4P4JA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33d
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
686
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
total genus 263
structure length 686
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4jA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4jA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4jA02
3SI0A 2O53A 4P4DA 1YSJA 3K9TA 5K8NA 1ELLP 2WYRA 2ZEEA 3BI1A 4JZ0A 1H8LA 1CP6A 5LYLA 4R8FA 5K8PA 3SI2A 1KWMA 2QYVA 2AFZA 3NH8A 3KGQA 3D7DA 2PVVA 1Z2LA 2AFMA 2PJ5A 3I74A 1F2PA 4R6TA 2ZEPA 3GLJA 3H8EA 3FX6A 5D8NA 3MRUA 2BO9A 3V38A 3D68A 2CF4A 2GREA 1TF8A 4BD9A 3PRTA 4NGTA 3WC6A 4PXEA 5ELYA 4NFRA 1XJOA 2HC9A 2V8HA 5LRKA 3IEHA 2POKA 1LAPA 5LYDA 5LYIA 1BAVA 1OBRA 4C85A 4MMOA 1Y0RA 2ZEDA 3HUVA 4C9UA 2ABZA 4UIBA 1PCAA 4TWEA 2ZELA 4C99A 1YW6A 4GM5A 1ZLIA 5JGFA 5F09A 4AXVA 4F8ZA 1ZG7A 3PB8X 4PPZA 2PJ8A 5THWA 4MCQA 3IIBA 3SI1A 1TKHA 1F2OA 3B3CA 3KHZA 3WC7A 2OOTA 1IY7A 5HVGA 4IAVA 2PJ3A 4OIWA 2ZOGA 4DUKA 4PXBA 4A38A 4OMEA 1LOKA 4W9YA 3B3TA 2JBJA 3BI0A 3S9LA 1WVMA 4UEEA 1JQGA 1R3NA 2ZENA 3I1UA 2NSMA 3NH4A 4MCRA 8CPAA 1ZG8A 5HXDA 1DTDA 2ZEFA 5DS0A 4YU9A 3PBBA 2PRQA 4K3NA 3KQXA 4EFDA 3FEDA 4X8IA 2XEIA 1BPNA 3CPXA 4ONWA 4R7MA 2AFSA 4MXUA 4C8TA 2QJ8A 3DGVA 2PJ7A 3IWWA 3VATA 1PYTB 3GUXA 3IO1A 1LCPA 1LAMA 2PJAA 1TXRA 3PB4X 3LWUA 4C9AA 4C9VA 4MRIA 4FUUA 4UIAA 4RUHA 2AFOA 3D67A 2V8VA 1TF9A 4NGQA 1VGYA 3D66A 5K8MA 4F9VA 3ISXA 1CPSA 1YLOA 2ANPA 3B3WA 2PIZA 3VTAA 4YN3A 2PJ0A 3SJXA 1Y7EA 4WWVA 4ZY0A 4C8CA 3S9MA 2PJ9A 1XFOA 1HDUA 3KASA 3L2NA 1Z8LA 3VH9A 4Z65A 3CDXA 1F57A 4P4EA 2ZOFA 4FBEA 1AYEA 3KZWA 4CDJA 4P45A 2GLFA 4NGSA 2PCUA 2RFHA 5K8OA 3PB7X 1CG2A 4TNUA 1CX8A 4ZI6A 4NGRA 2C6GA 3I6SA 1ELMP 4PQAA 4KNGE 4NJRA 4OC2A 4C86A 3B3SA 2FVGA 4P4JA 2C1CA 5J1QA 3BXMA 2AFWA 3TC8A 1HEEA 3SJGA 3MN8A 3N5FA 1XMBA 1Y9ZA 3CT9A 2ZEHA 4KSIA 4A94A 1ARMA 4FWUA 4OIDA 4EMEA 3FH4A 3ICUA 3KR4A 4IHMA 4PXDA 3PB6X 2IQ6A 1CP7A 4C8UA 7CPAA 3WT4A 3WABA 3KQZA 4X2TA 3KI9A 3PEIA 2V77A 4CDKA 4P4BA 2XEJA 1VHOA 2F8HA 4DYOA 1NSAA 3PB9X 3IC1A 2BOAA 4JYWA 4MHYA 6CPAA 3ISZA 1DE4C 1CBXA 4P4FA 1XBUA 2HB6A 3PBEA 3B3VA 1Q7LA 2IMOA 3FECA 3FF3A 4ZX8A 4ZYQA 3KHXA 4UF4A 1YW4A 2OR4A 3BHXA 2XEFA 3IFEA 4OKOA 2CIJA 1V6CA 1TKFA 2XEGA 1AMPA 4C9RA 2RB7A 4PXCA 1RTQA 2EK9A 4IK2A 3WC5A 2F7VA 3T8WA 1FNOA 2AFUA 1EE3P 2JEWA 2PJCA 2BCOA 3FMCA 4NGNA 4OC4A 2Q4ZA 4OC0A 3SJFA 3RZAA 5CBMA 3H8FA 4NJQA 3FJUA 1VHEA 4MHZA 4Q7AA 2AFXA 1BPMA 2IJZA 5JM6A 2V8GA 4MHNA 4MHPA 4P44A 4OC5A 5JH9A 2QVPA 2GLJA 3NH5A 3FEEA 3EIFA 3B35A 1TKJA 2O4HA 2Q51A 2PJ2A 2PJBA 1Z5RA 1QQ9A 5HVFA 2V8DA 2Q43A 3TX8A 2PE3A 4A39A 2PIYA 4ZY1A 2EK8A 3RAMA 1UWYA 3SJEA 1YMEA 3K2KA 3D7HA 4R76A 4DJLA 2JBKA 4EWTA 4P10A 4TJVA 1IGBA 4P6YA 4UEFA 3QNVA 2VL1A 1LANA 3D4UA 1ZG9A 3D7GA 5IB9A 4C9EA 2C6PA 4NGMA 4G1PA 3NFZA 4B6ZA 2C6CA 3VARA 1HDQA 2G9DA 2DEAA 4C8PA 1GYTA 3KL9A 4LQGA 3B2YA 2J9AA 1ARLA 2I3CA 3B7IA 3H8GA 2CTCA 2PJ4A 4NGPA 1LFWA 3DLJA 4WJBA 1ZLHA 4TJXA 4C8AA 4P4IA 1VIXA 4X3RA 4UEZA 2PJ1A 4CPAA 5LRGA 3S9NA 3NA6A 4ZY2A 4OC1A 2PVWA 1XF1A 5D29A 2GU2A 1QMUA 3GB0A 4C84A 1BLLE 3IJ3A 1FT7A 4YWYA 4OC3A 3LMSA 3PFOA 3PFEA 2ZEMA 5I4MA 1CPXA 2ZEGA 1M4LA 5LYFA 1Y0YA 2EWBA 1XRYA 3HLPA 3KR5A 4MCSA 4O23A 4A37A 5LRJA 3CPAA 3V7ZA 4F9UA 5HVHA 4H2KA 4MCPA 2PJ6A 5CPAA 2ZEOA 3FVLA 4C8FA 2NYQA 4ZX9A 3JRUA 2WZNA 1R43A 4FAIA 3D7FA 3RBUA 2CTBA 4OP4A
chains in the Genus database with same CATH superfamily
1R61A 2PCNA 5JVLA 3SI0A 4M6HA 2O53A 1ON0A 1S7NA 2OZGA 4YFJA 4COGA 1B87A 2R98A 4P4DA 2DLAA 1YVHA 1YSJA 3K9TA 5K8NA 1ELLP 2WYRA 2ZEEA 5F49A 4HNXB 5G22A 3BI1A 2GANA 5HKWA 4JZ0A 1H8LA 2OLSA 1CP6A 3T07A 5LYLA 4R8FA 5K8PA 3T05A 3SI2A 2I79A 1KWMA 2QYVA 3GY9A 1CJWA 2AFZA 2J8NA 2Q4YA 1LRZA 1S3ZA 3NH8A 1Y7RA 3KGQA 4E94A 3D7DA 5HH1A 2Y1NA 3S6KA 4H6UA 2PVVA 2YNDA 4BPXB 2N3AB 1Z2LA 2AFMA 4II9A 2PJ5A 3F5BA 3I74A 1F2PA 4R6TA 4KVOE 4E2AA 3NFQA 1WJTA 2ZEPA 4COBA 3GLJA 3TLCA 2B5GA 2HQYA 3CXSA 2P6FA 2Y0MA 1Q2DA 1NBWA 3H8EA 3FX6A 5D8NA 3MRUA 2BO9A 1IYLA 3TYXA 4QBJA 2REEA 3V38A 3D68A 2CF4A 4CAEA 4DNCA 2VBQA 2GREA 2Z3LA 2ODFA 3F0AA 1TF8A 3IU1A 4AVBA 4BD9A 1QSNA 5HKYA 4FD4A 3PRTA 4NGTA 1KBLA 1X12A 1QSOA 3WC6A 4PXEA 5J8FA 5ELYA 4E8OA 4INJA 4NFRA 3EO4A 1XJOA 2DPSA 2HC9A 2V8HA 5LRKA 3IEHA 2Z11A 2P6EA 5CNPA 2POKA 3EC4A 5GCNA 2YNEA 2EZBA 3EZEA 3FNCA 1LAPA 4IIYA 3K9UA 5LYDA 5LYIA 1BAVA 1OBRA 4Q36A 2PDOA 1X10A 4C85A 5FD8A 3G8WA 4MMOA 1L0CA 1Y0RA 2ZEDA 3HUVA 1ZO0A 4Y49B 4C9UA 2ABZA 1MJAA 2Z3MA 4UWIA 3PZJA 2B5GB 2Z10A 4C7IA 3TE4A 3SR3A 4RS2A 4UIBA 1BXRB 1PCAA 4OADA 2FL4A 2ZELA 3QAYA 3U88C 1YW6A 4TWEA 2C5QA 4C99A 4GM5A 2JDDA 1ZLIA 4B5PB 1CE8B 2Y1MA 5JGFA 5F09A 2DF5A 4AXVA 4F8ZA 2PQ8A 1ZG7A 2WPWA 3IWGA 2ARHA 5IV0A 4RI1A 3PB8X 4PPZA 2PJ8A 5THWA 3TOAA 1KUXA 5G1ZA 4MCQA 3IIBA 3SI1A 1TKHA 1F2OA 2ZW6A 3CZXA 3DSBA 5F47A 4C2XA 5C88A 3B3CA 3KHZA 4Y49C 3WC7A 4I49A 4GPLB 1PUAA 2OOTA 1IY7A 5HVGA 4IAVA 5BWAB 1ZL0A 5JYBA 3N7ZA 4LX9A 2PJ3A 3T5MA 1TIQA 4OIWA 4QC6A 2ZOGA 2EZAA 4KOVA 4XPDC 4DUKA 4PXBA 4A38A 4OMEA 1LOKA 4QUSA 3G23A 1I21A 3TLGA 4W9YA 3B3TA 2JBJA 1PU9A 4NSQA 3R95A 4AB7A 3SXOA 3TT2A 3BI0A 3S9LA 3BJ7A 1WVMA 4UEEA 1JQGA 3DR6A 1R3NA 3OWCA 2ZENA 4K30A 2D4PA 3RO0A 3I1UA 2NSMA 4MFQA 2QMLA 3NH4A 4MCRA 1MJ9A 4E0AA 1XEBA 1ZG8A 5FVJA 4F0XA 5EBVA 8CPAA 1CS0B 2O28A 2P6GA 3A9LA 1M44A 2GE3A 5HXDA 2B0AA 1DTDA 2ZEFA 4HNWB 2VZZA 5DS0A 5IB0A 3NE7A 4H89A 4M85A 4YU9A 3PBBA 2PRQA 4K3NA 3KQXA 4UCPA 4EFDA 1GHEA 1V0CA 5ISVA 2J8MA 1Z4RA 3FEDA 2ZW7A 2XEIA 4X8IA 1BPNA 3CPXA 3W6SA 4ONWA 2PC1A 3PGPA 4BMHA 4R7MA 1GGOA 4XPDB 2AFSA 3FXTA 4MXUA 3TLZA 4C8TA 2QJ8A 2R7HA 5KTDA 3DGVA 2PJ7A 3IWWA 4KLVA 3VATA 1YLEA 4KLWA 3O8ZA 1PYTB 3HPGG 4RR2B 4JXRA 4MBUA 4R9MA 4B12A 4CAWA 3EZBA 4CS0B 3GUXA 3IO1A 4A31A 1LCPA 1LAMA 2PJAA 4U5YA 1TXRA 1Z8WA 3RNZA 3PB4X 3LWUA 5G21A 1ZYMA 4C9AA 1IICA 4MRIA 4C9VA 1P4NA 4C2ZA 3H5ZA 4FUUA 3I9SA 4UIAA 3VRQA 5AG4A 4RUHA 2AFOA 3D67A 3IU2A 2V8VA 4LQ6A 1TF9A 4NGQA 4JD6A 5I0CA 2YJTA 3JVNA 4L89A 4UWJA 1VGYA 3D66A 4YRHA 4PV6A 5K8MA 4F9VA 1KUYA 2ZPAA 4QB9A 3R9GA 3ISXA 1CPSA 1NMTA 4MFLA 5J8CA 1YLOA 2ANPA 2F5IA 3B3WA 1JWQA 2PIZA 2QIRA 3LODA 4C7HA 3ZZIA 4YN3A 3EZAA 3VTAA 2PJ0A 3SJXA 1Y7EA 4WWVA 3PFVA 4CRYB 4ZY0A 4C8CA 3S9MA 2PJ9A 3DNSA 1XFOA 1HDUA 3KASA 2QECA 4R3KA 4CAVA 2AUNA 3L2NA 1Z8LA 3VH9A 4Z65A 3CDXA 4A4CA 4PK2A 2Q7SA 1F57A 5F46A 4BINA 4P4EA 2ZOFA 1A2ZA 1AYEA 3KZWA 4FBEA 3QAHA 4CDJA 2ZW4A 3TO7A 4L8AA 4GXHA 1R57A 4P45A 2GLFA 4NGSA 2GFQA 2PCUA 3OP0A 2RFHA 3CXQA 2P0WA 1CG2A 3PB7X 5K8OA 4AG9A 2H5MA 5AG6A 3BUNB 4TNUA 1CX8A 2VZYA 4KOUA 4NGRA 4ZI6A 2C6GA 3I6SA 3D3SA 4CYNA 3D8PA 4X5KA 1M4IA 1ELMP 1M4GA 4PQAA 4CAFA 4KNGE 3KKWA 1RO5A 4KUAA 4NJRA 4OC2A 5K99A 4MY0A 1Z8XA 3PP9A 2FIWA 4C86A 4H6ZA 3B3SA 4BTFA 5F1YA 1NSLA 2OB0A 2VKZG 2FVGA 4PSWA 1VI4A 1Q2YA 3SXNA 1KC7A 5A27A 1S7FA 5EC4A 2G3AA 4UFVA 4P4JA 2C1CA 5J1QA 3R9FA 2E28A 1IYKA 1K4JA 4NXYA 4EVYA 3BXMA 4BPUB 3U1BA 2AFWA 4XNHC 3TC8A 1HEEA 2B4DB 4NCZA 3SJGA 2Z0ZA 3MN8A 3N5FA 1XMBA 3P2FA 1C3OB 2XPPA 1Y9ZA 3CT9A 4Q38A 2ZEHA 3VROA 1U6MA 4M6IA 5HKZA 2HWGA 4JVOA 4KSIA 4A94A 1ARMA 4FWUA 4OIDA 4EMEA 2VXKA 3FH4A 3P2HA 3ICUA 3NE8A 3KR4A 1Z9EA 4J3GA 4IHMA 1YGHA 3WR7A 4KZTA 3PB6X 4PSXA 4PXDA 1VBGA 2IQ6A 1CP7A 4C8UA 1EZBA 5DWNA 7CPAA 2Q0YA 5AG5A 3WABA 3WT4A 3IGRA 3KQZA 4A33A 4X2TA 3KI9A 3TLEA 3PEIA 1SQHA 2B4JC 3ZNIA 2V77A 4MI1A 4P4BA 3BUWB 1FBVA 2XEJA 3MGDA 1VHOA 1ZRSA 1WK4A 4XPKA 4FD7A 1B6BA 2XPLA 2YJVA 2F8HA 2JDCA 4A32A 4KORA 4DYOA 1NSAA 3PB9X 3IC1A 4CGMA 2BOAA 2FCKA 2HV2A 2REFA 2NMTA 5JQ4A 3PT1A 4JYWA 4MHYA 6CPAA 3ISZA 1DE4C 4B14A 2D0PA 1CBXA 4P4FA 1XBUA 2HB6A 3PBEA 4UBRA 3B3VA 3V8IA 2B58A 5AG7A 2R82A 3SHPA 5C82A 4UCMA 1YX0A 1Y9WA 4F6AA 1Q7LA 2IL4A 2IMOA 3EY5A 2EZCA 3TLAA 3FECA 3FF3A 2MP0A 2FE7A 4ZX8A 4ZYQA 3GKRA 1B47A 3C8OA 3KHXA 4LUAA 4YGOA 4CYQA 4QVTA 2C27A 4B13A 4UF4A 1YW4A 3HPHE 2OR4A 3BHXA 3BUXB 1IOIA 2G3TA 3GIUA 4KOSA 4XPLA 3TO9A 2XEFA 3R1KA 3IFEA 1S7LA 2DXQA 4M3SA 4OKOA 2CIJA 4C2YA 1OZPA 4IF5A 4KOTA 4KVXA 4CRZB 5F5XA 1V6CA 1FY7A 3RYOA 1TKFA 1T36B 5A28A 3K4IA 3S6HA 4U9ZA 2XEGA 1AMPA 2EVNA 3CXPA 2DPTA 3FIXA 4C9RA 4MHDA 2RB7A 1KEEB 4PXCA 5KTCA 1S7KA 1RTQA 1Z4EA 2EK9A 2JEVA 3LD2A 4IK2A 2FIAA 4NEXA 3WC5A 2F7VA 4HKFA 1YVOA 3T8WA 1FNOA 2AFUA 1UFHA 4A30A 4B5OA 2AJ6A 2XPOA 1EE3P 2JEWA 2PJCA 1Y9KA 2YNCA 5E96A 2R1IA 2BCOA 3FMCA 1A9XB 3EXNA 3OAKA 2CNSA 4JXQA 4NGNA 4JJXA 4OC4A 4CGNA 2Q4ZA 4OC0A 4CYOA 3T9YA 2UV8G 1IIDA 4CGPA 3BUOB 3SJFA 3RZAA 5CBMA 5KTAA 1XOVA 2HUZA 3H8FA 2K5TA 4NJQA 3TLBA 3FJUA 1VHEA 4E5SA 3C26A 3H4QA 3PLFB 4MHZA 4Q7AA 1N71A 1BPMA 2AFXA 2IJZA 2ZW5A 3B8GA 5JM6A 1EZAA 2V8GA 2Z3PA 3W91A 4MHNA 4MHPA 2B4BA 4UFXA 4KUBA 3FRMA 4P44A 4OC5A 5EMIA 3T0TA 1CM0A 5AXIA 2I00A 4XNHB 3OB1B 2FT0A 1RXTA 2QVPA 5G20A 5JH9A 2GLJA 3NH5A 3FEEA 3LACA 4CO9A 2PR8A 2AUMA 2OH1A 3B35A 3EIFA 1TKJA 2O4HA 2Q51A 2J8RA 2PJ2A 1Z5RA 1QQ9A 2PJBA 5HVFA 5IR2A 2V8DA 1VKCA 1MJBA 2Q43A 3TX8A 4C68A 5JPHA 2PE3A 4A39A 2Z3NA 2PIYA 1I12A 3BJ8A 4MI4A 3EFAA 4ZY1A 4ONUA 4CGOA 4BBHA 2EK8A 2Q7BA 3RAMA 2GP4A 1UWYA 3SJEA 1YMEA 3K2KA 3D7HA 4NF1A 1Q5XA 4JWPA 3ZJ0A 4CZ1A 4B5PA 3DR8A 4R76A 3UY5A 4MY3A 1AUGA 4DJLA 1XMTA 2JBKA 2BL1A 4EWTA 2HI6A 4M8DA 1C30B 4P10A 2JLMA 4TJVA 1IGBA 4P6YA 3QB8A 4UEFA 4AVCA 5HMNA 2Q04A 4KS9A 1VHSA 3QNVA 2OU2A 5DWMA 3F9KC 2VL1A 4PK3A 1LANA 2ATRA 2WUUA 3JTKA 5IX3A 3D4UA 4RN7A 1ZG9A 2B4DA 4ZGYB 3NOJA 3D7GA 1NE9A 5IB9A 4HNYB 3S6FA 2CXAA 4C9EA 2C6PA 4NGMA 3G3SA 1YR0A 3VWEA 4A2ZA 4G1PA 3NFZA 5F9MA 3VGOA 3T90A 1M1DA 4M6GA 1MK4A 2FS5A 3FBUA 3VRPA 4OAEA 2C6CA 4B6ZA 4CGLA 4MFJA 2PSWA 3TLGB 4KSFA 3VARA 1HDQA 2G9DA 2DEAA 1YVKA 2EO8A 1M6VB 1NXJA 3JUWA 1GYTA 4C8PA 4KVME 1I1DA 3KL9A 4LQGA 2VQYA 3B2YA 3FYNA 3S6GA 2FSRA 2Z3OA 1VBHA 2J9AA 2D0OA 2HROA 4MFKA 4KOYA 1ARLA 4ORFA 2I3CA 3B7IA 2EUIA 3R96A 5J3XA 2GIVA 3H8GA 2CTCA 2PJ4A 4FD6A 1J4JA 3TTHA 4CDKA 4NGPA 1LFWA 3DLJA 4U9YA 1ZLHA 4WJBA 3W6XA 4TJXA 1Z9UA 4C8AA 1YREA 4P4IA 3E0KA 1BOBA 1VIXA 1DIKA 3F8KA 4CYPA 2AE6A 4IUSA 4X3RA 4UEZA 4EYSA 1WWZA 2BUEA 2YNCC 2PJ1A 5F48A 5LRGA 4CPAA 3S9NA 1IOFA 4MFZA 4OLLA 2YGWA 2OZHA 1JDBC 4MFPA 3NA6A 4ZY2A 4B10A 2FM4A 2KCWA 3TOBA 4H1HA 5H84A 4OC1A 3GYAA 2PVWA 3DDDA 3IWEA 2XPNA 1XF1A 3KRVA 2ZXVA 1XIXA 4UA3A 1JDEA 1QSRA 5D29A 2GU2A 1M4DA 2A4NA 1QMUA 2CNMA 1IU8A 2VI7A 4AG7A 3GB0A 1KZFA 2WPXA 4C84A 1BLLE 2D4OA 3IJ3A 2X0SA 3VRRA 4A4BA 1FT7A 2X7BA 3VRNA 2G0BA 5H86A 4YWYA 2PRBA 2DIKA 4JLYA 4KOWA 4KSAA 4OC3A 2CNTA 2WSAA 3VWDA 2RC4A 3LMSA 4B11A 4MJXA 3PFOA 4IIXA 4UFWA 1QSTA 3PFEA 3TFYA 2ZEMA 5I4MA 3TLYA 1CPXA 2ZEGA 1YQEA 1M4LA 3D2PA 2Q4VA 5LYFA 2PR1A 1Y0YA 2BEIA 2CY2A 2BSWA 3BLNA 3HMJG 2EWBA 1S5KA 1XRYA 3FB3A 1J3LA 3HLPA 1Q2CA 4HPSA 2R8VA 4KOXA 4R3LA 5AGEA 1Z8TA 3KR5A 4MCSA 2EBJA 4O23A 4A37A 4CAXA 5LRJA 4MJ8A 2Z3KA 3CPAA 4R57A 3R9EA 1XF8A 3V7ZA 4F9UA 2FXFA 3TCVA 4MCPA 2PJ6A 4H2KA 5HVHA 3GJZA 5CPAA 2ZEOA 4FD5A 4GS4A 1EO0A 4UCNA 3I3GA 3FVLA 4C8FA 3D2MA 4BPWB 2CBLA 1QSMA 1XE4A 2NYQA 2B3VA 1BO4A 1IB1E 4J0NA 5BY0A 4F0YA 1YK3A 1S60A 4ZX9A 2OZUA 2WZNA 3JRUA 1KUVA 3OB2B 1R43A 2Q44A 3BUMB 4FAIA 2VEZA 3D7FA 3RBUA 4R87A 1P0HA 2CTBA 4ZBGA 3TO6A 2B3UA 4OP4A 4A95A 4AVAA 5F13A
chains in the Genus database with same CATH topology
3SI0A 2O53A 4P4DA 1YSJA 3K9TA 5K8NA 1ELLP 2WYRA 2ZEEA 3BI1A 4JZ0A 1H8LA 1CP6A 5LYLA 4R8FA 5K8PA 3SI2A 1KWMA 2QYVA 2AFZA 3NH8A 3KGQA 3D7DA 2PVVA 1Z2LA 2AFMA 2PJ5A 3I74A 1F2PA 4R6TA 2ZEPA 3GLJA 3H8EA 3FX6A 5D8NA 3MRUA 2BO9A 3V38A 3D68A 2CF4A 2GREA 1TF8A 4BD9A 3PRTA 4NGTA 3WC6A 4PXEA 5ELYA 4NFRA 1XJOA 2HC9A 2V8HA 5LRKA 3IEHA 2POKA 1LAPA 5LYDA 5LYIA 1BAVA 1OBRA 4C85A 4MMOA 1Y0RA 2ZEDA 3HUVA 4C9UA 2ABZA 4UIBA 1PCAA 4TWEA 2ZELA 4C99A 1YW6A 2C5QA 4GM5A 1ZLIA 5JGFA 5F09A 4AXVA 4F8ZA 1ZG7A 3PB8X 4PPZA 2PJ8A 5THWA 4MCQA 3IIBA 3SI1A 1TKHA 1F2OA 3B3CA 3KHZA 3WC7A 2OOTA 1IY7A 5HVGA 4IAVA 2PJ3A 4OIWA 2ZOGA 4DUKA 4PXBA 4A38A 4OMEA 1LOKA 4W9YA 3B3TA 2JBJA 3BI0A 3S9LA 1WVMA 4UEEA 1JQGA 1R3NA 2ZENA 3I1UA 2NSMA 3NH4A 4MCRA 8CPAA 1ZG8A 5HXDA 1DTDA 2ZEFA 5DS0A 4YU9A 3PBBA 2PRQA 4K3NA 3KQXA 4EFDA 3FEDA 4X8IA 2XEIA 1BPNA 3CPXA 4ONWA 4R7MA 2AFSA 4MXUA 4C8TA 2QJ8A 3DGVA 2PJ7A 3IWWA 3VATA 1PYTB 3GUXA 3IO1A 1LCPA 1LAMA 2PJAA 1TXRA 3PB4X 3LWUA 4C9AA 4C9VA 4MRIA 4FUUA 4UIAA 4RUHA 2AFOA 3D67A 2V8VA 1TF9A 4NGQA 1VGYA 3D66A 5K8MA 4F9VA 3ISXA 1CPSA 1YLOA 2ANPA 3B3WA 2PIZA 3VTAA 4YN3A 2PJ0A 3SJXA 1Y7EA 4WWVA 4ZY0A 4C8CA 3S9MA 2PJ9A 1XFOA 1HDUA 3KASA 3L2NA 1Z8LA 3VH9A 4Z65A 3CDXA 1F57A 4P4EA 2ZOFA 4FBEA 1AYEA 3KZWA 4CDJA 4P45A 2GLFA 4NGSA 2PCUA 2RFHA 5K8OA 3PB7X 1CG2A 4TNUA 1CX8A 4ZI6A 4NGRA 2C6GA 3I6SA 1ELMP 4PQAA 4KNGE 4NJRA 4OC2A 4C86A 3B3SA 2FVGA 4P4JA 2C1CA 5J1QA 3BXMA 2AFWA 3TC8A 1HEEA 3SJGA 3MN8A 3N5FA 1XMBA 1Y9ZA 3CT9A 2ZEHA 4KSIA 4A94A 1ARMA 4FWUA 4OIDA 4EMEA 3FH4A 3ICUA 3KR4A 4IHMA 4PXDA 3PB6X 2IQ6A 1CP7A 4C8UA 7CPAA 3WT4A 3WABA 3KQZA 4X2TA 3KI9A 3PEIA 2V77A 4CDKA 4P4BA 2XEJA 1VHOA 2F8HA 4DYOA 1NSAA 3PB9X 3IC1A 2BOAA 4JYWA 4MHYA 6CPAA 3ISZA 1DE4C 1CBXA 4P4FA 1XBUA 2HB6A 3PBEA 3B3VA 1Q7LA 2IMOA 3FECA 3FF3A 4ZX8A 4ZYQA 3KHXA 4UF4A 1YW4A 2OR4A 3BHXA 2XEFA 3IFEA 4OKOA 2CIJA 1V6CA 1TKFA 2XEGA 1AMPA 4C9RA 2RB7A 4PXCA 1RTQA 2EK9A 4IK2A 3WC5A 2F7VA 3T8WA 1FNOA 2AFUA 1EE3P 2JEWA 2PJCA 2BCOA 3FMCA 4NGNA 4OC4A 2Q4ZA 4OC0A 3SJFA 3RZAA 5CBMA 3H8FA 4NJQA 3FJUA 1VHEA 4MHZA 4Q7AA 2AFXA 1BPMA 2IJZA 5JM6A 2V8GA 4MHNA 4MHPA 4P44A 4OC5A 5JH9A 2QVPA 2GLJA 3NH5A 3FEEA 3EIFA 3B35A 1TKJA 2O4HA 2Q51A 2PJ2A 2PJBA 1Z5RA 1QQ9A 5IR2A 5HVFA 2V8DA 2Q43A 3TX8A 2PE3A 4A39A 2PIYA 4ZY1A 2EK8A 3RAMA 2GP4A 1UWYA 3SJEA 1YMEA 3K2KA 3D7HA 4R76A 4DJLA 2JBKA 4EWTA 4P10A 4TJVA 1IGBA 4P6YA 4UEFA 3QNVA 2VL1A 1LANA 3D4UA 1ZG9A 3D7GA 5IB9A 4C9EA 2C6PA 4NGMA 4G1PA 3NFZA 4B6ZA 2C6CA 3VARA 1HDQA 2G9DA 2DEAA 4C8PA 1GYTA 3KL9A 4LQGA 3B2YA 2J9AA 1ARLA 2I3CA 3B7IA 3H8GA 2CTCA 2PJ4A 4NGPA 1LFWA 3DLJA 4WJBA 1ZLHA 4TJXA 4C8AA 4P4IA 1VIXA 4X3RA 4UEZA 2PJ1A 4CPAA 5LRGA 3S9NA 3NA6A 4ZY2A 4OC1A 2PVWA 1XF1A 5D29A 2GU2A 1QMUA 3GB0A 4C84A 1BLLE 3IJ3A 1FT7A 4YWYA 4OC3A 3LMSA 3PFOA 3PFEA 2ZEMA 5I4MA 1CPXA 2ZEGA 1M4LA 5LYFA 1Y0YA 2EWBA 1XRYA 3HLPA 3KR5A 4MCSA 4O23A 4A37A 5LRJA 3CPAA 3V7ZA 4F9UA 5HVHA 4H2KA 4MCPA 2PJ6A 5CPAA 2ZEOA 3FVLA 4C8FA 2NYQA 4ZX9A 3JRUA 2WZNA 1R43A 4FAIA 3D7FA 3RBUA 2CTBA 4OP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SI0 A;  2O53 A;  4P4D A;  1YSJ A;  3K9T A;  5K8N A;  1ELL P;  2WYR A;  2ZEE A;  3BI1 A;  4JZ0 A;  1H8L A;  1CP6 A;  5LYL A;  4R8F A;  5K8P A;  3SI2 A;  1KWM A;  2QYV A;  2AFZ A;  3NH8 A;  3KGQ A;  3D7D A;  2PVV A;  1Z2L A;  2AFM A;  2PJ5 A;  3I74 A;  1F2P A;  4R6T A;  2ZEP A;  3GLJ A;  3H8E A;  3FX6 A;  5D8N A;  3MRU A;  2BO9 A;  3V38 A;  3D68 A;  2CF4 A;  2GRE A;  1TF8 A;  4BD9 A;  3PRT A;  4NGT A;  3WC6 A;  4PXE A;  5ELY A;  4NFR A;  1XJO A;  2HC9 A;  2V8H A;  5LRK A;  3IEH A;  2POK A;  1LAP A;  5LYD A;  5LYI A;  1BAV A;  1OBR A;  4C85 A;  4MMO A;  1Y0R A;  2ZED A;  3HUV A;  4C9U A;  2ABZ A;  4UIB A;  1PCA A;  4TWE A;  2ZEL A;  4C99 A;  1YW6 A;  4GM5 A;  1ZLI A;  5JGF A;  5F09 A;  4AXV A;  4F8Z A;  1ZG7 A;  3PB8 X;  4PPZ A;  2PJ8 A;  5THW A;  4MCQ A;  3IIB A;  3SI1 A;  1TKH A;  1F2O A;  3B3C A;  3KHZ A;  3WC7 A;  2OOT A;  1IY7 A;  5HVG A;  4IAV A;  2PJ3 A;  4OIW A;  2ZOG A;  4DUK A;  4PXB A;  4A38 A;  4OME A;  1LOK A;  4W9Y A;  3B3T A;  2JBJ A;  3BI0 A;  3S9L A;  1WVM A;  4UEE A;  1JQG A;  1R3N A;  2ZEN A;  3I1U A;  2NSM A;  3NH4 A;  4MCR A;  8CPA A;  1ZG8 A;  5HXD A;  1DTD A;  2ZEF A;  5DS0 A;  4YU9 A;  3PBB A;  2PRQ A;  4K3N A;  3KQX A;  4EFD A;  3FED A;  4X8I A;  2XEI A;  1BPN A;  3CPX A;  4ONW A;  4R7M A;  2AFS A;  4MXU A;  4C8T A;  2QJ8 A;  3DGV A;  2PJ7 A;  3IWW A;  3VAT A;  1PYT B;  3GUX A;  3IO1 A;  1LCP A;  1LAM A;  2PJA A;  1TXR A;  3PB4 X;  3LWU A;  4C9A A;  4C9V A;  4MRI A;  4FUU A;  4UIA A;  4RUH A;  2AFO A;  3D67 A;  2V8V A;  1TF9 A;  4NGQ A;  1VGY A;  3D66 A;  5K8M A;  4F9V A;  3ISX A;  1CPS A;  1YLO A;  2ANP A;  3B3W A;  2PIZ A;  3VTA A;  4YN3 A;  2PJ0 A;  3SJX A;  1Y7E A;  4WWV A;  4ZY0 A;  4C8C A;  3S9M A;  2PJ9 A;  1XFO A;  1HDU A;  3KAS A;  3L2N A;  1Z8L A;  3VH9 A;  4Z65 A;  3CDX A;  1F57 A;  4P4E A;  2ZOF A;  4FBE A;  1AYE A;  3KZW A;  4CDJ A;  4P45 A;  2GLF A;  4NGS A;  2PCU A;  2RFH A;  5K8O A;  3PB7 X;  1CG2 A;  4TNU A;  1CX8 A;  4ZI6 A;  4NGR A;  2C6G A;  3I6S A;  1ELM P;  4PQA A;  4KNG E;  4NJR A;  4OC2 A;  4C86 A;  3B3S A;  2FVG A;  4P4J A;  2C1C A;  5J1Q A;  3BXM A;  2AFW A;  3TC8 A;  1HEE A;  3SJG A;  3MN8 A;  3N5F A;  1XMB A;  1Y9Z A;  3CT9 A;  2ZEH A;  4KSI A;  4A94 A;  1ARM A;  4FWU A;  4OID A;  4EME A;  3FH4 A;  3ICU A;  3KR4 A;  4IHM A;  4PXD A;  3PB6 X;  2IQ6 A;  1CP7 A;  4C8U A;  7CPA A;  3WT4 A;  3WAB A;  3KQZ A;  4X2T A;  3KI9 A;  3PEI A;  2V77 A;  4CDK A;  4P4B A;  2XEJ A;  1VHO A;  2F8H A;  4DYO A;  1NSA A;  3PB9 X;  3IC1 A;  2BOA A;  4JYW A;  4MHY A;  6CPA A;  3ISZ A;  1DE4 C;  1CBX A;  4P4F A;  1XBU A;  2HB6 A;  3PBE A;  3B3V A;  1Q7L A;  2IMO A;  3FEC A;  3FF3 A;  4ZX8 A;  4ZYQ A;  3KHX A;  4UF4 A;  1YW4 A;  2OR4 A;  3BHX A;  2XEF A;  3IFE A;  4OKO A;  2CIJ A;  1V6C A;  1TKF A;  2XEG A;  1AMP A;  4C9R A;  2RB7 A;  4PXC A;  1RTQ A;  2EK9 A;  4IK2 A;  3WC5 A;  2F7V A;  3T8W A;  1FNO A;  2AFU A;  1EE3 P;  2JEW A;  2PJC A;  2BCO A;  3FMC A;  4NGN A;  4OC4 A;  2Q4Z A;  4OC0 A;  3SJF A;  3RZA A;  5CBM A;  3H8F A;  4NJQ A;  3FJU A;  1VHE A;  4MHZ A;  4Q7A A;  2AFX A;  1BPM A;  2IJZ A;  5JM6 A;  2V8G A;  4MHN A;  4MHP A;  4P44 A;  4OC5 A;  5JH9 A;  2QVP A;  2GLJ A;  3NH5 A;  3FEE A;  3EIF A;  3B35 A;  1TKJ A;  2O4H A;  2Q51 A;  2PJ2 A;  2PJB A;  1Z5R A;  1QQ9 A;  5HVF A;  2V8D A;  2Q43 A;  3TX8 A;  2PE3 A;  4A39 A;  2PIY A;  4ZY1 A;  2EK8 A;  3RAM A;  1UWY A;  3SJE A;  1YME A;  3K2K A;  3D7H A;  4R76 A;  4DJL A;  2JBK A;  4EWT A;  4P10 A;  4TJV A;  1IGB A;  4P6Y A;  4UEF A;  3QNV A;  2VL1 A;  1LAN A;  3D4U A;  1ZG9 A;  3D7G A;  5IB9 A;  4C9E A;  2C6P A;  4NGM A;  4G1P A;  3NFZ A;  4B6Z A;  2C6C A;  3VAR A;  1HDQ A;  2G9D A;  2DEA A;  4C8P A;  1GYT A;  3KL9 A;  4LQG A;  3B2Y A;  2J9A A;  1ARL A;  2I3C A;  3B7I A;  3H8G A;  2CTC A;  2PJ4 A;  4NGP A;  1LFW A;  3DLJ A;  4WJB A;  1ZLH A;  4TJX A;  4C8A A;  4P4I A;  1VIX A;  4X3R A;  4UEZ A;  2PJ1 A;  4CPA A;  5LRG A;  3S9N A;  3NA6 A;  4ZY2 A;  4OC1 A;  2PVW A;  1XF1 A;  5D29 A;  2GU2 A;  1QMU A;  3GB0 A;  4C84 A;  1BLL E;  3IJ3 A;  1FT7 A;  4YWY A;  4OC3 A;  3LMS A;  3PFO A;  3PFE A;  2ZEM A;  5I4M A;  1CPX A;  2ZEG A;  1M4L A;  5LYF A;  1Y0Y A;  2EWB A;  1XRY A;  3HLP A;  3KR5 A;  4MCS A;  4O23 A;  4A37 A;  5LRJ A;  3CPA A;  3V7Z A;  4F9U A;  5HVH A;  4H2K A;  4MCP A;  2PJ6 A;  5CPA A;  2ZEO A;  3FVL A;  4C8F A;  2NYQ A;  4ZX9 A;  3JRU A;  2WZN A;  1R43 A;  4FAI A;  3D7F A;  3RBU A;  2CTB A;  4OP4 A; 
#chains in the Genus database with same CATH topology
 1R61 A;  2PCN A;  5JVL A;  3SI0 A;  4M6H A;  2O53 A;  1ON0 A;  1S7N A;  2OZG A;  4YFJ A;  4COG A;  1B87 A;  2R98 A;  4P4D A;  2DLA A;  1YVH A;  1YSJ A;  3K9T A;  5K8N A;  1ELL P;  2WYR A;  2ZEE A;  5F49 A;  4HNX B;  5G22 A;  3BI1 A;  2GAN A;  5HKW A;  4JZ0 A;  1H8L A;  2OLS A;  1CP6 A;  3T07 A;  5LYL A;  4R8F A;  5K8P A;  3T05 A;  3SI2 A;  2I79 A;  1KWM A;  2QYV A;  3GY9 A;  1CJW A;  2AFZ A;  2J8N A;  2Q4Y A;  1LRZ A;  1S3Z A;  3NH8 A;  1Y7R A;  3KGQ A;  4E94 A;  3D7D A;  5HH1 A;  2Y1N A;  3S6K A;  4H6U A;  2PVV A;  2YND A;  4BPX B;  2N3A B;  1Z2L A;  2AFM A;  4II9 A;  2PJ5 A;  3F5B A;  3I74 A;  1F2P A;  4R6T A;  4KVO E;  4E2A A;  3NFQ A;  1WJT A;  2ZEP A;  4COB A;  3GLJ A;  3TLC A;  2B5G A;  2HQY A;  3CXS A;  2P6F A;  2Y0M A;  1Q2D A;  1NBW A;  3H8E A;  3FX6 A;  5D8N A;  3MRU A;  2BO9 A;  1IYL A;  3TYX A;  4QBJ A;  2REE A;  3V38 A;  3D68 A;  2CF4 A;  4CAE A;  4DNC A;  2VBQ A;  2GRE A;  2Z3L A;  2ODF A;  3F0A A;  1TF8 A;  3IU1 A;  4AVB A;  4BD9 A;  1QSN A;  5HKY A;  4FD4 A;  3PRT A;  4NGT A;  1KBL A;  1X12 A;  1QSO A;  3WC6 A;  4PXE A;  5J8F A;  5ELY A;  4E8O A;  4INJ A;  4NFR A;  3EO4 A;  1XJO A;  2DPS A;  2HC9 A;  2V8H A;  5LRK A;  3IEH A;  2Z11 A;  2P6E A;  5CNP A;  2POK A;  3EC4 A;  5GCN A;  2YNE A;  2EZB A;  3EZE A;  3FNC A;  1LAP A;  4IIY A;  3K9U A;  5LYD A;  5LYI A;  1BAV A;  1OBR A;  4Q36 A;  2PDO A;  1X10 A;  4C85 A;  5FD8 A;  3G8W A;  4MMO A;  1L0C A;  1Y0R A;  2ZED A;  3HUV A;  1ZO0 A;  4Y49 B;  4C9U A;  2ABZ A;  1MJA A;  2Z3M A;  4UWI A;  3PZJ A;  2B5G B;  2Z10 A;  4C7I A;  3TE4 A;  3SR3 A;  4RS2 A;  4UIB A;  1BXR B;  1PCA A;  4OAD A;  2FL4 A;  2ZEL A;  3QAY A;  3U88 C;  1YW6 A;  4TWE A;  2C5Q A;  4C99 A;  4GM5 A;  2JDD A;  1ZLI A;  4B5P B;  1CE8 B;  2Y1M A;  5JGF A;  5F09 A;  2DF5 A;  4AXV A;  4F8Z A;  2PQ8 A;  1ZG7 A;  2WPW A;  3IWG A;  2ARH A;  5IV0 A;  4RI1 A;  3PB8 X;  4PPZ A;  2PJ8 A;  5THW A;  3TOA A;  1KUX A;  5G1Z A;  4MCQ A;  3IIB A;  3SI1 A;  1TKH A;  1F2O A;  2ZW6 A;  3CZX A;  3DSB A;  5F47 A;  4C2X A;  5C88 A;  3B3C A;  3KHZ A;  4Y49 C;  3WC7 A;  4I49 A;  4GPL B;  1PUA A;  2OOT A;  1IY7 A;  5HVG A;  4IAV A;  5BWA B;  1ZL0 A;  5JYB A;  3N7Z A;  4LX9 A;  2PJ3 A;  3T5M A;  1TIQ A;  4OIW A;  4QC6 A;  2ZOG A;  2EZA A;  4KOV A;  4XPD C;  4DUK A;  4PXB A;  4A38 A;  4OME A;  1LOK A;  4QUS A;  3G23 A;  1I21 A;  3TLG A;  4W9Y A;  3B3T A;  2JBJ A;  1PU9 A;  4NSQ A;  3R95 A;  4AB7 A;  3SXO A;  3TT2 A;  3BI0 A;  3S9L A;  3BJ7 A;  1WVM A;  4UEE A;  1JQG A;  3DR6 A;  1R3N A;  3OWC A;  2ZEN A;  4K30 A;  2D4P A;  3RO0 A;  3I1U A;  2NSM A;  4MFQ A;  2QML A;  3NH4 A;  4MCR A;  1MJ9 A;  4E0A A;  1XEB A;  1ZG8 A;  5FVJ A;  4F0X A;  5EBV A;  8CPA A;  1CS0 B;  2O28 A;  2P6G A;  3A9L A;  1M44 A;  2GE3 A;  5HXD A;  2B0A A;  1DTD A;  2ZEF A;  4HNW B;  2VZZ A;  5DS0 A;  5IB0 A;  3NE7 A;  4H89 A;  4M85 A;  4YU9 A;  3PBB A;  2PRQ A;  4K3N A;  3KQX A;  4UCP A;  4EFD A;  1GHE A;  1V0C A;  5ISV A;  2J8M A;  1Z4R A;  3FED A;  2ZW7 A;  2XEI A;  4X8I A;  1BPN A;  3CPX A;  3W6S A;  4ONW A;  2PC1 A;  3PGP A;  4BMH A;  4R7M A;  1GGO A;  4XPD B;  2AFS A;  3FXT A;  4MXU A;  3TLZ A;  4C8T A;  2QJ8 A;  2R7H A;  5KTD A;  3DGV A;  2PJ7 A;  3IWW A;  4KLV A;  3VAT A;  1YLE A;  4KLW A;  3O8Z A;  1PYT B;  3HPG G;  4RR2 B;  4JXR A;  4MBU A;  4R9M A;  4B12 A;  4CAW A;  3EZB A;  4CS0 B;  3GUX A;  3IO1 A;  4A31 A;  1LCP A;  1LAM A;  2PJA A;  4U5Y A;  1TXR A;  1Z8W A;  3RNZ A;  3PB4 X;  3LWU A;  5G21 A;  1ZYM A;  4C9A A;  1IIC A;  4MRI A;  4C9V A;  1P4N A;  4C2Z A;  3H5Z A;  4FUU A;  3I9S A;  4UIA A;  3VRQ A;  5AG4 A;  4RUH A;  2AFO A;  3D67 A;  3IU2 A;  2V8V A;  4LQ6 A;  1TF9 A;  4NGQ A;  4JD6 A;  5I0C A;  2YJT A;  3JVN A;  4L89 A;  4UWJ A;  1VGY A;  3D66 A;  4YRH A;  4PV6 A;  5K8M A;  4F9V A;  1KUY A;  2ZPA A;  4QB9 A;  3R9G A;  3ISX A;  1CPS A;  1NMT A;  4MFL A;  5J8C A;  1YLO A;  2ANP A;  2F5I A;  3B3W A;  1JWQ A;  2PIZ A;  2QIR A;  3LOD A;  4C7H A;  3ZZI A;  4YN3 A;  3EZA A;  3VTA A;  2PJ0 A;  3SJX A;  1Y7E A;  4WWV A;  3PFV A;  4CRY B;  4ZY0 A;  4C8C A;  3S9M A;  2PJ9 A;  3DNS A;  1XFO A;  1HDU A;  3KAS A;  2QEC A;  4R3K A;  4CAV A;  2AUN A;  3L2N A;  1Z8L A;  3VH9 A;  4Z65 A;  3CDX A;  4A4C A;  4PK2 A;  2Q7S A;  1F57 A;  5F46 A;  4BIN A;  4P4E A;  2ZOF A;  1A2Z A;  1AYE A;  3KZW A;  4FBE A;  3QAH A;  4CDJ A;  2ZW4 A;  3TO7 A;  4L8A A;  4GXH A;  1R57 A;  4P45 A;  2GLF A;  4NGS A;  2GFQ A;  2PCU A;  3OP0 A;  2RFH A;  3CXQ A;  2P0W A;  1CG2 A;  3PB7 X;  5K8O A;  4AG9 A;  2H5M A;  5AG6 A;  3BUN B;  4TNU A;  1CX8 A;  2VZY A;  4KOU A;  4NGR A;  4ZI6 A;  2C6G A;  3I6S A;  3D3S A;  4CYN A;  3D8P A;  4X5K A;  1M4I A;  1ELM P;  1M4G A;  4PQA A;  4CAF A;  4KNG E;  3KKW A;  1RO5 A;  4KUA A;  4NJR A;  4OC2 A;  5K99 A;  4MY0 A;  1Z8X A;  3PP9 A;  2FIW A;  4C86 A;  4H6Z A;  3B3S A;  4BTF A;  5F1Y A;  1NSL A;  2OB0 A;  2VKZ G;  2FVG A;  4PSW A;  1VI4 A;  1Q2Y A;  3SXN A;  1KC7 A;  5A27 A;  1S7F A;  5EC4 A;  2G3A A;  4UFV A;  4P4J A;  2C1C A;  5J1Q A;  3R9F A;  2E28 A;  1IYK A;  1K4J A;  4NXY A;  4EVY A;  3BXM A;  4BPU B;  3U1B A;  2AFW A;  4XNH C;  3TC8 A;  1HEE A;  2B4D B;  4NCZ A;  3SJG A;  2Z0Z A;  3MN8 A;  3N5F A;  1XMB A;  3P2F A;  1C3O B;  2XPP A;  1Y9Z A;  3CT9 A;  4Q38 A;  2ZEH A;  3VRO A;  1U6M A;  4M6I A;  5HKZ A;  2HWG A;  4JVO A;  4KSI A;  4A94 A;  1ARM A;  4FWU A;  4OID A;  4EME A;  2VXK A;  3FH4 A;  3P2H A;  3ICU A;  3NE8 A;  3KR4 A;  1Z9E A;  4J3G A;  4IHM A;  1YGH A;  3WR7 A;  4KZT A;  3PB6 X;  4PSX A;  4PXD A;  1VBG A;  2IQ6 A;  1CP7 A;  4C8U A;  1EZB A;  5DWN A;  7CPA A;  2Q0Y A;  5AG5 A;  3WAB A;  3WT4 A;  3IGR A;  3KQZ A;  4A33 A;  4X2T A;  3KI9 A;  3TLE A;  3PEI A;  1SQH A;  2B4J C;  3ZNI A;  2V77 A;  4MI1 A;  4P4B A;  3BUW B;  1FBV A;  2XEJ A;  3MGD A;  1VHO A;  1ZRS A;  1WK4 A;  4XPK A;  4FD7 A;  1B6B A;  2XPL A;  2YJV A;  2F8H A;  2JDC A;  4A32 A;  4KOR A;  4DYO A;  1NSA A;  3PB9 X;  3IC1 A;  4CGM A;  2BOA A;  2FCK A;  2HV2 A;  2REF A;  2NMT A;  5JQ4 A;  3PT1 A;  4JYW A;  4MHY A;  6CPA A;  3ISZ A;  1DE4 C;  4B14 A;  2D0P A;  1CBX A;  4P4F A;  1XBU A;  2HB6 A;  3PBE A;  4UBR A;  3B3V A;  3V8I A;  2B58 A;  5AG7 A;  2R82 A;  3SHP A;  5C82 A;  4UCM A;  1YX0 A;  1Y9W A;  4F6A A;  1Q7L A;  2IL4 A;  2IMO A;  3EY5 A;  2EZC A;  3TLA A;  3FEC A;  3FF3 A;  2MP0 A;  2FE7 A;  4ZX8 A;  4ZYQ A;  3GKR A;  1B47 A;  3C8O A;  3KHX A;  4LUA A;  4YGO A;  4CYQ A;  4QVT A;  2C27 A;  4B13 A;  4UF4 A;  1YW4 A;  3HPH E;  2OR4 A;  3BHX A;  3BUX B;  1IOI A;  2G3T A;  3GIU A;  4KOS A;  4XPL A;  3TO9 A;  2XEF A;  3R1K A;  3IFE A;  1S7L A;  2DXQ A;  4M3S A;  4OKO A;  2CIJ A;  4C2Y A;  1OZP A;  4IF5 A;  4KOT A;  4KVX A;  4CRZ B;  5F5X A;  1V6C A;  1FY7 A;  3RYO A;  1TKF A;  1T36 B;  5A28 A;  3K4I A;  3S6H A;  4U9Z A;  2XEG A;  1AMP A;  2EVN A;  3CXP A;  2DPT A;  3FIX A;  4C9R A;  4MHD A;  2RB7 A;  1KEE B;  4PXC A;  5KTC A;  1S7K A;  1RTQ A;  1Z4E A;  2EK9 A;  2JEV A;  3LD2 A;  4IK2 A;  2FIA A;  4NEX A;  3WC5 A;  2F7V A;  4HKF A;  1YVO A;  3T8W A;  1FNO A;  2AFU A;  1UFH A;  4A30 A;  4B5O A;  2AJ6 A;  2XPO A;  1EE3 P;  2JEW A;  2PJC A;  1Y9K A;  2YNC A;  5E96 A;  2R1I A;  2BCO A;  3FMC A;  1A9X B;  3EXN A;  3OAK A;  2CNS A;  4JXQ A;  4NGN A;  4JJX A;  4OC4 A;  4CGN A;  2Q4Z A;  4OC0 A;  4CYO A;  3T9Y A;  2UV8 G;  1IID A;  4CGP A;  3BUO B;  3SJF A;  3RZA A;  5CBM A;  5KTA A;  1XOV A;  2HUZ A;  3H8F A;  2K5T A;  4NJQ A;  3TLB A;  3FJU A;  1VHE A;  4E5S A;  3C26 A;  3H4Q A;  3PLF B;  4MHZ A;  4Q7A A;  1N71 A;  1BPM A;  2AFX A;  2IJZ A;  2ZW5 A;  3B8G A;  5JM6 A;  1EZA A;  2V8G A;  2Z3P A;  3W91 A;  4MHN A;  4MHP A;  2B4B A;  4UFX A;  4KUB A;  3FRM A;  4P44 A;  4OC5 A;  5EMI A;  3T0T A;  1CM0 A;  5AXI A;  2I00 A;  4XNH B;  3OB1 B;  2FT0 A;  1RXT A;  2QVP A;  5G20 A;  5JH9 A;  2GLJ A;  3NH5 A;  3FEE A;  3LAC A;  4CO9 A;  2PR8 A;  2AUM A;  2OH1 A;  3B35 A;  3EIF A;  1TKJ A;  2O4H A;  2Q51 A;  2J8R A;  2PJ2 A;  1Z5R A;  1QQ9 A;  2PJB A;  5HVF A;  5IR2 A;  2V8D A;  1VKC A;  1MJB A;  2Q43 A;  3TX8 A;  4C68 A;  5JPH A;  2PE3 A;  4A39 A;  2Z3N A;  2PIY A;  1I12 A;  3BJ8 A;  4MI4 A;  3EFA A;  4ZY1 A;  4ONU A;  4CGO A;  4BBH A;  2EK8 A;  2Q7B A;  3RAM A;  2GP4 A;  1UWY A;  3SJE A;  1YME A;  3K2K A;  3D7H A;  4NF1 A;  1Q5X A;  4JWP A;  3ZJ0 A;  4CZ1 A;  4B5P A;  3DR8 A;  4R76 A;  3UY5 A;  4MY3 A;  1AUG A;  4DJL A;  1XMT A;  2JBK A;  2BL1 A;  4EWT A;  2HI6 A;  4M8D A;  1C30 B;  4P10 A;  2JLM A;  4TJV A;  1IGB A;  4P6Y A;  3QB8 A;  4UEF A;  4AVC A;  5HMN A;  2Q04 A;  4KS9 A;  1VHS A;  3QNV A;  2OU2 A;  5DWM A;  3F9K C;  2VL1 A;  4PK3 A;  1LAN A;  2ATR A;  2WUU A;  3JTK A;  5IX3 A;  3D4U A;  4RN7 A;  1ZG9 A;  2B4D A;  4ZGY B;  3NOJ A;  3D7G A;  1NE9 A;  5IB9 A;  4HNY B;  3S6F A;  2CXA A;  4C9E A;  2C6P A;  4NGM A;  3G3S A;  1YR0 A;  3VWE A;  4A2Z A;  4G1P A;  3NFZ A;  5F9M A;  3VGO A;  3T90 A;  1M1D A;  4M6G A;  1MK4 A;  2FS5 A;  3FBU A;  3VRP A;  4OAE A;  2C6C A;  4B6Z A;  4CGL A;  4MFJ A;  2PSW A;  3TLG B;  4KSF A;  3VAR A;  1HDQ A;  2G9D A;  2DEA A;  1YVK A;  2EO8 A;  1M6V B;  1NXJ A;  3JUW A;  1GYT A;  4C8P A;  4KVM E;  1I1D A;  3KL9 A;  4LQG A;  2VQY A;  3B2Y A;  3FYN A;  3S6G A;  2FSR A;  2Z3O A;  1VBH A;  2J9A A;  2D0O A;  2HRO A;  4MFK A;  4KOY A;  1ARL A;  4ORF A;  2I3C A;  3B7I A;  2EUI A;  3R96 A;  5J3X A;  2GIV A;  3H8G A;  2CTC A;  2PJ4 A;  4FD6 A;  1J4J A;  3TTH A;  4CDK A;  4NGP A;  1LFW A;  3DLJ A;  4U9Y A;  1ZLH A;  4WJB A;  3W6X A;  4TJX A;  1Z9U A;  4C8A A;  1YRE A;  4P4I A;  3E0K A;  1BOB A;  1VIX A;  1DIK A;  3F8K A;  4CYP A;  2AE6 A;  4IUS A;  4X3R A;  4UEZ A;  4EYS A;  1WWZ A;  2BUE A;  2YNC C;  2PJ1 A;  5F48 A;  5LRG A;  4CPA A;  3S9N A;  1IOF A;  4MFZ A;  4OLL A;  2YGW A;  2OZH A;  1JDB C;  4MFP A;  3NA6 A;  4ZY2 A;  4B10 A;  2FM4 A;  2KCW A;  3TOB A;  4H1H A;  5H84 A;  4OC1 A;  3GYA A;  2PVW A;  3DDD A;  3IWE A;  2XPN A;  1XF1 A;  3KRV A;  2ZXV A;  1XIX A;  4UA3 A;  1JDE A;  1QSR A;  5D29 A;  2GU2 A;  1M4D A;  2A4N A;  1QMU A;  2CNM A;  1IU8 A;  2VI7 A;  4AG7 A;  3GB0 A;  1KZF A;  2WPX A;  4C84 A;  1BLL E;  2D4O A;  3IJ3 A;  2X0S A;  3VRR A;  4A4B A;  1FT7 A;  2X7B A;  3VRN A;  2G0B A;  5H86 A;  4YWY A;  2PRB A;  2DIK A;  4JLY A;  4KOW A;  4KSA A;  4OC3 A;  2CNT A;  2WSA A;  3VWD A;  2RC4 A;  3LMS A;  4B11 A;  4MJX A;  3PFO A;  4IIX A;  4UFW A;  1QST A;  3PFE A;  3TFY A;  2ZEM A;  5I4M A;  3TLY A;  1CPX A;  2ZEG A;  1YQE A;  1M4L A;  3D2P A;  2Q4V A;  5LYF A;  2PR1 A;  1Y0Y A;  2BEI A;  2CY2 A;  2BSW A;  3BLN A;  3HMJ G;  2EWB A;  1S5K A;  1XRY A;  3FB3 A;  1J3L A;  3HLP A;  1Q2C A;  4HPS A;  2R8V A;  4KOX A;  4R3L A;  5AGE A;  1Z8T A;  3KR5 A;  4MCS A;  2EBJ A;  4O23 A;  4A37 A;  4CAX A;  5LRJ A;  4MJ8 A;  2Z3K A;  3CPA A;  4R57 A;  3R9E A;  1XF8 A;  3V7Z A;  4F9U A;  2FXF A;  3TCV A;  4MCP A;  2PJ6 A;  4H2K A;  5HVH A;  3GJZ A;  5CPA A;  2ZEO A;  4FD5 A;  4GS4 A;  1EO0 A;  4UCN A;  3I3G A;  3FVL A;  4C8F A;  3D2M A;  4BPW B;  2CBL A;  1QSM A;  1XE4 A;  2NYQ A;  2B3V A;  1BO4 A;  1IB1 E;  4J0N A;  5BY0 A;  4F0Y A;  1YK3 A;  1S60 A;  4ZX9 A;  2OZU A;  2WZN A;  3JRU A;  1KUV A;  3OB2 B;  1R43 A;  2Q44 A;  3BUM B;  4FAI A;  2VEZ A;  3D7F A;  3RBU A;  4R87 A;  1P0H A;  2CTB A;  4ZBG A;  3TO6 A;  2B3U A;  4OP4 A;  4A95 A;  4AVA A;  5F13 A; 
#chains in the Genus database with same CATH homology
 3SI0 A;  2O53 A;  4P4D A;  1YSJ A;  3K9T A;  5K8N A;  1ELL P;  2WYR A;  2ZEE A;  3BI1 A;  4JZ0 A;  1H8L A;  1CP6 A;  5LYL A;  4R8F A;  5K8P A;  3SI2 A;  1KWM A;  2QYV A;  2AFZ A;  3NH8 A;  3KGQ A;  3D7D A;  2PVV A;  1Z2L A;  2AFM A;  2PJ5 A;  3I74 A;  1F2P A;  4R6T A;  2ZEP A;  3GLJ A;  3H8E A;  3FX6 A;  5D8N A;  3MRU A;  2BO9 A;  3V38 A;  3D68 A;  2CF4 A;  2GRE A;  1TF8 A;  4BD9 A;  3PRT A;  4NGT A;  3WC6 A;  4PXE A;  5ELY A;  4NFR A;  1XJO A;  2HC9 A;  2V8H A;  5LRK A;  3IEH A;  2POK A;  1LAP A;  5LYD A;  5LYI A;  1BAV A;  1OBR A;  4C85 A;  4MMO A;  1Y0R A;  2ZED A;  3HUV A;  4C9U A;  2ABZ A;  4UIB A;  1PCA A;  4TWE A;  2ZEL A;  4C99 A;  1YW6 A;  2C5Q A;  4GM5 A;  1ZLI A;  5JGF A;  5F09 A;  4AXV A;  4F8Z A;  1ZG7 A;  3PB8 X;  4PPZ A;  2PJ8 A;  5THW A;  4MCQ A;  3IIB A;  3SI1 A;  1TKH A;  1F2O A;  3B3C A;  3KHZ A;  3WC7 A;  2OOT A;  1IY7 A;  5HVG A;  4IAV A;  2PJ3 A;  4OIW A;  2ZOG A;  4DUK A;  4PXB A;  4A38 A;  4OME A;  1LOK A;  4W9Y A;  3B3T A;  2JBJ A;  3BI0 A;  3S9L A;  1WVM A;  4UEE A;  1JQG A;  1R3N A;  2ZEN A;  3I1U A;  2NSM A;  3NH4 A;  4MCR A;  8CPA A;  1ZG8 A;  5HXD A;  1DTD A;  2ZEF A;  5DS0 A;  4YU9 A;  3PBB A;  2PRQ A;  4K3N A;  3KQX A;  4EFD A;  3FED A;  4X8I A;  2XEI A;  1BPN A;  3CPX A;  4ONW A;  4R7M A;  2AFS A;  4MXU A;  4C8T A;  2QJ8 A;  3DGV A;  2PJ7 A;  3IWW A;  3VAT A;  1PYT B;  3GUX A;  3IO1 A;  1LCP A;  1LAM A;  2PJA A;  1TXR A;  3PB4 X;  3LWU A;  4C9A A;  4C9V A;  4MRI A;  4FUU A;  4UIA A;  4RUH A;  2AFO A;  3D67 A;  2V8V A;  1TF9 A;  4NGQ A;  1VGY A;  3D66 A;  5K8M A;  4F9V A;  3ISX A;  1CPS A;  1YLO A;  2ANP A;  3B3W A;  2PIZ A;  3VTA A;  4YN3 A;  2PJ0 A;  3SJX A;  1Y7E A;  4WWV A;  4ZY0 A;  4C8C A;  3S9M A;  2PJ9 A;  1XFO A;  1HDU A;  3KAS A;  3L2N A;  1Z8L A;  3VH9 A;  4Z65 A;  3CDX A;  1F57 A;  4P4E A;  2ZOF A;  4FBE A;  1AYE A;  3KZW A;  4CDJ A;  4P45 A;  2GLF A;  4NGS A;  2PCU A;  2RFH A;  5K8O A;  3PB7 X;  1CG2 A;  4TNU A;  1CX8 A;  4ZI6 A;  4NGR A;  2C6G A;  3I6S A;  1ELM P;  4PQA A;  4KNG E;  4NJR A;  4OC2 A;  4C86 A;  3B3S A;  2FVG A;  4P4J A;  2C1C A;  5J1Q A;  3BXM A;  2AFW A;  3TC8 A;  1HEE A;  3SJG A;  3MN8 A;  3N5F A;  1XMB A;  1Y9Z A;  3CT9 A;  2ZEH A;  4KSI A;  4A94 A;  1ARM A;  4FWU A;  4OID A;  4EME A;  3FH4 A;  3ICU A;  3KR4 A;  4IHM A;  4PXD A;  3PB6 X;  2IQ6 A;  1CP7 A;  4C8U A;  7CPA A;  3WT4 A;  3WAB A;  3KQZ A;  4X2T A;  3KI9 A;  3PEI A;  2V77 A;  4CDK A;  4P4B A;  2XEJ A;  1VHO A;  2F8H A;  4DYO A;  1NSA A;  3PB9 X;  3IC1 A;  2BOA A;  4JYW A;  4MHY A;  6CPA A;  3ISZ A;  1DE4 C;  1CBX A;  4P4F A;  1XBU A;  2HB6 A;  3PBE A;  3B3V A;  1Q7L A;  2IMO A;  3FEC A;  3FF3 A;  4ZX8 A;  4ZYQ A;  3KHX A;  4UF4 A;  1YW4 A;  2OR4 A;  3BHX A;  2XEF A;  3IFE A;  4OKO A;  2CIJ A;  1V6C A;  1TKF A;  2XEG A;  1AMP A;  4C9R A;  2RB7 A;  4PXC A;  1RTQ A;  2EK9 A;  4IK2 A;  3WC5 A;  2F7V A;  3T8W A;  1FNO A;  2AFU A;  1EE3 P;  2JEW A;  2PJC A;  2BCO A;  3FMC A;  4NGN A;  4OC4 A;  2Q4Z A;  4OC0 A;  3SJF A;  3RZA A;  5CBM A;  3H8F A;  4NJQ A;  3FJU A;  1VHE A;  4MHZ A;  4Q7A A;  2AFX A;  1BPM A;  2IJZ A;  5JM6 A;  2V8G A;  4MHN A;  4MHP A;  4P44 A;  4OC5 A;  5JH9 A;  2QVP A;  2GLJ A;  3NH5 A;  3FEE A;  3EIF A;  3B35 A;  1TKJ A;  2O4H A;  2Q51 A;  2PJ2 A;  2PJB A;  1Z5R A;  1QQ9 A;  5IR2 A;  5HVF A;  2V8D A;  2Q43 A;  3TX8 A;  2PE3 A;  4A39 A;  2PIY A;  4ZY1 A;  2EK8 A;  3RAM A;  2GP4 A;  1UWY A;  3SJE A;  1YME A;  3K2K A;  3D7H A;  4R76 A;  4DJL A;  2JBK A;  4EWT A;  4P10 A;  4TJV A;  1IGB A;  4P6Y A;  4UEF A;  3QNV A;  2VL1 A;  1LAN A;  3D4U A;  1ZG9 A;  3D7G A;  5IB9 A;  4C9E A;  2C6P A;  4NGM A;  4G1P A;  3NFZ A;  4B6Z A;  2C6C A;  3VAR A;  1HDQ A;  2G9D A;  2DEA A;  4C8P A;  1GYT A;  3KL9 A;  4LQG A;  3B2Y A;  2J9A A;  1ARL A;  2I3C A;  3B7I A;  3H8G A;  2CTC A;  2PJ4 A;  4NGP A;  1LFW A;  3DLJ A;  4WJB A;  1ZLH A;  4TJX A;  4C8A A;  4P4I A;  1VIX A;  4X3R A;  4UEZ A;  2PJ1 A;  4CPA A;  5LRG A;  3S9N A;  3NA6 A;  4ZY2 A;  4OC1 A;  2PVW A;  1XF1 A;  5D29 A;  2GU2 A;  1QMU A;  3GB0 A;  4C84 A;  1BLL E;  3IJ3 A;  1FT7 A;  4YWY A;  4OC3 A;  3LMS A;  3PFO A;  3PFE A;  2ZEM A;  5I4M A;  1CPX A;  2ZEG A;  1M4L A;  5LYF A;  1Y0Y A;  2EWB A;  1XRY A;  3HLP A;  3KR5 A;  4MCS A;  4O23 A;  4A37 A;  5LRJ A;  3CPA A;  3V7Z A;  4F9U A;  5HVH A;  4H2K A;  4MCP A;  2PJ6 A;  5CPA A;  2ZEO A;  3FVL A;  4C8F A;  2NYQ A;  4ZX9 A;  3JRU A;  2WZN A;  1R43 A;  4FAI A;  3D7F A;  3RBU A;  2CTB A;  4OP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...