  3LWU A;  2WZN A;  4MHP A;  3VTA A;  4PQA A;  1NSA A;  4DJL A;  5JGF A;  1ZG9 A;  2ZOG A;  1XMB A;  3FH4 A;  2V77 A;  1LAN A;  3PB6 X;  2PE3 A;  3KR4 A;  1AYE A;  2HB6 A;  3KZW A;  3N5F A;  4F8Z A;  2PJ1 A;  1VIX A;  4C85 A;  1IGB A;  2AFM A;  3L2N A;  3I1U A;  1WVM A;  1OBR A;  4OIW A;  4A39 A;  4MHY A;  1TF8 A;  4ZX8 A;  1AMP A;  4F9V A;  3FEC A;  3RAM A;  1XBU A;  4H2K A;  2EWB A;  4X3R A;  1XJO A;  3K9T A;  2RB7 A;  3I74 A;  4FBE A;  1TKH A;  3H8F A;  1F2P A;  4TWE A;  4OC0 A;  2O53 A;  4NGS A;  4MMO A;  4P6Y A;  1YW4 A;  2AFO A;  5F09 A;  1HDQ A;  1F2O A;  2F8H A;  5LYI A;  1JQG A;  4C86 A;  4MRI A;  2BOA A;  4UIA A;  2PVV A;  1CPS A;  4C9U A;  4CPA A;  4C8A A;  2PJ8 A;  2ZEE A;  4C9E A;  4WWV A;  3D66 A;  4C8F A;  5LRG A;  2AFW A;  1YLO A;  5CBM A;  3KI9 A;  5IB9 A;  4C99 A;  4BD9 A;  1V6C A;  1XF1 A;  3D68 A;  5LYF A;  1R43 A;  4X2T A;  1ZG8 A;  2CTB A;  4AXV A;  4ZYQ A;  2ZEH A;  1CX8 A;  3GB0 A;  4EFD A;  5THW A;  2F7V A;  3GLJ A;  2PJC A;  3B7I A;  2OR4 A;  4NGQ A;  1H8L A;  3SJX A;  3WC7 A;  4OC2 A;  3IWW A;  3S9N A;  2ZEN A;  2VL1 A;  5CPA A;  4ZY0 A;  4FAI A;  3PB7 X;  3B3W A;  2C6C A;  3WT4 A;  1LOK A;  3MN8 A;  4X8I A;  3B3S A;  4R8F A;  1CBX A;  5LYD A;  2OOT A;  3BI0 A;  1R3N A;  1TF9 A;  2GLF A;  1KWM A;  3MRU A;  3VH9 A;  3KR5 A;  2I3C A;  2QJ8 A;  2HC9 A;  4NGT A;  4NGM A;  3S9L A;  3D7D A;  2CF4 A;  3SJE A;  2BCO A;  3WC6 A;  3T8W A;  2J9A A;  4NJR A;  5DS0 A;  1XRY A;  3KQZ A;  3FJU A;  1EE3 P;  1BAV A;  2ABZ A;  5K8N A;  3SI1 A;  3D7G A;  4UEF A;  2V8V A;  4DYO A;  2ZEP A;  3KL9 A;  2ZEG A;  1VHO A;  3PB8 X;  1TKJ A;  4C8C A;  2IMO A;  4P44 A;  5JM6 A;  1YSJ A;  1TKF A;  3IIB A;  4K3N A;  5HVF A;  5ELY A;  1ELM P;  4IK2 A;  3DGV A;  3K2K A;  4B6Z A;  4OID A;  3D7H A;  3ISX A;  2QVP A;  4ZY1 A;  3FMC A;  4P45 A;  2CTC A;  3PFO A;  2Q4Z A;  4LQG A;  5JH9 A;  1Y7E A;  3TX8 A;  4PXE A;  3DLJ A;  4MCQ A;  1Y0Y A;  2C6G A;  3RBU A;  3PEI A;  2XEG A;  3PFE A;  1DTD A;  4C9R A;  4OC5 A;  4C8U A;  4NGP A;  3PRT A;  5D29 A;  3FED A;  3B3V A;  3PBB A;  2JBJ A;  4G1P A;  3IFE A;  3PB4 X;  4MHN A;  1UWY A;  4C84 A;  3NA6 A;  3D4U A;  3SJF A;  4FUU A;  4JYW A;  1LAP A;  4ZI6 A;  4JZ0 A;  1ARL A;  1TXR A;  5HVH A;  4NJQ A;  4NGN A;  4UF4 A;  4R7M A;  4MXU A;  4EWT A;  4R6T A;  3KAS A;  7CPA A;  4A37 A;  2C1C A;  4TJV A;  5D8N A;  1BLL E;  3FVL A;  2G9D A;  2C6P A;  3FEE A;  3S9M A;  1CP6 A;  1ZLH A;  4DUK A;  4IHM A;  1Z8L A;  1FNO A;  3B2Y A;  2V8D A;  4W9Y A;  1QQ9 A;  2Q43 A;  3KHX A;  3NH8 A;  4ZX9 A;  1VHE A;  4P4F A;  5J1Q A;  5LRJ A;  2GRE A;  4KNG E;  1XFO A;  3CPA A;  2PIY A;  2JEW A;  2IJZ A;  3FX6 A;  1F57 A;  2ZEO A;  2PRQ A;  3CDX A;  5LYL A;  4NGR A;  2JBK A;  4CDK A;  3H8G A;  4Q7A A;  1HDU A;  4UEZ A;  2POK A;  4A94 A;  1PYT B;  6CPA A;  2ZEL A;  4YN3 A;  3FF3 A;  3H8E A;  1ZLI A;  4C8T A;  5HVG A;  3NH5 A;  5LRK A;  3I6S A;  3HLP A;  1Z5R A;  4Z65 A;  3CT9 A;  2ZEM A;  4KSI A;  2ANP A;  4YWY A;  1GYT A;  2ZEF A;  3CPX A;  3BI1 A;  4R76 A;  3JRU A;  2EK9 A;  3ICU A;  4CDJ A;  4C9A A;  3B3T A;  1BPM A;  1YME A;  4OC1 A;  4MCS A;  5I4M A;  4OME A;  3IEH A;  4PXB A;  4PXD A;  1IY7 A;  2NSM A;  2DEA A;  4FWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...