4P4JA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33d
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
686
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 263
structure length 686
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4jA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4jA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4jA02
3VTAA 1TF8A 2PJAA 4MHPA 5THWA 1VGYA 2PCUA 4OC4A 3WABA 3NH5A 4YU9A 2CIJA 3NA6A 4MHNA 3PRTA 4Z65A 4OC0A 3RBUA 2CF4A 1HDUA 3ISXA 1ZG8A 3PFEA 4OIDA 4CPAA 3BHXA 4UEEA 1PYTB 2ZEFA 3ICUA 2WZNA 4P4IA 1ZLIA 4P4DA 3KR4A 4P45A 1BPMA 1Z2LA 4FWUA 1GYTA 3PB9X 5CPAA 4A94A 5CBMA 1QQ9A 2V8GA 3CDXA 4R7MA 4MCQA 4MCRA 2PJ7A 2GLFA 1OBRA 3SI0A 1F2PA 2PJ5A 4C8PA 4OMEA 1IGBA 3B7IA 3VARA 4IK2A 4ZY1A 2Q51A 2BO9A 7CPAA 1XMBA 4R8FA 4UIAA 1VHEA 3H8EA 3VATA 4C8TA 2PVWA 3D7GA 4A38A 1R3NA 3D7DA 3S9NA 3KHXA 3FJUA 3KI9A 4EFDA 3I74A 1M4LA 1Y9ZA 4MMOA 2I3CA 2V8VA 1XRYA 4X3RA 2C6PA 1ZG7A 2V8DA 4Q7AA 4R76A 3SI2A 4OC2A 2C6GA 2ZELA 3HUVA 4PXBA 4NJQA 5LRGA 2F7VA 2ZENA 5HVHA 3FECA 3B3WA 1YSJA 3KGQA 3CPAA 4F9UA 4F8ZA 4NGPA 3GLJA 4PQAA 3WC7A 3IIBA 3PBBA 3TC8A 2HB6A 3SJXA 2AFXA 2OOTA 2XEFA 2BCOA 4DUKA 1TF9A 1Z5RA 4KSIA 4JZ0A 2POKA 1Q7LA 4AXVA 3N5FA 1Z8LA 3NH8A 3K2KA 3IFEA 2QJ8A 5LYIA 3GB0A 2IQ6A 3MN8A 4C85A 1Y7EA 1PCAA 3SJEA 5HVFA 2GREA 2CTCA 1CBXA 2PJ0A 4PXCA 1F2OA 3FMCA 3KZWA 4UIBA 4TJXA 1FT7A 4W9YA 3ISZA 4C9AA 2AFUA 2AFOA 4A37A 5J1QA 1ELMP 2PIYA 2O4HA 3JRUA 3KASA 4C86A 2ZEGA 3KQXA 1XJOA 1ZLHA 2NYQA 2XEIA 2EWBA 4RUHA 4C8UA 3PEIA 3I1UA 3D68A 2RB7A 3BXMA 3SI1A 4IAVA 3PFOA 3NH4A 2WYRA 5HVGA 1UWYA 5K8NA 4X2TA 2ANPA 4OP4A 2AFSA 2AFWA 3BI1A 3B3SA 1LFWA 2OR4A 2O53A 4P4FA 2IJZA 4C84A 3IJ3A 1CPSA 4TJVA 3V38A 5JGFA 3FH4A 5K8PA 4FBEA 3KHZA 1LAMA 2ZEEA 3MRUA 4NGRA 2PJCA 3B35A 4F9VA 1YLOA 4ZI6A 1EE3P 4OIWA 4C9VA 4IHMA 3B3CA 3LMSA 1NSAA 2PE3A 2ZEOA 3WT4A 2ZEPA 1IY7A 1CG2A 3B3VA 4ZY2A 3T8WA 4C8FA 3WC5A 1CPXA 2ABZA 1CP7A 4PXEA 1V6CA 3PB6X 1TKJA 3B3TA 5JM6A 2AFZA 4LQGA 8CPAA 1Y0YA 2PJ8A 3GUXA 3PB8X 3HLPA 1FNOA 3V7ZA 3WC6A 2J9AA 4NFRA 4OC3A 5K8MA 1BLLE 4NGQA 4GM5A 4C99A 2XEJA 3FEEA 4NGMA 3FVLA 1ELLP 4C9EA 2F8HA 1QMUA 3PB7X 3FX6A 1RTQA 2CTBA 3QNVA 4ZX9A 4P4EA 1AMPA 1TKHA 4NGNA 3L2NA 5K8OA 3B2YA 4UF4A 4PPZA 2AFMA 3BI0A 2QVPA 1KWMA 5F09A 4YN3A 2G9DA 5D8NA 2V77A 4B6ZA 2PJ2A 4PXDA 4MCSA 4CDKA 4CDJA 1VIXA 5LYDA 1JQGA 4WJBA 4C9UA 2GLJA 1XBUA 3CPXA 2HC9A 5JH9A 4EMEA 5LYLA 1XF1A 1HDQA 3LWUA 1YMEA 3DLJA 2PJ6A 4A39A 3PBEA 4MXUA 3S9MA 3K9TA 2ZOFA 5D29A 4P4BA 3RAMA 5IB9A 4ZY0A 1YW6A 4NJRA 5ELYA 2ZEHA 4ZYQA 4OC5A 4NGSA 1ARLA 4KNGE 4DYOA 2VL1A 5I4MA 4JYWA 3KR5A 4P6YA 3VH9A 1TKFA 1TXRA 3NFZA 2JBJA 5DS0A 2JEWA 4OC1A 3D7HA 4G1PA 2C6CA 1CX8A 3SJFA 2V8HA 2EK9A 2Q43A 1WVMA 5LRJA 4C8CA 4X8IA 1ZG9A 2FVGA 4DJLA 3FEDA 2PJ4A 4YWYA 2PJBA 2BOAA 4FUUA 4TWEA 4ZX8A 3EIFA 1DE4C 1AYEA 4MHYA 3SJGA 1F57A 1LANA 2ZOGA 1HEEA 3IC1A 2PIZA 3KQZA 3S9LA 2ZEMA 4WWVA 6CPAA 4H2KA 4TNUA 4EWTA 4MRIA 5LRKA 2PRQA 2JBKA 3DGVA 4O23A 4UEFA 4P44A 2PJ1A 4C9RA 4ONWA 1BAVA 4OKOA 3D4UA 2PJ3A 2PJ9A 3KL9A 1LCPA 3FF3A 3H8GA 2C1CA 4NGTA 5HXDA 3IEHA 4MCPA 1R43A 2XEGA 3CT9A 1LAPA 2Q4ZA 2DEAA 2QYVA 2PVVA 3IO1A 4FAIA 3RZAA 3D66A 1DTDA 1LOKA 3H8FA 4C8AA 4MHZA 4P4JA 4K3NA 2ZEDA 3D7FA 2IMOA 3IWWA 3D67A 1YW4A 2EK8A 4UEZA 2GU2A 3PB4X 4R6TA 1H8LA 3I6SA 1BPNA 1Y0RA 1XFOA 2RFHA 4P10A 1ARMA 1CP6A 3TX8A 1VHOA 2NSMA 4BD9A 5LYFA
chains in the Genus database with same CATH superfamily
3VTAA 5J8CA 1ZYMA 4JWPA 1TF8A 2PJAA 4ONUA 5HH1A 5AGEA 4MHPA 3R95A 2DXQA 5THWA 5AG4A 1VGYA 2PCUA 5F48A 2R98A 1EZBA 4OC4A 3WABA 3SXOA 1BXRB 3TOAA 2B4BA 3OB1B 3NH5A 4KZTA 4RN7A 2CIJA 1MJ9A 3NA6A 4YU9A 1S7KA 2DIKA 4MHNA 1XOVA 4KS9A 3PRTA 4Z65A 4OC0A 3RBUA 2CF4A 1HDUA 3W6SA 5F49A 1KUYA 3ISXA 1ZG8A 1KC7A 1V0CA 1M4DA 4QUSA 4PSWA 3BUNB 1S5KA 3TLZA 3PFEA 4OIDA 4RI1A 3BHXA 4UEEA 4CPAA 2REEA 4UWIA 1PYTB 2ZEFA 4CGPA 1ZRSA 3ICUA 2P6EA 2WZNA 1CJWA 4GXHA 4FD4A 4P4IA 1JDBC 1J4JA 1ZLIA 4INJA 1T36B 4P4DA 3KR4A 3K9UA 3GJZA 3EZEA 4P45A 1BPMA 2YNCC 3ZJ0A 3FNCA 1Z2LA 4FWUA 1GYTA 2Q04A 3PB9X 3KRVA 4M8DA 5CPAA 1U6MA 2YNEA 4A94A 5CBMA 1QQ9A 2V8GA 4B11A 2FSRA 3CDXA 4R7MA 4CRYB 4MCQA 1YK3A 4MCRA 3TLAA 2PJ7A 4UFWA 2GLFA 1OBRA 2VI7A 2Z0ZA 1S60A 4DNCA 2KCWA 4LX9A 3SI0A 1F2PA 2PJ5A 4BINA 4C8PA 4OMEA 1IGBA 3I9SA 4CAEA 1Z8XA 3B7IA 3VARA 5IV0A 4UCNA 2CNMA 4IK2A 4ZY1A 2Q51A 5HKWA 5GCNA 4JXQA 1I21A 1K4JA 5AG6A 2I79A 1ON0A 2AE6A 4F0XA 5F9MA 2BO9A 7CPAA 4B10A 2O28A 1XMBA 2FIWA 4R8FA 4UIAA 5FVJA 5G22A 4CAVA 1VHEA 2B4JC 3VRQA 2P6GA 3E0KA 3H8EA 3K4IA 4R57A 3VATA 4B13A 1S7NA 3N7ZA 1S3ZA 4M6HA 4XPKA 1WK4A 3FXTA 2Y1NA 4YRHA 2B5GA 4C8TA 2PVWA 3W6XA 4JLYA 4XPDC 3D7GA 2JEVA 1R3NA 3D7DA 2IL4A 3IU2A 4A38A 1Z9EA 4AVCA 4ZBGA 2H5MA 3S9NA 1S7FA 3KHXA 3FJUA 3KI9A 3TO6A 4EFDA 5HKYA 3G23A 2HROA 3EC4A 3G3SA 4KUBA 2CXAA 1M4LA 3I74A 2Q7SA 4CO9A 1Y9ZA 4CGOA 1R61A 1YVHA 4MMOA 2I3CA 2V8VA 4M3SA 3W91A 1NE9A 1XRYA 4FD5A 4X3RA 2C6PA 3TFYA 2ZW5A 3NE8A 4A2ZA 4KOWA 1ZG7A 5JQ4A 2V8DA 1XIXA 2PCNA 4Q7AA 4R76A 1IYKA 1YLEA 3SI2A 1MJBA 4OC2A 2C6GA 4LUAA 2GFQA 3JUWA 2ZELA 1YVKA 3HUVA 4PXBA 4YFJA 3TO9A 4NJQA 5LRGA 4MFJA 4AVAA 4R3KA 2F7VA 2ZENA 5HVHA 3FECA 3B3WA 1YSJA 3KGQA 4MFQA 3S6FA 3CPAA 4F9UA 3OWCA 4CAWA 5IX3A 2MP0A 3R1KA 4F8ZA 4Q36A 3EZBA 3QAHA 4NGPA 2Q0YA 5J8FA 2EVNA 3GLJA 4PQAA 1KZFA 3RNZA 3WC7A 3IIBA 3VRPA 3PBBA 2HB6A 3TC8A 2BEIA 1VKCA 3VGOA 4B5PA 3SJXA 2AFXA 2CNTA 2PRBA 2DPTA 2Z3OA 1EZAA 3WR7A 2OOTA 2CNSA 4J3GA 2XEFA 2BCOA 4DUKA 1TF9A 1Z5RA 4KSIA 4JZ0A 1ZO0A 2AUNA 3HMJG 4B14A 3F9KC 1A9XB 2POKA 3TO7A 2EZCA 1Q7LA 4AXVA 3N5FA 1Z4RA 5JYBA 1Z8LA 3VWEA 1KBLA 1TIQA 3T90A 1IICA 1IU8A 1QSRA 4K30A 3NH8A 3K2KA 2QJ8A 3IFEA 3B8GA 3CZXA 5LYIA 5G21A 3GB0A 1VI4A 1KUXA 2XPNA 2IQ6A 3MN8A 3TLYA 3ZNIA 1Y9KA 4C85A 1GHEA 5IR2A 2DPSA 1Y7EA 1PCAA 4OLLA 3SJEA 5AG5A 5FD8A 5HVFA 2GREA 2CTCA 4NEXA 1CBXA 4COBA 2PJ0A 4PXCA 3O8ZA 2CY2A 1VBGA 1F2OA 2YNDA 3FMCA 3KZWA 4UIBA 3LACA 3BUWB 3EO4A 4XNHB 1J3LA 2VXKA 4A33A 3CXPA 1VBHA 1FT7A 2B4DB 4FD6A 4W9YA 4TJXA 4KOXA 4B5PB 4CGLA 2FE7A 4L8AA 3ISZA 3D8PA 1BOBA 3P2FA 3GY9A 4C9AA 3FIXA 3C8OA 4A30A 2AFUA 2AFOA 4A37A 1QSMA 4OADA 2HQYA 4BPWB 5J1QA 2X0SA 4PSXA 2PQ8A 2VBQA 2NMTA 1Z4EA 2BSWA 1ELMP 1M4GA 2PIYA 1B6BA 1IB1E 2O4HA 4M6IA 3S6HA 1DIKA 2FM4A 3RYOA 2WPXA 3KASA 3JRUA 1Y9WA 4CYOA 4C86A 4CS0B 2J8MA 3PP9A 2ZEGA 3P2HA 4QB9A 3KQXA 4PV6A 2ZXVA 1ZL0A 1XJOA 1ZLHA 2FIAA 2NYQA 2OB0A 3D2MA 2XEIA 2G3AA 5G20A 3OP0A 1X12A 2Z3MA 2EWBA 1L0CA 2FXFA 4M85A 3R96A 4RUHA 4U5YA 3BLNA 3BUOB 3PEIA 4C8UA 3I1UA 3D68A 4YGOA 1P4NA 2RB7A 1C3OB 2OLSA 4F6AA 3BXMA 3SI1A 1KUVA 4IAVA 1IOIA 2VZZA 2Q4YA 3PFOA 4JD6A 2D0OA 3H8FA 3NH4A 2WYRA 1Q2CA 2R1IA 3RO0A 5HVGA 2G0BA 1UWYA 1A2ZA 3S6GA 5JPHA 3IU1A 5K8NA 4E94A 4R9MA 3R9EA 4X2TA 3TTHA 5F13A 1X10A 2ANPA 4OP4A 4ORFA 2AFSA 4BPUB 2HUZA 2Z3LA 3R9FA 2HWGA 2D4PA 2AFWA 2EZAA 3TCVA 2VEZA 3BI1A 4H6UA 3B3SA 2Q7BA 3TT2A 5AG7A 3PT1A 1LFWA 2OR4A 2O53A 2YNCA 5DWNA 4E5SA 5C88A 4P4FA 4KLVA 2C5QA 3IGRA 3UY5A 4KUAA 4COGA 2IJZA 4C84A 3IJ3A 3TOBA 1CPSA 1EO0A 4TJVA 2VKZG 3V38A 4KSFA 5JGFA 5EBVA 1YREA 2PC1A 3JVNA 4M6GA 3FH4A 2BUEA 4QBJA 5KTCA 4AVBA 1YQEA 4KOUA 4FBEA 5K8PA 3VRRA 3KHZA 1XF8A 2Q4VA 4JXRA 1LAMA 4AG9A 4CGMA 3U1BA 2ZEEA 2OZGA 1M44A 3MRUA 3SHPA 2HI6A 4NGRA 2PJCA 3B35A 5JVLA 4KOYA 1GGOA 2JDDA 4F9VA 1YLOA 4ZI6A 3T5MA 3HPGG 1EE3P 4OIWA 4C9VA 4IHMA 3FYNA 3B3CA 1YR0A 4QVTA 4CYQA 3NOJA 3LMSA 1NSAA 4Q38A 3FB3A 2OZUA 4IIYA 3EZAA 2PE3A 2ZEOA 3WT4A 3EY5A 2ZEPA 1IY7A 1CG2A 3B3VA 4ZY2A 3T8WA 4CAXA 4C8FA 3WC5A 2D0PA 1CPXA 2ABZA 2B0AA 5DWMA 1QSTA 1CP7A 4HNWB 4I49A 4PXEA 3T9YA 4CRZB 3PB6X 1V6CA 1TKJA 5J3XA 4EVYA 4H89A 4KOSA 3B3TA 2OU2A 4KSAA 4NCZA 5JM6A 3T0TA 1CE8B 4MI4A 2K5TA 3NFQA 1NXJA 2OH1A 2AFZA 4LQGA 1IIDA 8CPAA 4A32A 4H1HA 4XNHC 1Y0YA 1CM0A 5A27A 1LRZA 2B5GB 2PJ8A 2J8NA 2GIVA 3GUXA 3BUMB 3HLPA 3PB8X 1FNOA 1S7LA 2YJVA 2DF5A 3S6KA 3FRMA 3V7ZA 3WC6A 2P0WA 5KTDA 2J9AA 4NFRA 4MFZA 4AG7A 4OC3A 1Q2DA 4HPSA 1BLLE 5K8MA 4NGQA 3TLCA 3BUXB 4GM5A 4C99A 2XEJA 4UBRA 3FEEA 4NGMA 1XEBA 1RXTA 3FVLA 4RR2B 1ELLP 4C9EA 3QB8A 2F8HA 3TLGA 4A4BA 3F5BA 2PR1A 1QMUA 3PB7X 3FX6A 2C27A 4LQ6A 1RTQA 2OZHA 1IYLA 3G8WA 4MJ8A 2CTBA 5H84A 4C68A 3SXNA 2N3AB 4C2YA 3QNVA 4ZX9A 5A28A 1P0HA 4P4EA 1IOFA 3DR8A 2Z3PA 5EC4A 1AMPA 1TKHA 4NGNA 3L2NA 1Q5XA 3HPHE 1I12A 5K8OA 4Y49B 1I1DA 3B2YA 4U9YA 3DR6A 1M4IA 4PPZA 4UF4A 3DSBA 1NSLA 2ZW4A 2AFMA 3BI0A 2QVPA 4XPLA 4FD7A 4CGNA 3V8IA 5I0CA 1KWMA 5G1ZA 3ZZIA 5F09A 4GS4A 4YN3A 2G9DA 2Z11A 5D8NA 5EMIA 2AUMA 2WPWA 2V77A 4B6ZA 2PJ2A 2HV2A 4PXDA 3PLFB 4MCSA 4CDKA 5AXIA 4CDJA 1FBVA 1VIXA 1NMTA 2RC4A 5LYDA 3TLGB 1JQGA 2Z10A 4WJBA 4NF1A 3MGDA 2VZYA 4C9UA 2PDOA 2R82A 2F5IA 3OAKA 2GLJA 1XBUA 3CPXA 2HC9A 4MBUA 5JH9A 4GPLB 4EMEA 5LYLA 1XF1A 2PSWA 4CYNA 4IIXA 4E0AA 2Q44A 4E2AA 1HDQA 4B12A 3LWUA 4R3LA 1YMEA 2UV8G 2G3TA 2EBJA 3BJ7A 3DLJA 3GIUA 2PJ6A 4UFVA 3EXNA 5F47A 4A39A 1YX0A 3H5ZA 3PBEA 5HKZA 4KOVA 4MXUA 3S9MA 3K9TA 4II9A 2ZOFA 5K99A 4PK3A 5D29A 4IUSA 4P4BA 2PR8A 3EFAA 2YGWA 3RAMA 4A95A 4C2ZA 1Y7RA 5IB9A 3PFVA 4BMHA 4ZY0A 1YW6A 3R9GA 4NJRA 2A4NA 5ELYA 2ZEHA 3LODA 4MFLA 4L89A 4ZYQA 4OC5A 3F8KA 4MY0A 2ZPAA 1C30B 4J0NA 4KORA 1SQHA 4NGSA 1WWZA 1ARLA 2Z3NA 2XPOA 4UCMA 4F0YA 4HNYB 3FBUA 4DYOA 4KNGE 3SR3A 4BBHA 3LD2A 2R8VA 2VL1A 3PZJA 3JTKA 4KVME 4C2XA 1BO4A 5I4MA 2BL1A 1M1DA 4JYWA 2DLAA 3KR5A 4P6YA 3VH9A 1TKFA 1TXRA 3NFZA 2JBJA 1XE4A 2ODFA 2B3UA 4NXYA 4MJXA 2Y0MA 3DDDA 5DS0A 3VRNA 2JEWA 2X7BA 4OC1A 4MFPA 3D7HA 2EZBA 4G1PA 2C6CA 1CX8A 3SJFA 3PGPA 4UA3A 2GANA 2QMLA 2V8HA 5BY0A 2EK9A 2Q43A 2EUIA 1MJAA 1WVMA 5LRJA 2XPPA 4HKFA 4X8IA 1ZG9A 1NBWA 4C8CA 2FVGA 4R87A 4DJLA 3FEDA 1MK4A 2AJ6A 2PJ4A 2PJBA 4X5KA 4YWYA 5F46A 2BOAA 4FUUA 4KOTA 4E8OA 4MI1A 4TWEA 4AB7A 3D3SA 4B5OA 3DNSA 4UCPA 3TLEA 1Z8TA 5H86A 1RO5A 1PU9A 2FS5A 4PK2A 4ZX8A 3EIFA 1DE4C 2WSAA 5C82A 3A9LA 1AYEA 4CZ1A 4MHYA 4UWJA 3SJGA 1F57A 1LANA 2ZOGA 1N71A 2D4OA 3IWGA 1QSOA 3QAYA 4IF5A 1HEEA 4MY3A 1XMTA 3IC1A 2PIZA 3KQZA 5IB0A 1Z9UA 3S9LA 5F5XA 3CXQA 2ZEMA 3GYAA 4WWVA 2FL4A 5BWAB 4CYPA 6CPAA 3KKWA 4H2KA 4TNUA 5F1YA 4EWTA 2E28A 1Z8WA 4MRIA 1VHSA 4C7IA 4BTFA 3GKRA 5LRKA 2Y1MA 2PRQA 5E96A 1JDEA 5KTAA 2JBKA 2QECA 3BJ8A 3DGVA 3I3GA 4KLWA 4O23A 4UEFA 4P44A 3C26A 4Y49C 1KEEB 4BPXB 4KVXA 4QC6A 4KVOE 2JLMA 1FY7A 3TLBA 2PJ1A 4C9RA 4ONWA 1BAVA 4MFKA 3D4UA 1YGHA 2PJ3A 4OKOA 2PJ9A 3F0AA 4RS2A 3KL9A 4NSQA 1LCPA 3FF3A 3VWDA 3CXSA 3H8GA 2C1CA 4NGTA 5HXDA 2VQYA 1AUGA 1JWQA 5CNPA 4A31A 3IEHA 4MCPA 1R43A 2XEGA 3CT9A 1LAPA 2Q4ZA 2DEAA 2QYVA 2EO8A 2PVVA 3VROA 3IO1A 4HNXB 4OAEA 4H6ZA 4FAIA 1UFHA 4A4CA 3RZAA 4UFXA 3D66A 3T07A 1DTDA 1LOKA 1PUAA 2GP4A 1OZPA 2B4DA 2CBLA 2QIRA 1QSNA 1YVOA 1B87A 2R7HA 2B58A 2ZW6A 3D2PA 4MHZA 3TYXA 4C8AA 4XPDB 2REFA 2XPLA 4P4JA 3IWEA 4K3NA 2J8RA 2ZEDA 3NE7A 2ARHA 3D7FA 5HMNA 1CS0B 2IMOA 3IWWA 2P6FA 2ZW7A 2B3VA 3D67A 1Q2YA 1YW4A 4EYSA 2EK8A 4UEZA 2GU2A 3PB4X 4JJXA 5ISVA 1M6VB 1WJTA 3TE4A 4R6TA 1R57A 4U9ZA 1B47A 1H8LA 4MHDA 4JVOA 3OB2B 2FCKA 3U88C 3I6SA 1BPNA 1Y0RA 1XFOA 2JDCA 2RFHA 2GE3A 3H4QA 4P10A 2ATRA 1ARMA 1CP6A 3TX8A 4C7HA 1VHOA 2NSMA 2I00A 4BD9A 4ZGYB 2YJTA 5LYFA 4CAFA 2Z3KA 2FT0A 3T05A 2WUUA
chains in the Genus database with same CATH topology
3VTAA 1TF8A 2PJAA 4MHPA 5THWA 1VGYA 2PCUA 4OC4A 3WABA 3NH5A 4YU9A 2CIJA 3NA6A 4MHNA 3PRTA 4Z65A 4OC0A 3RBUA 2CF4A 1HDUA 3ISXA 1ZG8A 3PFEA 4OIDA 4CPAA 3BHXA 4UEEA 1PYTB 2ZEFA 3ICUA 2WZNA 4P4IA 1ZLIA 4P4DA 3KR4A 4P45A 1BPMA 1Z2LA 4FWUA 1GYTA 3PB9X 5CPAA 4A94A 5CBMA 1QQ9A 2V8GA 3CDXA 4R7MA 4MCQA 4MCRA 2PJ7A 2GLFA 1OBRA 3SI0A 1F2PA 2PJ5A 4C8PA 4OMEA 1IGBA 3B7IA 3VARA 4IK2A 4ZY1A 2Q51A 2BO9A 7CPAA 1XMBA 4R8FA 4UIAA 1VHEA 3H8EA 3VATA 4C8TA 2PVWA 3D7GA 4A38A 1R3NA 3D7DA 3S9NA 3KHXA 3FJUA 3KI9A 4EFDA 3I74A 1M4LA 1Y9ZA 4MMOA 2I3CA 2V8VA 1XRYA 4X3RA 2C6PA 1ZG7A 2V8DA 4Q7AA 4R76A 3SI2A 4OC2A 2C6GA 2ZELA 3HUVA 4PXBA 4NJQA 5LRGA 2F7VA 2ZENA 5HVHA 3FECA 3B3WA 1YSJA 3KGQA 3CPAA 4F9UA 4F8ZA 4NGPA 3GLJA 4PQAA 3WC7A 3IIBA 3PBBA 3TC8A 2HB6A 3SJXA 2AFXA 2OOTA 2XEFA 2BCOA 4DUKA 1TF9A 1Z5RA 4KSIA 4JZ0A 2POKA 1Q7LA 4AXVA 3N5FA 1Z8LA 3NH8A 3K2KA 3IFEA 2QJ8A 5LYIA 3GB0A 2IQ6A 3MN8A 4C85A 5IR2A 1Y7EA 1PCAA 3SJEA 5HVFA 2GREA 2CTCA 1CBXA 2PJ0A 4PXCA 1F2OA 3FMCA 3KZWA 4UIBA 4TJXA 1FT7A 4W9YA 3ISZA 4C9AA 2AFUA 2AFOA 4A37A 5J1QA 1ELMP 2PIYA 2O4HA 3JRUA 3KASA 4C86A 2ZEGA 3KQXA 1XJOA 1ZLHA 2NYQA 2XEIA 2EWBA 4RUHA 4C8UA 3PEIA 3I1UA 3D68A 2RB7A 3BXMA 3SI1A 4IAVA 3PFOA 3NH4A 2WYRA 5HVGA 1UWYA 5K8NA 4X2TA 2ANPA 4OP4A 2AFSA 2AFWA 3BI1A 3B3SA 1LFWA 2OR4A 2O53A 4P4FA 2C5QA 2IJZA 4C84A 3IJ3A 1CPSA 4TJVA 3V38A 5JGFA 3FH4A 5K8PA 4FBEA 3KHZA 1LAMA 2ZEEA 3MRUA 4NGRA 2PJCA 3B35A 4F9VA 1YLOA 4ZI6A 1EE3P 4OIWA 4C9VA 4IHMA 3B3CA 3LMSA 1NSAA 2PE3A 2ZEOA 3WT4A 2ZEPA 1IY7A 1CG2A 3B3VA 4ZY2A 3T8WA 4C8FA 3WC5A 1CPXA 2ABZA 1CP7A 4PXEA 1V6CA 3PB6X 1TKJA 3B3TA 5JM6A 2AFZA 4LQGA 8CPAA 1Y0YA 2PJ8A 3GUXA 3PB8X 3HLPA 1FNOA 3V7ZA 3WC6A 2J9AA 4NFRA 4OC3A 5K8MA 1BLLE 4NGQA 4GM5A 4C99A 2XEJA 3FEEA 4NGMA 3FVLA 1ELLP 4C9EA 2F8HA 1QMUA 3PB7X 3FX6A 1RTQA 2CTBA 3QNVA 4ZX9A 4P4EA 1AMPA 1TKHA 4NGNA 3L2NA 5K8OA 3B2YA 4UF4A 4PPZA 2AFMA 3BI0A 2QVPA 1KWMA 5F09A 4YN3A 2G9DA 5D8NA 2V77A 4B6ZA 2PJ2A 4PXDA 4MCSA 4CDKA 4CDJA 1VIXA 5LYDA 1JQGA 4WJBA 4C9UA 2GLJA 1XBUA 3CPXA 2HC9A 5JH9A 4EMEA 5LYLA 1XF1A 1HDQA 3LWUA 1YMEA 3DLJA 2PJ6A 4A39A 3PBEA 4MXUA 3S9MA 3K9TA 2ZOFA 5D29A 4P4BA 3RAMA 5IB9A 4ZY0A 1YW6A 4NJRA 5ELYA 2ZEHA 4ZYQA 4OC5A 4NGSA 1ARLA 4KNGE 4DYOA 2VL1A 5I4MA 4JYWA 3KR5A 4P6YA 3VH9A 1TKFA 1TXRA 3NFZA 2JBJA 5DS0A 2JEWA 4OC1A 3D7HA 4G1PA 2C6CA 1CX8A 3SJFA 2V8HA 2EK9A 2Q43A 1WVMA 5LRJA 4C8CA 4X8IA 1ZG9A 2FVGA 4DJLA 3FEDA 2PJ4A 4YWYA 2PJBA 2BOAA 4FUUA 4TWEA 4ZX8A 3EIFA 1DE4C 1AYEA 4MHYA 3SJGA 1F57A 1LANA 2ZOGA 1HEEA 3IC1A 2PIZA 3KQZA 3S9LA 2ZEMA 4WWVA 6CPAA 4H2KA 4TNUA 4EWTA 4MRIA 5LRKA 2PRQA 2JBKA 3DGVA 4O23A 4UEFA 4P44A 2PJ1A 4C9RA 4ONWA 1BAVA 4OKOA 3D4UA 2PJ3A 2PJ9A 3KL9A 1LCPA 3FF3A 3H8GA 2C1CA 4NGTA 5HXDA 3IEHA 4MCPA 1R43A 2XEGA 3CT9A 1LAPA 2Q4ZA 2DEAA 2QYVA 2PVVA 3IO1A 4FAIA 3RZAA 3D66A 1DTDA 1LOKA 2GP4A 3H8FA 4C8AA 4MHZA 4P4JA 4K3NA 2ZEDA 3D7FA 2IMOA 3IWWA 3D67A 1YW4A 2EK8A 4UEZA 2GU2A 3PB4X 4R6TA 1H8LA 3I6SA 1BPNA 1Y0RA 1XFOA 2RFHA 4P10A 1ARMA 1CP6A 3TX8A 1VHOA 2NSMA 4BD9A 5LYFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTA A;  1TF8 A;  2PJA A;  4MHP A;  5THW A;  1VGY A;  2PCU A;  4OC4 A;  3WAB A;  3NH5 A;  4YU9 A;  2CIJ A;  3NA6 A;  4MHN A;  3PRT A;  4Z65 A;  4OC0 A;  3RBU A;  2CF4 A;  1HDU A;  3ISX A;  1ZG8 A;  3PFE A;  4OID A;  4CPA A;  3BHX A;  4UEE A;  1PYT B;  2ZEF A;  3ICU A;  2WZN A;  4P4I A;  1ZLI A;  4P4D A;  3KR4 A;  4P45 A;  1BPM A;  1Z2L A;  4FWU A;  1GYT A;  3PB9 X;  5CPA A;  4A94 A;  5CBM A;  1QQ9 A;  2V8G A;  3CDX A;  4R7M A;  4MCQ A;  4MCR A;  2PJ7 A;  2GLF A;  1OBR A;  3SI0 A;  1F2P A;  2PJ5 A;  4C8P A;  4OME A;  1IGB A;  3B7I A;  3VAR A;  4IK2 A;  4ZY1 A;  2Q51 A;  2BO9 A;  7CPA A;  1XMB A;  4R8F A;  4UIA A;  1VHE A;  3H8E A;  3VAT A;  4C8T A;  2PVW A;  3D7G A;  4A38 A;  1R3N A;  3D7D A;  3S9N A;  3KHX A;  3FJU A;  3KI9 A;  4EFD A;  3I74 A;  1M4L A;  1Y9Z A;  4MMO A;  2I3C A;  2V8V A;  1XRY A;  4X3R A;  2C6P A;  1ZG7 A;  2V8D A;  4Q7A A;  4R76 A;  3SI2 A;  4OC2 A;  2C6G A;  2ZEL A;  3HUV A;  4PXB A;  4NJQ A;  5LRG A;  2F7V A;  2ZEN A;  5HVH A;  3FEC A;  3B3W A;  1YSJ A;  3KGQ A;  3CPA A;  4F9U A;  4F8Z A;  4NGP A;  3GLJ A;  4PQA A;  3WC7 A;  3IIB A;  3PBB A;  3TC8 A;  2HB6 A;  3SJX A;  2AFX A;  2OOT A;  2XEF A;  2BCO A;  4DUK A;  1TF9 A;  1Z5R A;  4KSI A;  4JZ0 A;  2POK A;  1Q7L A;  4AXV A;  3N5F A;  1Z8L A;  3NH8 A;  3K2K A;  3IFE A;  2QJ8 A;  5LYI A;  3GB0 A;  2IQ6 A;  3MN8 A;  4C85 A;  1Y7E A;  1PCA A;  3SJE A;  5HVF A;  2GRE A;  2CTC A;  1CBX A;  2PJ0 A;  4PXC A;  1F2O A;  3FMC A;  3KZW A;  4UIB A;  4TJX A;  1FT7 A;  4W9Y A;  3ISZ A;  4C9A A;  2AFU A;  2AFO A;  4A37 A;  5J1Q A;  1ELM P;  2PIY A;  2O4H A;  3JRU A;  3KAS A;  4C86 A;  2ZEG A;  3KQX A;  1XJO A;  1ZLH A;  2NYQ A;  2XEI A;  2EWB A;  4RUH A;  4C8U A;  3PEI A;  3I1U A;  3D68 A;  2RB7 A;  3BXM A;  3SI1 A;  4IAV A;  3PFO A;  3NH4 A;  2WYR A;  5HVG A;  1UWY A;  5K8N A;  4X2T A;  2ANP A;  4OP4 A;  2AFS A;  2AFW A;  3BI1 A;  3B3S A;  1LFW A;  2OR4 A;  2O53 A;  4P4F A;  2IJZ A;  4C84 A;  3IJ3 A;  1CPS A;  4TJV A;  3V38 A;  5JGF A;  3FH4 A;  5K8P A;  4FBE A;  3KHZ A;  1LAM A;  2ZEE A;  3MRU A;  4NGR A;  2PJC A;  3B35 A;  4F9V A;  1YLO A;  4ZI6 A;  1EE3 P;  4OIW A;  4C9V A;  4IHM A;  3B3C A;  3LMS A;  1NSA A;  2PE3 A;  2ZEO A;  3WT4 A;  2ZEP A;  1IY7 A;  1CG2 A;  3B3V A;  4ZY2 A;  3T8W A;  4C8F A;  3WC5 A;  1CPX A;  2ABZ A;  1CP7 A;  4PXE A;  1V6C A;  3PB6 X;  1TKJ A;  3B3T A;  5JM6 A;  2AFZ A;  4LQG A;  8CPA A;  1Y0Y A;  2PJ8 A;  3GUX A;  3PB8 X;  3HLP A;  1FNO A;  3V7Z A;  3WC6 A;  2J9A A;  4NFR A;  4OC3 A;  5K8M A;  1BLL E;  4NGQ A;  4GM5 A;  4C99 A;  2XEJ A;  3FEE A;  4NGM A;  3FVL A;  1ELL P;  4C9E A;  2F8H A;  1QMU A;  3PB7 X;  3FX6 A;  1RTQ A;  2CTB A;  3QNV A;  4ZX9 A;  4P4E A;  1AMP A;  1TKH A;  4NGN A;  3L2N A;  5K8O A;  3B2Y A;  4UF4 A;  4PPZ A;  2AFM A;  3BI0 A;  2QVP A;  1KWM A;  5F09 A;  4YN3 A;  2G9D A;  5D8N A;  2V77 A;  4B6Z A;  2PJ2 A;  4PXD A;  4MCS A;  4CDK A;  4CDJ A;  1VIX A;  5LYD A;  1JQG A;  4WJB A;  4C9U A;  2GLJ A;  1XBU A;  3CPX A;  2HC9 A;  5JH9 A;  4EME A;  5LYL A;  1XF1 A;  1HDQ A;  3LWU A;  1YME A;  3DLJ A;  2PJ6 A;  4A39 A;  3PBE A;  4MXU A;  3S9M A;  3K9T A;  2ZOF A;  5D29 A;  4P4B A;  3RAM A;  5IB9 A;  4ZY0 A;  1YW6 A;  4NJR A;  5ELY A;  2ZEH A;  4ZYQ A;  4OC5 A;  4NGS A;  1ARL A;  4KNG E;  4DYO A;  2VL1 A;  5I4M A;  4JYW A;  3KR5 A;  4P6Y A;  3VH9 A;  1TKF A;  1TXR A;  3NFZ A;  2JBJ A;  5DS0 A;  2JEW A;  4OC1 A;  3D7H A;  4G1P A;  2C6C A;  1CX8 A;  3SJF A;  2V8H A;  2EK9 A;  2Q43 A;  1WVM A;  5LRJ A;  4C8C A;  4X8I A;  1ZG9 A;  2FVG A;  4DJL A;  3FED A;  2PJ4 A;  4YWY A;  2PJB A;  2BOA A;  4FUU A;  4TWE A;  4ZX8 A;  3EIF A;  1DE4 C;  1AYE A;  4MHY A;  3SJG A;  1F57 A;  1LAN A;  2ZOG A;  1HEE A;  3IC1 A;  2PIZ A;  3KQZ A;  3S9L A;  2ZEM A;  4WWV A;  6CPA A;  4H2K A;  4TNU A;  4EWT A;  4MRI A;  5LRK A;  2PRQ A;  2JBK A;  3DGV A;  4O23 A;  4UEF A;  4P44 A;  2PJ1 A;  4C9R A;  4ONW A;  1BAV A;  4OKO A;  3D4U A;  2PJ3 A;  2PJ9 A;  3KL9 A;  1LCP A;  3FF3 A;  3H8G A;  2C1C A;  4NGT A;  5HXD A;  3IEH A;  4MCP A;  1R43 A;  2XEG A;  3CT9 A;  1LAP A;  2Q4Z A;  2DEA A;  2QYV A;  2PVV A;  3IO1 A;  4FAI A;  3RZA A;  3D66 A;  1DTD A;  1LOK A;  3H8F A;  4C8A A;  4MHZ A;  4P4J A;  4K3N A;  2ZED A;  3D7F A;  2IMO A;  3IWW A;  3D67 A;  1YW4 A;  2EK8 A;  4UEZ A;  2GU2 A;  3PB4 X;  4R6T A;  1H8L A;  3I6S A;  1BPN A;  1Y0R A;  1XFO A;  2RFH A;  4P10 A;  1ARM A;  1CP6 A;  3TX8 A;  1VHO A;  2NSM A;  4BD9 A;  5LYF A; 
#chains in the Genus database with same CATH topology
 3VTA A;  5J8C A;  1ZYM A;  4JWP A;  1TF8 A;  2PJA A;  4ONU A;  5HH1 A;  5AGE A;  4MHP A;  3R95 A;  2DXQ A;  5THW A;  5AG4 A;  1VGY A;  2PCU A;  5F48 A;  2R98 A;  1EZB A;  4OC4 A;  3WAB A;  3SXO A;  1BXR B;  3TOA A;  2B4B A;  3OB1 B;  3NH5 A;  4KZT A;  4RN7 A;  2CIJ A;  1MJ9 A;  3NA6 A;  4YU9 A;  1S7K A;  2DIK A;  4MHN A;  1XOV A;  4KS9 A;  3PRT A;  4Z65 A;  4OC0 A;  3RBU A;  2CF4 A;  1HDU A;  3W6S A;  5F49 A;  1KUY A;  3ISX A;  1ZG8 A;  1KC7 A;  1V0C A;  1M4D A;  4QUS A;  4PSW A;  3BUN B;  1S5K A;  3TLZ A;  3PFE A;  4OID A;  4RI1 A;  3BHX A;  4UEE A;  4CPA A;  2REE A;  4UWI A;  1PYT B;  2ZEF A;  4CGP A;  1ZRS A;  3ICU A;  2P6E A;  2WZN A;  1CJW A;  4GXH A;  4FD4 A;  4P4I A;  1JDB C;  1J4J A;  1ZLI A;  4INJ A;  1T36 B;  4P4D A;  3KR4 A;  3K9U A;  3GJZ A;  3EZE A;  4P45 A;  1BPM A;  2YNC C;  3ZJ0 A;  3FNC A;  1Z2L A;  4FWU A;  1GYT A;  2Q04 A;  3PB9 X;  3KRV A;  4M8D A;  5CPA A;  1U6M A;  2YNE A;  4A94 A;  5CBM A;  1QQ9 A;  2V8G A;  4B11 A;  2FSR A;  3CDX A;  4R7M A;  4CRY B;  4MCQ A;  1YK3 A;  4MCR A;  3TLA A;  2PJ7 A;  4UFW A;  2GLF A;  1OBR A;  2VI7 A;  2Z0Z A;  1S60 A;  4DNC A;  2KCW A;  4LX9 A;  3SI0 A;  1F2P A;  2PJ5 A;  4BIN A;  4C8P A;  4OME A;  1IGB A;  3I9S A;  4CAE A;  1Z8X A;  3B7I A;  3VAR A;  5IV0 A;  4UCN A;  2CNM A;  4IK2 A;  4ZY1 A;  2Q51 A;  5HKW A;  5GCN A;  4JXQ A;  1I21 A;  1K4J A;  5AG6 A;  2I79 A;  1ON0 A;  2AE6 A;  4F0X A;  5F9M A;  2BO9 A;  7CPA A;  4B10 A;  2O28 A;  1XMB A;  2FIW A;  4R8F A;  4UIA A;  5FVJ A;  5G22 A;  4CAV A;  1VHE A;  2B4J C;  3VRQ A;  2P6G A;  3E0K A;  3H8E A;  3K4I A;  4R57 A;  3VAT A;  4B13 A;  1S7N A;  3N7Z A;  1S3Z A;  4M6H A;  4XPK A;  1WK4 A;  3FXT A;  2Y1N A;  4YRH A;  2B5G A;  4C8T A;  2PVW A;  3W6X A;  4JLY A;  4XPD C;  3D7G A;  2JEV A;  1R3N A;  3D7D A;  2IL4 A;  3IU2 A;  4A38 A;  1Z9E A;  4AVC A;  4ZBG A;  2H5M A;  3S9N A;  1S7F A;  3KHX A;  3FJU A;  3KI9 A;  3TO6 A;  4EFD A;  5HKY A;  3G23 A;  2HRO A;  3EC4 A;  3G3S A;  4KUB A;  2CXA A;  1M4L A;  3I74 A;  2Q7S A;  4CO9 A;  1Y9Z A;  4CGO A;  1R61 A;  1YVH A;  4MMO A;  2I3C A;  2V8V A;  4M3S A;  3W91 A;  1NE9 A;  1XRY A;  4FD5 A;  4X3R A;  2C6P A;  3TFY A;  2ZW5 A;  3NE8 A;  4A2Z A;  4KOW A;  1ZG7 A;  5JQ4 A;  2V8D A;  1XIX A;  2PCN A;  4Q7A A;  4R76 A;  1IYK A;  1YLE A;  3SI2 A;  1MJB A;  4OC2 A;  2C6G A;  4LUA A;  2GFQ A;  3JUW A;  2ZEL A;  1YVK A;  3HUV A;  4PXB A;  4YFJ A;  3TO9 A;  4NJQ A;  5LRG A;  4MFJ A;  4AVA A;  4R3K A;  2F7V A;  2ZEN A;  5HVH A;  3FEC A;  3B3W A;  1YSJ A;  3KGQ A;  4MFQ A;  3S6F A;  3CPA A;  4F9U A;  3OWC A;  4CAW A;  5IX3 A;  2MP0 A;  3R1K A;  4F8Z A;  4Q36 A;  3EZB A;  3QAH A;  4NGP A;  2Q0Y A;  5J8F A;  2EVN A;  3GLJ A;  4PQA A;  1KZF A;  3RNZ A;  3WC7 A;  3IIB A;  3VRP A;  3PBB A;  2HB6 A;  3TC8 A;  2BEI A;  1VKC A;  3VGO A;  4B5P A;  3SJX A;  2AFX A;  2CNT A;  2PRB A;  2DPT A;  2Z3O A;  1EZA A;  3WR7 A;  2OOT A;  2CNS A;  4J3G A;  2XEF A;  2BCO A;  4DUK A;  1TF9 A;  1Z5R A;  4KSI A;  4JZ0 A;  1ZO0 A;  2AUN A;  3HMJ G;  4B14 A;  3F9K C;  1A9X B;  2POK A;  3TO7 A;  2EZC A;  1Q7L A;  4AXV A;  3N5F A;  1Z4R A;  5JYB A;  1Z8L A;  3VWE A;  1KBL A;  1TIQ A;  3T90 A;  1IIC A;  1IU8 A;  1QSR A;  4K30 A;  3NH8 A;  3K2K A;  2QJ8 A;  3IFE A;  3B8G A;  3CZX A;  5LYI A;  5G21 A;  3GB0 A;  1VI4 A;  1KUX A;  2XPN A;  2IQ6 A;  3MN8 A;  3TLY A;  3ZNI A;  1Y9K A;  4C85 A;  1GHE A;  5IR2 A;  2DPS A;  1Y7E A;  1PCA A;  4OLL A;  3SJE A;  5AG5 A;  5FD8 A;  5HVF A;  2GRE A;  2CTC A;  4NEX A;  1CBX A;  4COB A;  2PJ0 A;  4PXC A;  3O8Z A;  2CY2 A;  1VBG A;  1F2O A;  2YND A;  3FMC A;  3KZW A;  4UIB A;  3LAC A;  3BUW B;  3EO4 A;  4XNH B;  1J3L A;  2VXK A;  4A33 A;  3CXP A;  1VBH A;  1FT7 A;  2B4D B;  4FD6 A;  4W9Y A;  4TJX A;  4KOX A;  4B5P B;  4CGL A;  2FE7 A;  4L8A A;  3ISZ A;  3D8P A;  1BOB A;  3P2F A;  3GY9 A;  4C9A A;  3FIX A;  3C8O A;  4A30 A;  2AFU A;  2AFO A;  4A37 A;  1QSM A;  4OAD A;  2HQY A;  4BPW B;  5J1Q A;  2X0S A;  4PSX A;  2PQ8 A;  2VBQ A;  2NMT A;  1Z4E A;  2BSW A;  1ELM P;  1M4G A;  2PIY A;  1B6B A;  1IB1 E;  2O4H A;  4M6I A;  3S6H A;  1DIK A;  2FM4 A;  3RYO A;  2WPX A;  3KAS A;  3JRU A;  1Y9W A;  4CYO A;  4C86 A;  4CS0 B;  2J8M A;  3PP9 A;  2ZEG A;  3P2H A;  4QB9 A;  3KQX A;  4PV6 A;  2ZXV A;  1ZL0 A;  1XJO A;  1ZLH A;  2FIA A;  2NYQ A;  2OB0 A;  3D2M A;  2XEI A;  2G3A A;  5G20 A;  3OP0 A;  1X12 A;  2Z3M A;  2EWB A;  1L0C A;  2FXF A;  4M85 A;  3R96 A;  4RUH A;  4U5Y A;  3BLN A;  3BUO B;  3PEI A;  4C8U A;  3I1U A;  3D68 A;  4YGO A;  1P4N A;  2RB7 A;  1C3O B;  2OLS A;  4F6A A;  3BXM A;  3SI1 A;  1KUV A;  4IAV A;  1IOI A;  2VZZ A;  2Q4Y A;  3PFO A;  4JD6 A;  2D0O A;  3H8F A;  3NH4 A;  2WYR A;  1Q2C A;  2R1I A;  3RO0 A;  5HVG A;  2G0B A;  1UWY A;  1A2Z A;  3S6G A;  5JPH A;  3IU1 A;  5K8N A;  4E94 A;  4R9M A;  3R9E A;  4X2T A;  3TTH A;  5F13 A;  1X10 A;  2ANP A;  4OP4 A;  4ORF A;  2AFS A;  4BPU B;  2HUZ A;  2Z3L A;  3R9F A;  2HWG A;  2D4P A;  2AFW A;  2EZA A;  3TCV A;  2VEZ A;  3BI1 A;  4H6U A;  3B3S A;  2Q7B A;  3TT2 A;  5AG7 A;  3PT1 A;  1LFW A;  2OR4 A;  2O53 A;  2YNC A;  5DWN A;  4E5S A;  5C88 A;  4P4F A;  4KLV A;  2C5Q A;  3IGR A;  3UY5 A;  4KUA A;  4COG A;  2IJZ A;  4C84 A;  3IJ3 A;  3TOB A;  1CPS A;  1EO0 A;  4TJV A;  2VKZ G;  3V38 A;  4KSF A;  5JGF A;  5EBV A;  1YRE A;  2PC1 A;  3JVN A;  4M6G A;  3FH4 A;  2BUE A;  4QBJ A;  5KTC A;  4AVB A;  1YQE A;  4KOU A;  4FBE A;  5K8P A;  3VRR A;  3KHZ A;  1XF8 A;  2Q4V A;  4JXR A;  1LAM A;  4AG9 A;  4CGM A;  3U1B A;  2ZEE A;  2OZG A;  1M44 A;  3MRU A;  3SHP A;  2HI6 A;  4NGR A;  2PJC A;  3B35 A;  5JVL A;  4KOY A;  1GGO A;  2JDD A;  4F9V A;  1YLO A;  4ZI6 A;  3T5M A;  3HPG G;  1EE3 P;  4OIW A;  4C9V A;  4IHM A;  3FYN A;  3B3C A;  1YR0 A;  4QVT A;  4CYQ A;  3NOJ A;  3LMS A;  1NSA A;  4Q38 A;  3FB3 A;  2OZU A;  4IIY A;  3EZA A;  2PE3 A;  2ZEO A;  3WT4 A;  3EY5 A;  2ZEP A;  1IY7 A;  1CG2 A;  3B3V A;  4ZY2 A;  3T8W A;  4CAX A;  4C8F A;  3WC5 A;  2D0P A;  1CPX A;  2ABZ A;  2B0A A;  5DWM A;  1QST A;  1CP7 A;  4HNW B;  4I49 A;  4PXE A;  3T9Y A;  4CRZ B;  3PB6 X;  1V6C A;  1TKJ A;  5J3X A;  4EVY A;  4H89 A;  4KOS A;  3B3T A;  2OU2 A;  4KSA A;  4NCZ A;  5JM6 A;  3T0T A;  1CE8 B;  4MI4 A;  2K5T A;  3NFQ A;  1NXJ A;  2OH1 A;  2AFZ A;  4LQG A;  1IID A;  8CPA A;  4A32 A;  4H1H A;  4XNH C;  1Y0Y A;  1CM0 A;  5A27 A;  1LRZ A;  2B5G B;  2PJ8 A;  2J8N A;  2GIV A;  3GUX A;  3BUM B;  3HLP A;  3PB8 X;  1FNO A;  1S7L A;  2YJV A;  2DF5 A;  3S6K A;  3FRM A;  3V7Z A;  3WC6 A;  2P0W A;  5KTD A;  2J9A A;  4NFR A;  4MFZ A;  4AG7 A;  4OC3 A;  1Q2D A;  4HPS A;  1BLL E;  5K8M A;  4NGQ A;  3TLC A;  3BUX B;  4GM5 A;  4C99 A;  2XEJ A;  4UBR A;  3FEE A;  4NGM A;  1XEB A;  1RXT A;  3FVL A;  4RR2 B;  1ELL P;  4C9E A;  3QB8 A;  2F8H A;  3TLG A;  4A4B A;  3F5B A;  2PR1 A;  1QMU A;  3PB7 X;  3FX6 A;  2C27 A;  4LQ6 A;  1RTQ A;  2OZH A;  1IYL A;  3G8W A;  4MJ8 A;  2CTB A;  5H84 A;  4C68 A;  3SXN A;  2N3A B;  4C2Y A;  3QNV A;  4ZX9 A;  5A28 A;  1P0H A;  4P4E A;  1IOF A;  3DR8 A;  2Z3P A;  5EC4 A;  1AMP A;  1TKH A;  4NGN A;  3L2N A;  1Q5X A;  3HPH E;  1I12 A;  5K8O A;  4Y49 B;  1I1D A;  3B2Y A;  4U9Y A;  3DR6 A;  1M4I A;  4PPZ A;  4UF4 A;  3DSB A;  1NSL A;  2ZW4 A;  2AFM A;  3BI0 A;  2QVP A;  4XPL A;  4FD7 A;  4CGN A;  3V8I A;  5I0C A;  1KWM A;  5G1Z A;  3ZZI A;  5F09 A;  4GS4 A;  4YN3 A;  2G9D A;  2Z11 A;  5D8N A;  5EMI A;  2AUM A;  2WPW A;  2V77 A;  4B6Z A;  2PJ2 A;  2HV2 A;  4PXD A;  3PLF B;  4MCS A;  4CDK A;  5AXI A;  4CDJ A;  1FBV A;  1VIX A;  1NMT A;  2RC4 A;  5LYD A;  3TLG B;  1JQG A;  2Z10 A;  4WJB A;  4NF1 A;  3MGD A;  2VZY A;  4C9U A;  2PDO A;  2R82 A;  2F5I A;  3OAK A;  2GLJ A;  1XBU A;  3CPX A;  2HC9 A;  4MBU A;  5JH9 A;  4GPL B;  4EME A;  5LYL A;  1XF1 A;  2PSW A;  4CYN A;  4IIX A;  4E0A A;  2Q44 A;  4E2A A;  1HDQ A;  4B12 A;  3LWU A;  4R3L A;  1YME A;  2UV8 G;  2G3T A;  2EBJ A;  3BJ7 A;  3DLJ A;  3GIU A;  2PJ6 A;  4UFV A;  3EXN A;  5F47 A;  4A39 A;  1YX0 A;  3H5Z A;  3PBE A;  5HKZ A;  4KOV A;  4MXU A;  3S9M A;  3K9T A;  4II9 A;  2ZOF A;  5K99 A;  4PK3 A;  5D29 A;  4IUS A;  4P4B A;  2PR8 A;  3EFA A;  2YGW A;  3RAM A;  4A95 A;  4C2Z A;  1Y7R A;  5IB9 A;  3PFV A;  4BMH A;  4ZY0 A;  1YW6 A;  3R9G A;  4NJR A;  2A4N A;  5ELY A;  2ZEH A;  3LOD A;  4MFL A;  4L89 A;  4ZYQ A;  4OC5 A;  3F8K A;  4MY0 A;  2ZPA A;  1C30 B;  4J0N A;  4KOR A;  1SQH A;  4NGS A;  1WWZ A;  1ARL A;  2Z3N A;  2XPO A;  4UCM A;  4F0Y A;  4HNY B;  3FBU A;  4DYO A;  4KNG E;  3SR3 A;  4BBH A;  3LD2 A;  2R8V A;  2VL1 A;  3PZJ A;  3JTK A;  4KVM E;  4C2X A;  1BO4 A;  5I4M A;  2BL1 A;  1M1D A;  4JYW A;  2DLA A;  3KR5 A;  4P6Y A;  3VH9 A;  1TKF A;  1TXR A;  3NFZ A;  2JBJ A;  1XE4 A;  2ODF A;  2B3U A;  4NXY A;  4MJX A;  2Y0M A;  3DDD A;  5DS0 A;  3VRN A;  2JEW A;  2X7B A;  4OC1 A;  4MFP A;  3D7H A;  2EZB A;  4G1P A;  2C6C A;  1CX8 A;  3SJF A;  3PGP A;  4UA3 A;  2GAN A;  2QML A;  2V8H A;  5BY0 A;  2EK9 A;  2Q43 A;  2EUI A;  1MJA A;  1WVM A;  5LRJ A;  2XPP A;  4HKF A;  4X8I A;  1ZG9 A;  1NBW A;  4C8C A;  2FVG A;  4R87 A;  4DJL A;  3FED A;  1MK4 A;  2AJ6 A;  2PJ4 A;  2PJB A;  4X5K A;  4YWY A;  5F46 A;  2BOA A;  4FUU A;  4KOT A;  4E8O A;  4MI1 A;  4TWE A;  4AB7 A;  3D3S A;  4B5O A;  3DNS A;  4UCP A;  3TLE A;  1Z8T A;  5H86 A;  1RO5 A;  1PU9 A;  2FS5 A;  4PK2 A;  4ZX8 A;  3EIF A;  1DE4 C;  2WSA A;  5C82 A;  3A9L A;  1AYE A;  4CZ1 A;  4MHY A;  4UWJ A;  3SJG A;  1F57 A;  1LAN A;  2ZOG A;  1N71 A;  2D4O A;  3IWG A;  1QSO A;  3QAY A;  4IF5 A;  1HEE A;  4MY3 A;  1XMT A;  3IC1 A;  2PIZ A;  3KQZ A;  5IB0 A;  1Z9U A;  3S9L A;  5F5X A;  3CXQ A;  2ZEM A;  3GYA A;  4WWV A;  2FL4 A;  5BWA B;  4CYP A;  6CPA A;  3KKW A;  4H2K A;  4TNU A;  5F1Y A;  4EWT A;  2E28 A;  1Z8W A;  4MRI A;  1VHS A;  4C7I A;  4BTF A;  3GKR A;  5LRK A;  2Y1M A;  2PRQ A;  5E96 A;  1JDE A;  5KTA A;  2JBK A;  2QEC A;  3BJ8 A;  3DGV A;  3I3G A;  4KLW A;  4O23 A;  4UEF A;  4P44 A;  3C26 A;  4Y49 C;  1KEE B;  4BPX B;  4KVX A;  4QC6 A;  4KVO E;  2JLM A;  1FY7 A;  3TLB A;  2PJ1 A;  4C9R A;  4ONW A;  1BAV A;  4MFK A;  3D4U A;  1YGH A;  2PJ3 A;  4OKO A;  2PJ9 A;  3F0A A;  4RS2 A;  3KL9 A;  4NSQ A;  1LCP A;  3FF3 A;  3VWD A;  3CXS A;  3H8G A;  2C1C A;  4NGT A;  5HXD A;  2VQY A;  1AUG A;  1JWQ A;  5CNP A;  4A31 A;  3IEH A;  4MCP A;  1R43 A;  2XEG A;  3CT9 A;  1LAP A;  2Q4Z A;  2DEA A;  2QYV A;  2EO8 A;  2PVV A;  3VRO A;  3IO1 A;  4HNX B;  4OAE A;  4H6Z A;  4FAI A;  1UFH A;  4A4C A;  3RZA A;  4UFX A;  3D66 A;  3T07 A;  1DTD A;  1LOK A;  1PUA A;  2GP4 A;  1OZP A;  2B4D A;  2CBL A;  2QIR A;  1QSN A;  1YVO A;  1B87 A;  2R7H A;  2B58 A;  2ZW6 A;  3D2P A;  4MHZ A;  3TYX A;  4C8A A;  4XPD B;  2REF A;  2XPL A;  4P4J A;  3IWE A;  4K3N A;  2J8R A;  2ZED A;  3NE7 A;  2ARH A;  3D7F A;  5HMN A;  1CS0 B;  2IMO A;  3IWW A;  2P6F A;  2ZW7 A;  2B3V A;  3D67 A;  1Q2Y A;  1YW4 A;  4EYS A;  2EK8 A;  4UEZ A;  2GU2 A;  3PB4 X;  4JJX A;  5ISV A;  1M6V B;  1WJT A;  3TE4 A;  4R6T A;  1R57 A;  4U9Z A;  1B47 A;  1H8L A;  4MHD A;  4JVO A;  3OB2 B;  2FCK A;  3U88 C;  3I6S A;  1BPN A;  1Y0R A;  1XFO A;  2JDC A;  2RFH A;  2GE3 A;  3H4Q A;  4P10 A;  2ATR A;  1ARM A;  1CP6 A;  3TX8 A;  4C7H A;  1VHO A;  2NSM A;  2I00 A;  4BD9 A;  4ZGY B;  2YJT A;  5LYF A;  4CAF A;  2Z3K A;  2FT0 A;  3T05 A;  2WUU A; 
#chains in the Genus database with same CATH homology
 3VTA A;  1TF8 A;  2PJA A;  4MHP A;  5THW A;  1VGY A;  2PCU A;  4OC4 A;  3WAB A;  3NH5 A;  4YU9 A;  2CIJ A;  3NA6 A;  4MHN A;  3PRT A;  4Z65 A;  4OC0 A;  3RBU A;  2CF4 A;  1HDU A;  3ISX A;  1ZG8 A;  3PFE A;  4OID A;  4CPA A;  3BHX A;  4UEE A;  1PYT B;  2ZEF A;  3ICU A;  2WZN A;  4P4I A;  1ZLI A;  4P4D A;  3KR4 A;  4P45 A;  1BPM A;  1Z2L A;  4FWU A;  1GYT A;  3PB9 X;  5CPA A;  4A94 A;  5CBM A;  1QQ9 A;  2V8G A;  3CDX A;  4R7M A;  4MCQ A;  4MCR A;  2PJ7 A;  2GLF A;  1OBR A;  3SI0 A;  1F2P A;  2PJ5 A;  4C8P A;  4OME A;  1IGB A;  3B7I A;  3VAR A;  4IK2 A;  4ZY1 A;  2Q51 A;  2BO9 A;  7CPA A;  1XMB A;  4R8F A;  4UIA A;  1VHE A;  3H8E A;  3VAT A;  4C8T A;  2PVW A;  3D7G A;  4A38 A;  1R3N A;  3D7D A;  3S9N A;  3KHX A;  3FJU A;  3KI9 A;  4EFD A;  3I74 A;  1M4L A;  1Y9Z A;  4MMO A;  2I3C A;  2V8V A;  1XRY A;  4X3R A;  2C6P A;  1ZG7 A;  2V8D A;  4Q7A A;  4R76 A;  3SI2 A;  4OC2 A;  2C6G A;  2ZEL A;  3HUV A;  4PXB A;  4NJQ A;  5LRG A;  2F7V A;  2ZEN A;  5HVH A;  3FEC A;  3B3W A;  1YSJ A;  3KGQ A;  3CPA A;  4F9U A;  4F8Z A;  4NGP A;  3GLJ A;  4PQA A;  3WC7 A;  3IIB A;  3PBB A;  3TC8 A;  2HB6 A;  3SJX A;  2AFX A;  2OOT A;  2XEF A;  2BCO A;  4DUK A;  1TF9 A;  1Z5R A;  4KSI A;  4JZ0 A;  2POK A;  1Q7L A;  4AXV A;  3N5F A;  1Z8L A;  3NH8 A;  3K2K A;  3IFE A;  2QJ8 A;  5LYI A;  3GB0 A;  2IQ6 A;  3MN8 A;  4C85 A;  5IR2 A;  1Y7E A;  1PCA A;  3SJE A;  5HVF A;  2GRE A;  2CTC A;  1CBX A;  2PJ0 A;  4PXC A;  1F2O A;  3FMC A;  3KZW A;  4UIB A;  4TJX A;  1FT7 A;  4W9Y A;  3ISZ A;  4C9A A;  2AFU A;  2AFO A;  4A37 A;  5J1Q A;  1ELM P;  2PIY A;  2O4H A;  3JRU A;  3KAS A;  4C86 A;  2ZEG A;  3KQX A;  1XJO A;  1ZLH A;  2NYQ A;  2XEI A;  2EWB A;  4RUH A;  4C8U A;  3PEI A;  3I1U A;  3D68 A;  2RB7 A;  3BXM A;  3SI1 A;  4IAV A;  3PFO A;  3NH4 A;  2WYR A;  5HVG A;  1UWY A;  5K8N A;  4X2T A;  2ANP A;  4OP4 A;  2AFS A;  2AFW A;  3BI1 A;  3B3S A;  1LFW A;  2OR4 A;  2O53 A;  4P4F A;  2C5Q A;  2IJZ A;  4C84 A;  3IJ3 A;  1CPS A;  4TJV A;  3V38 A;  5JGF A;  3FH4 A;  5K8P A;  4FBE A;  3KHZ A;  1LAM A;  2ZEE A;  3MRU A;  4NGR A;  2PJC A;  3B35 A;  4F9V A;  1YLO A;  4ZI6 A;  1EE3 P;  4OIW A;  4C9V A;  4IHM A;  3B3C A;  3LMS A;  1NSA A;  2PE3 A;  2ZEO A;  3WT4 A;  2ZEP A;  1IY7 A;  1CG2 A;  3B3V A;  4ZY2 A;  3T8W A;  4C8F A;  3WC5 A;  1CPX A;  2ABZ A;  1CP7 A;  4PXE A;  1V6C A;  3PB6 X;  1TKJ A;  3B3T A;  5JM6 A;  2AFZ A;  4LQG A;  8CPA A;  1Y0Y A;  2PJ8 A;  3GUX A;  3PB8 X;  3HLP A;  1FNO A;  3V7Z A;  3WC6 A;  2J9A A;  4NFR A;  4OC3 A;  5K8M A;  1BLL E;  4NGQ A;  4GM5 A;  4C99 A;  2XEJ A;  3FEE A;  4NGM A;  3FVL A;  1ELL P;  4C9E A;  2F8H A;  1QMU A;  3PB7 X;  3FX6 A;  1RTQ A;  2CTB A;  3QNV A;  4ZX9 A;  4P4E A;  1AMP A;  1TKH A;  4NGN A;  3L2N A;  5K8O A;  3B2Y A;  4UF4 A;  4PPZ A;  2AFM A;  3BI0 A;  2QVP A;  1KWM A;  5F09 A;  4YN3 A;  2G9D A;  5D8N A;  2V77 A;  4B6Z A;  2PJ2 A;  4PXD A;  4MCS A;  4CDK A;  4CDJ A;  1VIX A;  5LYD A;  1JQG A;  4WJB A;  4C9U A;  2GLJ A;  1XBU A;  3CPX A;  2HC9 A;  5JH9 A;  4EME A;  5LYL A;  1XF1 A;  1HDQ A;  3LWU A;  1YME A;  3DLJ A;  2PJ6 A;  4A39 A;  3PBE A;  4MXU A;  3S9M A;  3K9T A;  2ZOF A;  5D29 A;  4P4B A;  3RAM A;  5IB9 A;  4ZY0 A;  1YW6 A;  4NJR A;  5ELY A;  2ZEH A;  4ZYQ A;  4OC5 A;  4NGS A;  1ARL A;  4KNG E;  4DYO A;  2VL1 A;  5I4M A;  4JYW A;  3KR5 A;  4P6Y A;  3VH9 A;  1TKF A;  1TXR A;  3NFZ A;  2JBJ A;  5DS0 A;  2JEW A;  4OC1 A;  3D7H A;  4G1P A;  2C6C A;  1CX8 A;  3SJF A;  2V8H A;  2EK9 A;  2Q43 A;  1WVM A;  5LRJ A;  4C8C A;  4X8I A;  1ZG9 A;  2FVG A;  4DJL A;  3FED A;  2PJ4 A;  4YWY A;  2PJB A;  2BOA A;  4FUU A;  4TWE A;  4ZX8 A;  3EIF A;  1DE4 C;  1AYE A;  4MHY A;  3SJG A;  1F57 A;  1LAN A;  2ZOG A;  1HEE A;  3IC1 A;  2PIZ A;  3KQZ A;  3S9L A;  2ZEM A;  4WWV A;  6CPA A;  4H2K A;  4TNU A;  4EWT A;  4MRI A;  5LRK A;  2PRQ A;  2JBK A;  3DGV A;  4O23 A;  4UEF A;  4P44 A;  2PJ1 A;  4C9R A;  4ONW A;  1BAV A;  4OKO A;  3D4U A;  2PJ3 A;  2PJ9 A;  3KL9 A;  1LCP A;  3FF3 A;  3H8G A;  2C1C A;  4NGT A;  5HXD A;  3IEH A;  4MCP A;  1R43 A;  2XEG A;  3CT9 A;  1LAP A;  2Q4Z A;  2DEA A;  2QYV A;  2PVV A;  3IO1 A;  4FAI A;  3RZA A;  3D66 A;  1DTD A;  1LOK A;  2GP4 A;  3H8F A;  4C8A A;  4MHZ A;  4P4J A;  4K3N A;  2ZED A;  3D7F A;  2IMO A;  3IWW A;  3D67 A;  1YW4 A;  2EK8 A;  4UEZ A;  2GU2 A;  3PB4 X;  4R6T A;  1H8L A;  3I6S A;  1BPN A;  1Y0R A;  1XFO A;  2RFH A;  4P10 A;  1ARM A;  1CP6 A;  3TX8 A;  1VHO A;  2NSM A;  4BD9 A;  5LYF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...