4P4JA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor t33d
Total Genus 263
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
263
sequence length
696
structure length
686
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Glutamate carboxypeptidase 2
publication title Design of composite inhibitors targeting glutamate carboxypeptidase II: the importance of effector functionalities.
pubmed doi rcsb
source organism Homo sapiens
total genus 263
structure length 686
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2014-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4p4jA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4p4jA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4p4jA02
1EE3P 3B3WA 3RAMA 4UEZA 3MN8A 4P44A 4P45A 5J1QA 2F7VA 2IJZA 2PE3A 3BXMA 2ZEPA 5LYIA 4A38A 1F2OA 3H8EA 1BLLE 3IIBA 3KHZA 4MCQA 1Y0RA 3PB4X 3ISZA 1DE4C 2O53A 4NGPA 3S9LA 1Z8LA 2HC9A 1ARLA 4C9EA 2PRQA 1ARMA 1YMEA 4ZYQA 1CPXA 4OC3A 1XFOA 4MMOA 5I4MA 1F57A 3PBBA 4PQAA 2AFMA 1YLOA 2GREA 1XBUA 2EK9A 1CX8A 1Y9ZA 5HXDA 4C8CA 4DYOA 4MXUA 3LWUA 1VHEA 3NH5A 1NSAA 3WC5A 6CPAA 1YW6A 5LYLA 3RBUA 2XEJA 2Q43A 5JGFA 2C1CA 4CDKA 2VL1A 4ZY1A 2V8GA 5CBMA 4IAVA 2XEFA 3MRUA 3FEDA 5CPAA 1TF8A 2WZNA 2GLJA 3D7HA 1HEEA 4NGTA 3I6SA 3FX6A 3KQXA 4JYWA 3GUXA 4MHPA 2JBJA 4PXBA 1Z5RA 2CTBA 2PJ7A 3PFEA 2ZELA 1XF1A 4FUUA 3KR5A 4PPZA 3KHXA 4ONWA 3KGQA 1TF9A 4NJQA 4C8PA 1FT7A 4NJRA 4NFRA 3JRUA 3TX8A 2AFSA 4UEFA 4F9VA 2J9AA 3KZWA 4OKOA 3ISXA 5IB9A 2I3CA 4WWVA 4NGQA 2AFWA 4ZI6A 1TKFA 3H8GA 3PB7X 4MRIA 3SI0A 4LQGA 3EIFA 4OC4A 4MCPA 3V7ZA 2AFXA 4FBEA 5LYFA 2HB6A 3VH9A 2PJ8A 3BI0A 2GU2A 5D8NA 1ZG9A 4YN3A 3SJEA 2ZEMA 3ICUA 1CPSA 1PCAA 4DJLA 5D29A 1DTDA 1XRYA 2PVVA 4P4BA 4JZ0A 2GLFA 1RTQA 4OC2A 3B3SA 3D7GA 4G1PA 5K8MA 3LMSA 3IO1A 1LANA 2O4HA 1ZLHA 2PJ9A 2QVPA 4BD9A 2PJ2A 1WVMA 4DUKA 5K8OA 2CIJA 7CPAA 4MHZA 2ZEOA 3QNVA 2EWBA 2Q4ZA 1QMUA 1R43A 1XJOA 4PXCA 1GYTA 4OIDA 4IHMA 3WC6A 2PIYA 2BOAA 3CDXA 5HVHA 3S9NA 3BHXA 4OP4A 2OR4A 1Y7EA 2ZEDA 3PEIA 4C9AA 5K8PA 3FH4A 3NFZA 4R6TA 3FF3A 4MCSA 2PJ3A 1YW4A 3DLJA 2IMOA 4NGRA 2PJAA 3B3CA 4OC1A 1UWYA 1HDUA 3SJXA 3K9TA 3PBEA 4YWYA 3H8FA 3TC8A 1ZLIA 4OC0A 2CTCA 4P4IA 2RB7A 3DGVA 4C9UA 3CT9A 4MHYA 4MCRA 1VHOA 3B3VA 3IJ3A 1JQGA 2G9DA 1H8LA 5LRGA 2PCUA 1Z2LA 1FNOA 3D68A 2PJBA 3SJGA 4PXEA 2PVWA 4ZX8A 3SI1A 1ELLP 4TWEA 3NH8A 4ZY2A 1YSJA 2PJ5A 3PB9X 1BPNA 2IQ6A 3D66A 5LRJA 3HLPA 5JH9A 2F8HA 2ABZA 1TXRA 2C6PA 2BO9A 2NYQA 3VATA 4UEEA 4EMEA 2PIZA 3CPXA 2QYVA 4C8FA 1TKHA 3VARA 3B35A 3D7DA 3KQZA 3PB6X 2C6GA 4C99A 1KWMA 4C9RA 1LAPA 1Y0YA 2QJ8A 4P6YA 3WC7A 4UIBA 4R7MA 4C8TA 2V77A 2ZEGA 4FAIA 4TJXA 4TNUA 1CP7A 3IEHA 3L2NA 2AFOA 3I1UA 3T8WA 1LFWA 4R8FA 3GB0A 4OIWA 3BI1A 5F09A 2WYRA 4RUHA 2DEAA 1HDQA 4NGMA 3WT4A 4C86A 4A39A 3D7FA 2PJ4A 1CBXA 4O23A 1F2PA 5LYDA 1ZG7A 2Q51A 1CP6A 2PJCA 4OMEA 4H2KA 4WJBA 3KL9A 4P4EA 4R76A 4KSIA 3S9MA 3PRTA 4C8AA 4P4JA 5ELYA 2PJ6A 4AXVA 3KR4A 5DS0A 3KASA 2EK8A 4F8ZA 4P4DA 1PYTB 4X3RA 3IWWA 1AMPA 4C9VA 3D67A 4B6ZA 1QQ9A 2ZEEA 2NSMA 3K2KA 3SI2A 2XEIA 3FJUA 4EFDA 2V8HA 3RZAA 4UIAA 3PB8X 2PJ1A 5LRKA 2POKA 4NGSA 1TKJA 2ANPA 2OOTA 3IFEA 4FWUA 4PXDA 3NA6A 3FECA 2JEWA 1ELMP 4ZY0A 1ZG8A 2ZEFA 3D4UA 1AYEA 1VIXA 1BPMA 1XMBA 3B7IA 5HVFA 4NGNA 4A37A 4C84A 4IK2A 3PFOA 3FVLA 4CPAA 4X8IA 1R3NA 3CPAA 4EWTA 3B3TA 4KNGE 4P4FA 3KI9A 1Q7LA 4YU9A 4C85A 3N5FA 4GM5A 4OC5A 4A94A 4UF4A 2C6CA 3VTAA 1IGBA 3SJFA 2ZOGA 2XEGA 8CPAA 1BAVA 3B2YA 5JM6A 4CDJA 3I74A 4Z65A 4TJVA 4Q7AA 1M4LA 5HVGA 3FEEA 2ZENA 1OBRA 4ZX9A 2PJ0A 3WABA 3NH4A 3GLJA 5K8NA 1VGYA 1LOKA 1LCPA 2V8DA 3FMCA 2FVGA 2ZOFA 2AFZA 4K3NA 1V6CA 5THWA 1LAMA 3HUVA 2V8VA 4W9YA 4C8UA 1CG2A 3V38A 1IY7A 2AFUA 4MHNA 4P10A 4X2TA 2JBKA 4F9UA 2ZEHA 3IC1A 2RFHA 2BCOA 2CF4A
chains in the Genus database with same CATH superfamily
4MHDA 4OLLA 3TLZA 1EE3P 4KOVA 3B3WA 3TO7A 4I49A 5CNPA 3RAMA 4UEZA 5IX3A 1PU9A 3MN8A 4QB9A 4UCPA 3OB1B 4P44A 4NSQA 1CM0A 4P45A 5J1QA 1I1DA 2F7VA 2IJZA 2PE3A 3BXMA 2OZGA 1S5KA 3PP9A 4IIYA 3JUWA 4PV6A 2ZEPA 4M8DA 3NE8A 5LYIA 4A38A 3OWCA 1F2OA 4UBRA 2VZYA 4HNXB 3DSBA 3H8EA 1BLLE 4K30A 3IIBA 3KHZA 4MCQA 5C82A 1M4DA 1Y0RA 4FD5A 2AJ6A 3PB4X 3D2MA 3ISZA 1DE4C 2O53A 4NGPA 4CAFA 3S9LA 4CGNA 3D3SA 1Z8LA 5DWNA 5AG5A 2HC9A 1ARLA 2XPOA 4C9EA 4NXYA 3PGPA 1QSMA 2PRQA 1ARMA 3T0TA 1YMEA 4MI1A 2DLAA 3B8GA 3BJ7A 1CPXA 3R9FA 4ZYQA 3T07A 2IL4A 4OC3A 5BY0A 1XFOA 2HWGA 4MMOA 5I4MA 3FXTA 1F57A 3PBBA 1JWQA 2PR1A 3CXPA 4PSXA 4PQAA 5J8FA 2G3TA 2AFMA 4LQ6A 4LUAA 2GIVA 1YLOA 1YR0A 1XBUA 2EK9A 2GREA 3GY9A 4QC6A 2O28A 2FCKA 1CX8A 2OZUA 5HXDA 4CAXA 2VXKA 1Y9ZA 4C8CA 4DYOA 3GYAA 3PZJA 4MXUA 1QSOA 3LWUA 2ODFA 1Z4RA 2EZBA 3F5BA 4BINA 5A27A 1VHEA 3NH5A 4KSAA 4M3SA 5C88A 5JQ4A 1NSAA 1L0CA 3WC5A 2VBQA 6CPAA 4KZTA 5EC4A 1YW6A 4UA3A 5LYLA 3RBUA 3TLAA 2QMLA 2XEJA 2Q43A 5JGFA 2C1CA 1BOBA 2P6GA 4CDKA 2REFA 2VL1A 4ZY1A 2V8GA 3HMJG 5CBMA 4IAVA 2KCWA 4H6UA 2XEFA 2OU2A 3MRUA 2A4NA 3EO4A 3FEDA 1ZRSA 4AG7A 5CPAA 4A95A 4CGLA 1TF8A 4C2YA 2CNTA 1Z8WA 2GANA 2WZNA 4M6GA 1JDBC 4R57A 4B10A 1C3OB 2GLJA 2VZZA 3D8PA 3A9LA 1GGOA 3D7HA 1HEEA 1QSTA 2FSRA 3S6FA 4NGTA 1IYKA 2EO8A 3FX6A 3KQXA 5E96A 1J3LA 3I6SA 4UCNA 2D0PA 1MJBA 4JVOA 3HPGG 4JYWA 3GUXA 4MHPA 1S60A 4M6IA 2JBJA 4PXBA 4FD6A 3F0AA 1Z5RA 2CTBA 2VKZG 2R8VA 4KOSA 4MY3A 2PJ7A 3PFEA 2ZELA 2ZW5A 1XF1A 2G0BA 3KR5A 4FUUA 4KOTA 1I12A 4PPZA 2P6FA 3KHXA 3QB8A 1A9XB 4ONWA 3R9EA 2I00A 1B87A 2VQYA 3KGQA 4KOUA 2JDDA 5G20A 2NMTA 2YJVA 2D4OA 3E0KA 2K5TA 1TF9A 1YVHA 4F0XA 1S7KA 4CYPA 4NJQA 4C8PA 1X12A 1FY7A 1FT7A 4NJRA 2BCOA 4NFRA 3JRUA 3TX8A 2FXFA 3PLFB 4A32A 2R7HA 4PK3A 3BUXB 1J4JA 1KUYA 2AFSA 2D4PA 4UEFA 4F9VA 1Q2YA 1Y9WA 2J9AA 3KZWA 4KLWA 4M85A 3ISXA 4OKOA 3R95A 4AVCA 4CAEA 5IB9A 2I3CA 1VBGA 3EZEA 4WWVA 4NGQA 1Z8XA 2Z11A 2WPXA 2AFWA 4KS9A 4KVOE 4ZI6A 1CJWA 1TKFA 3H8GA 2UV8G 3PB7X 4JD6A 4MRIA 3SI0A 4A4BA 4LQGA 3TTHA 3EIFA 4OC4A 5G21A 1YX0A 4MCPA 2YNCC 1XE4A 5G1ZA 3TLYA 3V7ZA 2YGWA 2AFXA 1S7LA 2I79A 4FBEA 1Z4EA 5LYFA 4R3LA 5EBVA 4B11A 1R61A 4CZ1A 2HB6A 2X0SA 1LRZA 3C26A 4BMHA 5HH1A 4BPUB 3VH9A 4EVYA 2PJ8A 2Z3OA 3TO6A 3BI0A 2GU2A 3ZZIA 5D8NA 1B47A 3LD2A 2ZW7A 1ZG9A 3R9GA 3WR7A 4E0AA 4ONUA 2ZW6A 4XPDB 3IWEA 3CXSA 4YN3A 3SJEA 1M4GA 1XEBA 2ZEMA 4U9YA 5IV0A 2CNMA 3ICUA 1CPSA 4B5OA 4MY0A 2VI7A 1PCAA 3C8OA 4C68A 4DJLA 5D29A 4DNCA 1DTDA 4U5YA 1CE8B 3BUNB 1AUGA 4C7IA 2ZXVA 3V8IA 1XRYA 3FYNA 4KORA 1BXRB 2PVVA 4BTFA 4B14A 4P4BA 3O8ZA 4JZ0A 1IIDA 2GLFA 1RTQA 3QAHA 4J3GA 4CAVA 1IOIA 4RS2A 3TOBA 4OC2A 3B3SA 3D7GA 4G1PA 5K8MA 4U9ZA 3LMSA 3IO1A 1LANA 2PDOA 1NMTA 2O4HA 4QVTA 1ON0A 1ZLHA 1YREA 1RXTA 2PJ9A 5IB0A 2WPWA 2QVPA 2Q4VA 4XPKA 2PJ2A 4MFKA 4YRHA 3RYOA 4BD9A 4ZGYB 2ATRA 3N7ZA 1Z8TA 3TOAA 1WVMA 4DUKA 4CS0B 5K8OA 2PCNA 4E2AA 2CIJA 4YGOA 5J3XA 4MFQA 5AGEA 1MJ9A 7CPAA 2PQ8A 4MHZA 5FVJA 2ZEOA 3QNVA 2MP0A 3FRMA 5AG4A 2EWBA 2Q4ZA 1M6VB 4E94A 1QMUA 1R43A 3NOJA 5BWAB 1KZFA 1XJOA 2YNDA 5G22A 4PXCA 1M1DA 4UFWA 3KRVA 4RN7A 1GYTA 4J0NA 5I0CA 2Z3KA 4OIDA 2EUIA 2FS5A 4IHMA 4R3KA 1YQEA 3WC6A 2PIYA 3TT2A 3T5MA 2Q4YA 5H84A 2AE6A 4AG9A 3FBUA 4H1HA 4AB7A 2BOAA 2YJTA 4CYNA 2R98A 5HMNA 1M44A 3TCVA 2J8MA 1ZYMA 4A2ZA 1VKCA 3FIXA 2BEIA 1A2ZA 5F48A 3VWEA 1KEEB 3CDXA 3R96A 3S9NA 2QECA 5HVHA 3BHXA 4OP4A 3TLBA 2OR4A 2DPSA 4CYOA 1Y7EA 4FD4A 2ZEDA 3PEIA 4C9AA 3NFQA 3DDDA 5J8CA 5K8PA 3FH4A 3NFZA 4R6TA 2FM4A 4CGMA 3FF3A 4MCSA 1P0HA 1CS0B 1WWZA 3U88C 5F5XA 2PJ3A 1YW4A 1XOVA 3OP0A 1XF8A 2B3VA 3DLJA 2IMOA 4HNYB 4HPSA 4UWJA 4NGRA 2PJAA 3B3CA 4OC1A 3DNSA 3NE7A 2B3UA 2OZHA 4JWPA 1UWYA 2Q04A 2X7BA 4E5SA 1YVOA 3F8KA 4PSWA 1HDUA 3SJXA 1Z9EA 3R1KA 3K9TA 4L8AA 3PBEA 4YWYA 5KTAA 3IU2A 3H8FA 2HV2A 5AG6A 3K4IA 2Z3LA 4XPLA 1VHSA 2BL1A 2FL4A 2Y1NA 1ZLIA 2DPTA 2HQYA 4OC0A 5DWMA 1RO5A 2CTCA 3I9SA 3TC8A 4P4IA 3VRPA 2HROA 2RB7A 3DGVA 2CY2A 4C9UA 5AG7A 2FE7A 3CT9A 3W91A 4AVBA 2WUUA 4MHYA 1KC7A 1B6BA 4MCRA 3EFAA 3W6XA 3EY5A 2B4BA 3IGRA 4KVME 1R57A 1VHOA 3B3VA 3IJ3A 1JQGA 1XMTA 2G9DA 3TLEA 3G8WA 4UCMA 3S6KA 1GHEA 1H8LA 3SHPA 1X10A 2PCUA 5LRGA 1Z2LA 1FNOA 3D68A 3DR6A 4Q36A 2PJBA 3OAKA 3SJGA 4KLVA 4RR2B 4MFZA 4PXEA 2PVWA 4Y49C 2Z10A 4ZX8A 3SI1A 4JXRA 1ELLP 4TWEA 1Q5XA 3NH8A 2HI6A 4ZY2A 2XPPA 3P2HA 5JPHA 3D2PA 3GJZA 3JTKA 4A31A 4II9A 1QSNA 4GPLB 1YSJA 2PJ5A 1KBLA 4H6ZA 3PB9X 1BPNA 2IQ6A 1SQHA 2P0WA 3D66A 3HLPA 5LRJA 5JH9A 2F8HA 1ZL0A 2ABZA 2B4JC 1S7FA 1TXRA 3MGDA 1FBVA 2C6PA 1Q2DA 2BO9A 2NYQA 3VATA 4CYQA 2D0OA 4UEEA 4EMEA 1VBHA 2PIZA 3CPXA 1NBWA 2QYVA 4C8FA 4IF5A 1TKHA 2OB0A 3VARA 2PR8A 4QBJA 3B35A 3D7DA 3KQZA 3PB6X 1NE9A 3T9YA 2C6GA 4INJA 4C99A 1KWMA 3VRNA 5F9MA 3TYXA 2Z3MA 4C9RA 4CO9A 1YK3A 1LAPA 1Y0YA 1IICA 2QJ8A 4ZBGA 2YNCA 3VGOA 1XIXA 3P2FA 4P6YA 3TLGA 3WC7A 4UIBA 2G3AA 2EBJA 5ISVA 3ZJ0A 3PFVA 5KTDA 4R7MA 3OB2B 4C2XA 4F0YA 2DXQA 2V77A 2ZEGA 4FAIA 3CZXA 4TJXA 4TNUA 4C8TA 2OH1A 2Q44A 1CP7A 3DR8A 4YFJA 2Q7SA 4CAWA 3T90A 3IEHA 3L2NA 2GP4A 2AFOA 3I1UA 4FD7A 3T8WA 1LFWA 4R8FA 3GB0A 1JDEA 4B5PA 1T36B 1NXJA 4OIWA 1Y7RA 2XPLA 3BI1A 1PUAA 5F09A 2WYRA 4KUAA 1EO0A 3SXNA 2DEAA 4RUHA 1HDQA 4B13A 2E28A 2VEZA 4R9MA 4NGMA 2J8RA 4NF1A 4XNHC 3EC4A 3GIUA 4KVXA 3WT4A 4A39A 4C86A 2Y0MA 5JYBA 3D7FA 2HUZA 1CBXA 1UFHA 2P6EA 2PJ4A 3K9UA 5A28A 4MJXA 4O23A 2Z3NA 4IIXA 1I21A 1F2PA 5LYDA 1EZBA 1ZG7A 2Q51A 4B12A 1CP6A 2PJCA 4OMEA 2WSAA 4H2KA 4OADA 3KL9A 4P4EA 4R76A 4WJBA 4KSIA 3S9MA 3VWDA 4C2ZA 2C5QA 3PRTA 4NCZA 4C8AA 4COBA 4P4JA 5ELYA 2PJ6A 1Z9UA 4HKFA 4AXVA 3KR4A 5DS0A 3VRQA 2FIWA 2FT0A 2CBLA 3KASA 4UFXA 4A33A 2GFQA 2EK8A 4Q38A 4CGOA 4F8ZA 4NEXA 4P4DA 1PYTB 2YNEA 4MI4A 4R87A 3RO0A 1IOFA 3TFYA 4X3RA 3IWWA 2EVNA 5EMIA 1AMPA 1EZAA 4C9VA 3D67A 3G3SA 3SXOA 4KSFA 4B6ZA 1QQ9A 2Q0YA 2ZEEA 2NSMA 3GKRA 5KTCA 3K2KA 3SI2A 3LACA 2XEIA 2EZAA 3H5ZA 4KUBA 3TO9A 1BO4A 3BUWB 2B4DB 1N71A 2DF5A 3FJUA 5JVLA 2EZCA 4F6AA 1YVKA 4EFDA 2V8HA 1IB1E 3HPHE 4JLYA 3EZBA 4E8OA 4RI1A 3RZAA 5F46A 3W6SA 4A4CA 5HKZA 4UIAA 1MJAA 1OZPA 3TE4A 3PB8X 2PJ1A 4ORFA 1Y9KA 2REEA 4QUSA 4XPDC 5LRKA 2POKA 4Y49B 3SR3A 4NGSA 3T05A 1TKJA 2ANPA 2OOTA 3IFEA 1NSLA 3UY5A 2B5GB 4FWUA 4PXDA 3CXQA 3FECA 3NA6A 2JEWA 4MFJA 1ELMP 4MJ8A 4C7HA 4ZY0A 1ZG8A 4BPXB 2JLMA 2QIRA 2ZEFA 2N3AB 3D4UA 1AYEA 1VIXA 3TLGB 3TLCA 3BUOB 1BPMA 4GS4A 4JJXA 1XMBA 4MBUA 3BLNA 4UWIA 3B7IA 1VI4A 5HVFA 2C27A 5F47A 4NGNA 3EXNA 4A37A 5F13A 4L89A 4UFVA 4C84A 1S7NA 1DIKA 4IK2A 3JVNA 2F5IA 4CGPA 1P4NA 3PFOA 3FVLA 4CPAA 3LODA 1R3NA 1Q2CA 3CPAA 3B3TA 4X8IA 4EWTA 3FB3A 4KNGE 4B5PB 3F9KC 1IU8A 4P4FA 2GE3A 2Y1MA 1Q7LA 3KI9A 4YU9A 4C85A 3N5FA 1KUVA 1MK4A 4GM5A 2Z0ZA 2J8NA 1V0CA 4OC5A 4A94A 2B0AA 4UF4A 2AUNA 1ZO0A 3S6HA 2C6CA 1TIQA 1YLEA 4PK2A 3VTAA 1IGBA 3VRRA 2XPNA 4H89A 3H4QA 2PRBA 4A30A 4IUSA 3SJFA 2ZOGA 2XEGA 2CNSA 8CPAA 1BAVA 3B2YA 3S6GA 4GXHA 2AUMA 5JM6A 1M4IA 1KUXA 2R1IA 3I74A 4Z65A 4CDJA 2B4DA 4KOWA 4Q7AA 4XNHB 4TJVA 5HKYA 1M4LA 2B58A 4BPWB 3IU1A 5HVGA 3FEEA 4JXQA 2ZENA 1OBRA 1K4JA 2RC4A 4ZX9A 3BUMB 2PJ0A 1WJTA 2ZW4A 3KKWA 1U6MA 3QAYA 1YGHA 2BSWA 2CXAA 3BJ8A 4KOXA 3WABA 4OAEA 3NH4A 3GLJA 4AVAA 1C30B 5K99A 5H86A 5IR2A 4M6HA 1VGYA 1LOKA 5K8NA 4MFPA 5AXIA 5FD8A 1LCPA 2JEVA 1IYLA 2B5GA 2V8DA 2ZPAA 3FMCA 3IWGA 2FVGA 2ZOFA 5GCNA 4KOYA 2AFZA 4K3NA 1V6CA 5THWA 1LAMA 3HUVA 3ZNIA 4X5KA 2V8VA 1WK4A 4W9YA 4CRYB 4C8UA 5F1YA 3U1BA 1CG2A 5HKWA 2H5MA 3FNCA 4MFLA 2PSWA 4EYSA 5F49A 3RNZA 4BBHA 1S3ZA 4CRZB 2PC1A 2R82A 3I3GA 3G23A 2ZEHA 2JDCA 3V38A 1IY7A 2AFUA 2Q7BA 3VROA 4HNWB 2DIKA 4MHNA 4P10A 4LX9A 2JBKA 2BUEA 4X2TA 3EZAA 4COGA 2ARHA 4F9UA 2OLSA 2FIAA 3IC1A 2RFHA 1QSRA 2CF4A 2Z3PA 3PT1A
chains in the Genus database with same CATH topology
1EE3P 3B3WA 3RAMA 4UEZA 3MN8A 4P44A 4P45A 5J1QA 2F7VA 2IJZA 2PE3A 3BXMA 2ZEPA 5LYIA 4A38A 1F2OA 3H8EA 1BLLE 3IIBA 3KHZA 4MCQA 1Y0RA 3PB4X 3ISZA 1DE4C 2O53A 4NGPA 3S9LA 1Z8LA 2HC9A 1ARLA 4C9EA 2PRQA 1ARMA 1YMEA 4ZYQA 1CPXA 4OC3A 1XFOA 4MMOA 5I4MA 1F57A 3PBBA 4PQAA 2AFMA 1YLOA 2GREA 1XBUA 2EK9A 1CX8A 1Y9ZA 5HXDA 4C8CA 4DYOA 4MXUA 3LWUA 1VHEA 3NH5A 1NSAA 3WC5A 6CPAA 1YW6A 5LYLA 3RBUA 2XEJA 2Q43A 5JGFA 2C1CA 4CDKA 2VL1A 4ZY1A 2V8GA 5CBMA 4IAVA 2XEFA 3MRUA 3FEDA 5CPAA 1TF8A 2WZNA 2GLJA 3D7HA 1HEEA 4NGTA 3I6SA 3FX6A 3KQXA 4JYWA 3GUXA 4MHPA 2JBJA 4PXBA 1Z5RA 2CTBA 2PJ7A 3PFEA 2ZELA 1XF1A 4FUUA 3KR5A 4PPZA 3KHXA 4ONWA 3KGQA 1TF9A 4NJQA 4C8PA 1FT7A 4NJRA 4NFRA 3JRUA 3TX8A 2AFSA 4UEFA 4F9VA 2J9AA 3KZWA 4OKOA 3ISXA 5IB9A 2I3CA 4WWVA 4NGQA 2AFWA 4ZI6A 1TKFA 3H8GA 3PB7X 4MRIA 3SI0A 4LQGA 3EIFA 4OC4A 4MCPA 3V7ZA 2AFXA 4FBEA 5LYFA 2HB6A 3VH9A 2PJ8A 3BI0A 2GU2A 5D8NA 1ZG9A 4YN3A 3SJEA 2ZEMA 3ICUA 1CPSA 1PCAA 4DJLA 5D29A 1DTDA 1XRYA 2PVVA 4P4BA 4JZ0A 2GLFA 1RTQA 4OC2A 3B3SA 3D7GA 4G1PA 5K8MA 3LMSA 3IO1A 1LANA 2O4HA 1ZLHA 2PJ9A 2QVPA 4BD9A 2PJ2A 1WVMA 4DUKA 5K8OA 2CIJA 7CPAA 4MHZA 2ZEOA 3QNVA 2EWBA 2Q4ZA 1QMUA 1R43A 1XJOA 4PXCA 1GYTA 4OIDA 4IHMA 3WC6A 2PIYA 2BOAA 3CDXA 5HVHA 3S9NA 3BHXA 4OP4A 2OR4A 1Y7EA 2ZEDA 3PEIA 4C9AA 5K8PA 3FH4A 3NFZA 4R6TA 3FF3A 4MCSA 2PJ3A 1YW4A 3DLJA 2IMOA 4NGRA 2PJAA 3B3CA 4OC1A 1UWYA 1HDUA 3SJXA 3K9TA 3PBEA 4YWYA 3H8FA 3TC8A 1ZLIA 4OC0A 2CTCA 4P4IA 2RB7A 3DGVA 4C9UA 3CT9A 4MHYA 4MCRA 1VHOA 3B3VA 3IJ3A 1JQGA 2G9DA 1H8LA 5LRGA 2PCUA 1Z2LA 1FNOA 3D68A 2PJBA 3SJGA 4PXEA 2PVWA 4ZX8A 3SI1A 1ELLP 4TWEA 3NH8A 4ZY2A 1YSJA 2PJ5A 3PB9X 1BPNA 2IQ6A 3D66A 5LRJA 3HLPA 5JH9A 2F8HA 2ABZA 1TXRA 2C6PA 2BO9A 2NYQA 3VATA 4UEEA 4EMEA 2PIZA 3CPXA 2QYVA 4C8FA 1TKHA 3VARA 3B35A 3D7DA 3KQZA 3PB6X 2C6GA 4C99A 1KWMA 4C9RA 1LAPA 1Y0YA 2QJ8A 4P6YA 3WC7A 4UIBA 4R7MA 4C8TA 2V77A 2ZEGA 4FAIA 4TJXA 4TNUA 1CP7A 3IEHA 3L2NA 2GP4A 2AFOA 3I1UA 3T8WA 1LFWA 4R8FA 3GB0A 4OIWA 3BI1A 5F09A 2WYRA 4RUHA 2DEAA 1HDQA 4NGMA 3WT4A 4C86A 4A39A 3D7FA 2PJ4A 1CBXA 4O23A 1F2PA 5LYDA 1ZG7A 2Q51A 1CP6A 2PJCA 4OMEA 4H2KA 4WJBA 3KL9A 4P4EA 4R76A 4KSIA 3S9MA 2C5QA 3PRTA 4C8AA 4P4JA 5ELYA 2PJ6A 4AXVA 3KR4A 5DS0A 3KASA 2EK8A 4F8ZA 4P4DA 1PYTB 4X3RA 3IWWA 1AMPA 4C9VA 3D67A 4B6ZA 1QQ9A 2ZEEA 2NSMA 3K2KA 3SI2A 2XEIA 3FJUA 4EFDA 2V8HA 3RZAA 4UIAA 3PB8X 2PJ1A 5LRKA 2POKA 4NGSA 1TKJA 2ANPA 2OOTA 3IFEA 4FWUA 4PXDA 3NA6A 3FECA 2JEWA 1ELMP 4ZY0A 1ZG8A 2ZEFA 3D4UA 1AYEA 1VIXA 1BPMA 1XMBA 3B7IA 5HVFA 4NGNA 4A37A 4C84A 4IK2A 3PFOA 3FVLA 4CPAA 4X8IA 1R3NA 3CPAA 4EWTA 3B3TA 4KNGE 4P4FA 3KI9A 1Q7LA 4YU9A 4C85A 3N5FA 4GM5A 4OC5A 4A94A 4UF4A 2C6CA 3VTAA 1IGBA 3SJFA 2ZOGA 2XEGA 8CPAA 1BAVA 3B2YA 5JM6A 4CDJA 3I74A 4Z65A 4TJVA 4Q7AA 1M4LA 5HVGA 3FEEA 2ZENA 1OBRA 4ZX9A 2PJ0A 3WABA 3NH4A 3GLJA 5IR2A 5K8NA 1VGYA 1LOKA 1LCPA 2V8DA 3FMCA 2FVGA 2ZOFA 2AFZA 4K3NA 1V6CA 5THWA 1LAMA 3HUVA 2V8VA 4W9YA 4C8UA 1CG2A 3V38A 1IY7A 2AFUA 4MHNA 4P10A 4X2TA 2JBKA 4F9UA 2ZEHA 3IC1A 2RFHA 2BCOA 2CF4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EE3 P;  3B3W A;  3RAM A;  4UEZ A;  3MN8 A;  4P44 A;  4P45 A;  5J1Q A;  2F7V A;  2IJZ A;  2PE3 A;  3BXM A;  2ZEP A;  5LYI A;  4A38 A;  1F2O A;  3H8E A;  1BLL E;  3IIB A;  3KHZ A;  4MCQ A;  1Y0R A;  3PB4 X;  3ISZ A;  1DE4 C;  2O53 A;  4NGP A;  3S9L A;  1Z8L A;  2HC9 A;  1ARL A;  4C9E A;  2PRQ A;  1ARM A;  1YME A;  4ZYQ A;  1CPX A;  4OC3 A;  1XFO A;  4MMO A;  5I4M A;  1F57 A;  3PBB A;  4PQA A;  2AFM A;  1YLO A;  2GRE A;  1XBU A;  2EK9 A;  1CX8 A;  1Y9Z A;  5HXD A;  4C8C A;  4DYO A;  4MXU A;  3LWU A;  1VHE A;  3NH5 A;  1NSA A;  3WC5 A;  6CPA A;  1YW6 A;  5LYL A;  3RBU A;  2XEJ A;  2Q43 A;  5JGF A;  2C1C A;  4CDK A;  2VL1 A;  4ZY1 A;  2V8G A;  5CBM A;  4IAV A;  2XEF A;  3MRU A;  3FED A;  5CPA A;  1TF8 A;  2WZN A;  2GLJ A;  3D7H A;  1HEE A;  4NGT A;  3I6S A;  3FX6 A;  3KQX A;  4JYW A;  3GUX A;  4MHP A;  2JBJ A;  4PXB A;  1Z5R A;  2CTB A;  2PJ7 A;  3PFE A;  2ZEL A;  1XF1 A;  4FUU A;  3KR5 A;  4PPZ A;  3KHX A;  4ONW A;  3KGQ A;  1TF9 A;  4NJQ A;  4C8P A;  1FT7 A;  4NJR A;  4NFR A;  3JRU A;  3TX8 A;  2AFS A;  4UEF A;  4F9V A;  2J9A A;  3KZW A;  4OKO A;  3ISX A;  5IB9 A;  2I3C A;  4WWV A;  4NGQ A;  2AFW A;  4ZI6 A;  1TKF A;  3H8G A;  3PB7 X;  4MRI A;  3SI0 A;  4LQG A;  3EIF A;  4OC4 A;  4MCP A;  3V7Z A;  2AFX A;  4FBE A;  5LYF A;  2HB6 A;  3VH9 A;  2PJ8 A;  3BI0 A;  2GU2 A;  5D8N A;  1ZG9 A;  4YN3 A;  3SJE A;  2ZEM A;  3ICU A;  1CPS A;  1PCA A;  4DJL A;  5D29 A;  1DTD A;  1XRY A;  2PVV A;  4P4B A;  4JZ0 A;  2GLF A;  1RTQ A;  4OC2 A;  3B3S A;  3D7G A;  4G1P A;  5K8M A;  3LMS A;  3IO1 A;  1LAN A;  2O4H A;  1ZLH A;  2PJ9 A;  2QVP A;  4BD9 A;  2PJ2 A;  1WVM A;  4DUK A;  5K8O A;  2CIJ A;  7CPA A;  4MHZ A;  2ZEO A;  3QNV A;  2EWB A;  2Q4Z A;  1QMU A;  1R43 A;  1XJO A;  4PXC A;  1GYT A;  4OID A;  4IHM A;  3WC6 A;  2PIY A;  2BOA A;  3CDX A;  5HVH A;  3S9N A;  3BHX A;  4OP4 A;  2OR4 A;  1Y7E A;  2ZED A;  3PEI A;  4C9A A;  5K8P A;  3FH4 A;  3NFZ A;  4R6T A;  3FF3 A;  4MCS A;  2PJ3 A;  1YW4 A;  3DLJ A;  2IMO A;  4NGR A;  2PJA A;  3B3C A;  4OC1 A;  1UWY A;  1HDU A;  3SJX A;  3K9T A;  3PBE A;  4YWY A;  3H8F A;  3TC8 A;  1ZLI A;  4OC0 A;  2CTC A;  4P4I A;  2RB7 A;  3DGV A;  4C9U A;  3CT9 A;  4MHY A;  4MCR A;  1VHO A;  3B3V A;  3IJ3 A;  1JQG A;  2G9D A;  1H8L A;  5LRG A;  2PCU A;  1Z2L A;  1FNO A;  3D68 A;  2PJB A;  3SJG A;  4PXE A;  2PVW A;  4ZX8 A;  3SI1 A;  1ELL P;  4TWE A;  3NH8 A;  4ZY2 A;  1YSJ A;  2PJ5 A;  3PB9 X;  1BPN A;  2IQ6 A;  3D66 A;  5LRJ A;  3HLP A;  5JH9 A;  2F8H A;  2ABZ A;  1TXR A;  2C6P A;  2BO9 A;  2NYQ A;  3VAT A;  4UEE A;  4EME A;  2PIZ A;  3CPX A;  2QYV A;  4C8F A;  1TKH A;  3VAR A;  3B35 A;  3D7D A;  3KQZ A;  3PB6 X;  2C6G A;  4C99 A;  1KWM A;  4C9R A;  1LAP A;  1Y0Y A;  2QJ8 A;  4P6Y A;  3WC7 A;  4UIB A;  4R7M A;  4C8T A;  2V77 A;  2ZEG A;  4FAI A;  4TJX A;  4TNU A;  1CP7 A;  3IEH A;  3L2N A;  2AFO A;  3I1U A;  3T8W A;  1LFW A;  4R8F A;  3GB0 A;  4OIW A;  3BI1 A;  5F09 A;  2WYR A;  4RUH A;  2DEA A;  1HDQ A;  4NGM A;  3WT4 A;  4C86 A;  4A39 A;  3D7F A;  2PJ4 A;  1CBX A;  4O23 A;  1F2P A;  5LYD A;  1ZG7 A;  2Q51 A;  1CP6 A;  2PJC A;  4OME A;  4H2K A;  4WJB A;  3KL9 A;  4P4E A;  4R76 A;  4KSI A;  3S9M A;  3PRT A;  4C8A A;  4P4J A;  5ELY A;  2PJ6 A;  4AXV A;  3KR4 A;  5DS0 A;  3KAS A;  2EK8 A;  4F8Z A;  4P4D A;  1PYT B;  4X3R A;  3IWW A;  1AMP A;  4C9V A;  3D67 A;  4B6Z A;  1QQ9 A;  2ZEE A;  2NSM A;  3K2K A;  3SI2 A;  2XEI A;  3FJU A;  4EFD A;  2V8H A;  3RZA A;  4UIA A;  3PB8 X;  2PJ1 A;  5LRK A;  2POK A;  4NGS A;  1TKJ A;  2ANP A;  2OOT A;  3IFE A;  4FWU A;  4PXD A;  3NA6 A;  3FEC A;  2JEW A;  1ELM P;  4ZY0 A;  1ZG8 A;  2ZEF A;  3D4U A;  1AYE A;  1VIX A;  1BPM A;  1XMB A;  3B7I A;  5HVF A;  4NGN A;  4A37 A;  4C84 A;  4IK2 A;  3PFO A;  3FVL A;  4CPA A;  4X8I A;  1R3N A;  3CPA A;  4EWT A;  3B3T A;  4KNG E;  4P4F A;  3KI9 A;  1Q7L A;  4YU9 A;  4C85 A;  3N5F A;  4GM5 A;  4OC5 A;  4A94 A;  4UF4 A;  2C6C A;  3VTA A;  1IGB A;  3SJF A;  2ZOG A;  2XEG A;  8CPA A;  1BAV A;  3B2Y A;  5JM6 A;  4CDJ A;  3I74 A;  4Z65 A;  4TJV A;  4Q7A A;  1M4L A;  5HVG A;  3FEE A;  2ZEN A;  1OBR A;  4ZX9 A;  2PJ0 A;  3WAB A;  3NH4 A;  3GLJ A;  5K8N A;  1VGY A;  1LOK A;  1LCP A;  2V8D A;  3FMC A;  2FVG A;  2ZOF A;  2AFZ A;  4K3N A;  1V6C A;  5THW A;  1LAM A;  3HUV A;  2V8V A;  4W9Y A;  4C8U A;  1CG2 A;  3V38 A;  1IY7 A;  2AFU A;  4MHN A;  4P10 A;  4X2T A;  2JBK A;  4F9U A;  2ZEH A;  3IC1 A;  2RFH A;  2BCO A;  2CF4 A; 
#chains in the Genus database with same CATH topology
 4MHD A;  4OLL A;  3TLZ A;  1EE3 P;  4KOV A;  3B3W A;  3TO7 A;  4I49 A;  5CNP A;  3RAM A;  4UEZ A;  5IX3 A;  1PU9 A;  3MN8 A;  4QB9 A;  4UCP A;  3OB1 B;  4P44 A;  4NSQ A;  1CM0 A;  4P45 A;  5J1Q A;  1I1D A;  2F7V A;  2IJZ A;  2PE3 A;  3BXM A;  2OZG A;  1S5K A;  3PP9 A;  4IIY A;  3JUW A;  4PV6 A;  2ZEP A;  4M8D A;  3NE8 A;  5LYI A;  4A38 A;  3OWC A;  1F2O A;  4UBR A;  2VZY A;  4HNX B;  3DSB A;  3H8E A;  1BLL E;  4K30 A;  3IIB A;  3KHZ A;  4MCQ A;  5C82 A;  1M4D A;  1Y0R A;  4FD5 A;  2AJ6 A;  3PB4 X;  3D2M A;  3ISZ A;  1DE4 C;  2O53 A;  4NGP A;  4CAF A;  3S9L A;  4CGN A;  3D3S A;  1Z8L A;  5DWN A;  5AG5 A;  2HC9 A;  1ARL A;  2XPO A;  4C9E A;  4NXY A;  3PGP A;  1QSM A;  2PRQ A;  1ARM A;  3T0T A;  1YME A;  4MI1 A;  2DLA A;  3B8G A;  3BJ7 A;  1CPX A;  3R9F A;  4ZYQ A;  3T07 A;  2IL4 A;  4OC3 A;  5BY0 A;  1XFO A;  2HWG A;  4MMO A;  5I4M A;  3FXT A;  1F57 A;  3PBB A;  1JWQ A;  2PR1 A;  3CXP A;  4PSX A;  4PQA A;  5J8F A;  2G3T A;  2AFM A;  4LQ6 A;  4LUA A;  2GIV A;  1YLO A;  1YR0 A;  1XBU A;  2EK9 A;  2GRE A;  3GY9 A;  4QC6 A;  2O28 A;  2FCK A;  1CX8 A;  2OZU A;  5HXD A;  4CAX A;  2VXK A;  1Y9Z A;  4C8C A;  4DYO A;  3GYA A;  3PZJ A;  4MXU A;  1QSO A;  3LWU A;  2ODF A;  1Z4R A;  2EZB A;  3F5B A;  4BIN A;  5A27 A;  1VHE A;  3NH5 A;  4KSA A;  4M3S A;  5C88 A;  5JQ4 A;  1NSA A;  1L0C A;  3WC5 A;  2VBQ A;  6CPA A;  4KZT A;  5EC4 A;  1YW6 A;  4UA3 A;  5LYL A;  3RBU A;  3TLA A;  2QML A;  2XEJ A;  2Q43 A;  5JGF A;  2C1C A;  1BOB A;  2P6G A;  4CDK A;  2REF A;  2VL1 A;  4ZY1 A;  2V8G A;  3HMJ G;  5CBM A;  4IAV A;  2KCW A;  4H6U A;  2XEF A;  2OU2 A;  3MRU A;  2A4N A;  3EO4 A;  3FED A;  1ZRS A;  4AG7 A;  5CPA A;  4A95 A;  4CGL A;  1TF8 A;  4C2Y A;  2CNT A;  1Z8W A;  2GAN A;  2WZN A;  4M6G A;  1JDB C;  4R57 A;  4B10 A;  1C3O B;  2GLJ A;  2VZZ A;  3D8P A;  3A9L A;  1GGO A;  3D7H A;  1HEE A;  1QST A;  2FSR A;  3S6F A;  4NGT A;  1IYK A;  2EO8 A;  3FX6 A;  3KQX A;  5E96 A;  1J3L A;  3I6S A;  4UCN A;  2D0P A;  1MJB A;  4JVO A;  3HPG G;  4JYW A;  3GUX A;  4MHP A;  1S60 A;  4M6I A;  2JBJ A;  4PXB A;  4FD6 A;  3F0A A;  1Z5R A;  2CTB A;  2VKZ G;  2R8V A;  4KOS A;  4MY3 A;  2PJ7 A;  3PFE A;  2ZEL A;  2ZW5 A;  1XF1 A;  2G0B A;  3KR5 A;  4FUU A;  4KOT A;  1I12 A;  4PPZ A;  2P6F A;  3KHX A;  3QB8 A;  1A9X B;  4ONW A;  3R9E A;  2I00 A;  1B87 A;  2VQY A;  3KGQ A;  4KOU A;  2JDD A;  5G20 A;  2NMT A;  2YJV A;  2D4O A;  3E0K A;  2K5T A;  1TF9 A;  1YVH A;  4F0X A;  1S7K A;  4CYP A;  4NJQ A;  4C8P A;  1X12 A;  1FY7 A;  1FT7 A;  4NJR A;  2BCO A;  4NFR A;  3JRU A;  3TX8 A;  2FXF A;  3PLF B;  4A32 A;  2R7H A;  4PK3 A;  3BUX B;  1J4J A;  1KUY A;  2AFS A;  2D4P A;  4UEF A;  4F9V A;  1Q2Y A;  1Y9W A;  2J9A A;  3KZW A;  4KLW A;  4M85 A;  3ISX A;  4OKO A;  3R95 A;  4AVC A;  4CAE A;  5IB9 A;  2I3C A;  1VBG A;  3EZE A;  4WWV A;  4NGQ A;  1Z8X A;  2Z11 A;  2WPX A;  2AFW A;  4KS9 A;  4KVO E;  4ZI6 A;  1CJW A;  1TKF A;  3H8G A;  2UV8 G;  3PB7 X;  4JD6 A;  4MRI A;  3SI0 A;  4A4B A;  4LQG A;  3TTH A;  3EIF A;  4OC4 A;  5G21 A;  1YX0 A;  4MCP A;  2YNC C;  1XE4 A;  5G1Z A;  3TLY A;  3V7Z A;  2YGW A;  2AFX A;  1S7L A;  2I79 A;  4FBE A;  1Z4E A;  5LYF A;  4R3L A;  5EBV A;  4B11 A;  1R61 A;  4CZ1 A;  2HB6 A;  2X0S A;  1LRZ A;  3C26 A;  4BMH A;  5HH1 A;  4BPU B;  3VH9 A;  4EVY A;  2PJ8 A;  2Z3O A;  3TO6 A;  3BI0 A;  2GU2 A;  3ZZI A;  5D8N A;  1B47 A;  3LD2 A;  2ZW7 A;  1ZG9 A;  3R9G A;  3WR7 A;  4E0A A;  4ONU A;  2ZW6 A;  4XPD B;  3IWE A;  3CXS A;  4YN3 A;  3SJE A;  1M4G A;  1XEB A;  2ZEM A;  4U9Y A;  5IV0 A;  2CNM A;  3ICU A;  1CPS A;  4B5O A;  4MY0 A;  2VI7 A;  1PCA A;  3C8O A;  4C68 A;  4DJL A;  5D29 A;  4DNC A;  1DTD A;  4U5Y A;  1CE8 B;  3BUN B;  1AUG A;  4C7I A;  2ZXV A;  3V8I A;  1XRY A;  3FYN A;  4KOR A;  1BXR B;  2PVV A;  4BTF A;  4B14 A;  4P4B A;  3O8Z A;  4JZ0 A;  1IID A;  2GLF A;  1RTQ A;  3QAH A;  4J3G A;  4CAV A;  1IOI A;  4RS2 A;  3TOB A;  4OC2 A;  3B3S A;  3D7G A;  4G1P A;  5K8M A;  4U9Z A;  3LMS A;  3IO1 A;  1LAN A;  2PDO A;  1NMT A;  2O4H A;  4QVT A;  1ON0 A;  1ZLH A;  1YRE A;  1RXT A;  2PJ9 A;  5IB0 A;  2WPW A;  2QVP A;  2Q4V A;  4XPK A;  2PJ2 A;  4MFK A;  4YRH A;  3RYO A;  4BD9 A;  4ZGY B;  2ATR A;  3N7Z A;  1Z8T A;  3TOA A;  1WVM A;  4DUK A;  4CS0 B;  5K8O A;  2PCN A;  4E2A A;  2CIJ A;  4YGO A;  5J3X A;  4MFQ A;  5AGE A;  1MJ9 A;  7CPA A;  2PQ8 A;  4MHZ A;  5FVJ A;  2ZEO A;  3QNV A;  2MP0 A;  3FRM A;  5AG4 A;  2EWB A;  2Q4Z A;  1M6V B;  4E94 A;  1QMU A;  1R43 A;  3NOJ A;  5BWA B;  1KZF A;  1XJO A;  2YND A;  5G22 A;  4PXC A;  1M1D A;  4UFW A;  3KRV A;  4RN7 A;  1GYT A;  4J0N A;  5I0C A;  2Z3K A;  4OID A;  2EUI A;  2FS5 A;  4IHM A;  4R3K A;  1YQE A;  3WC6 A;  2PIY A;  3TT2 A;  3T5M A;  2Q4Y A;  5H84 A;  2AE6 A;  4AG9 A;  3FBU A;  4H1H A;  4AB7 A;  2BOA A;  2YJT A;  4CYN A;  2R98 A;  5HMN A;  1M44 A;  3TCV A;  2J8M A;  1ZYM A;  4A2Z A;  1VKC A;  3FIX A;  2BEI A;  1A2Z A;  5F48 A;  3VWE A;  1KEE B;  3CDX A;  3R96 A;  3S9N A;  2QEC A;  5HVH A;  3BHX A;  4OP4 A;  3TLB A;  2OR4 A;  2DPS A;  4CYO A;  1Y7E A;  4FD4 A;  2ZED A;  3PEI A;  4C9A A;  3NFQ A;  3DDD A;  5J8C A;  5K8P A;  3FH4 A;  3NFZ A;  4R6T A;  2FM4 A;  4CGM A;  3FF3 A;  4MCS A;  1P0H A;  1CS0 B;  1WWZ A;  3U88 C;  5F5X A;  2PJ3 A;  1YW4 A;  1XOV A;  3OP0 A;  1XF8 A;  2B3V A;  3DLJ A;  2IMO A;  4HNY B;  4HPS A;  4UWJ A;  4NGR A;  2PJA A;  3B3C A;  4OC1 A;  3DNS A;  3NE7 A;  2B3U A;  2OZH A;  4JWP A;  1UWY A;  2Q04 A;  2X7B A;  4E5S A;  1YVO A;  3F8K A;  4PSW A;  1HDU A;  3SJX A;  1Z9E A;  3R1K A;  3K9T A;  4L8A A;  3PBE A;  4YWY A;  5KTA A;  3IU2 A;  3H8F A;  2HV2 A;  5AG6 A;  3K4I A;  2Z3L A;  4XPL A;  1VHS A;  2BL1 A;  2FL4 A;  2Y1N A;  1ZLI A;  2DPT A;  2HQY A;  4OC0 A;  5DWM A;  1RO5 A;  2CTC A;  3I9S A;  3TC8 A;  4P4I A;  3VRP A;  2HRO A;  2RB7 A;  3DGV A;  2CY2 A;  4C9U A;  5AG7 A;  2FE7 A;  3CT9 A;  3W91 A;  4AVB A;  2WUU A;  4MHY A;  1KC7 A;  1B6B A;  4MCR A;  3EFA A;  3W6X A;  3EY5 A;  2B4B A;  3IGR A;  4KVM E;  1R57 A;  1VHO A;  3B3V A;  3IJ3 A;  1JQG A;  1XMT A;  2G9D A;  3TLE A;  3G8W A;  4UCM A;  3S6K A;  1GHE A;  1H8L A;  3SHP A;  1X10 A;  2PCU A;  5LRG A;  1Z2L A;  1FNO A;  3D68 A;  3DR6 A;  4Q36 A;  2PJB A;  3OAK A;  3SJG A;  4KLV A;  4RR2 B;  4MFZ A;  4PXE A;  2PVW A;  4Y49 C;  2Z10 A;  4ZX8 A;  3SI1 A;  4JXR A;  1ELL P;  4TWE A;  1Q5X A;  3NH8 A;  2HI6 A;  4ZY2 A;  2XPP A;  3P2H A;  5JPH A;  3D2P A;  3GJZ A;  3JTK A;  4A31 A;  4II9 A;  1QSN A;  4GPL B;  1YSJ A;  2PJ5 A;  1KBL A;  4H6Z A;  3PB9 X;  1BPN A;  2IQ6 A;  1SQH A;  2P0W A;  3D66 A;  3HLP A;  5LRJ A;  5JH9 A;  2F8H A;  1ZL0 A;  2ABZ A;  2B4J C;  1S7F A;  1TXR A;  3MGD A;  1FBV A;  2C6P A;  1Q2D A;  2BO9 A;  2NYQ A;  3VAT A;  4CYQ A;  2D0O A;  4UEE A;  4EME A;  1VBH A;  2PIZ A;  3CPX A;  1NBW A;  2QYV A;  4C8F A;  4IF5 A;  1TKH A;  2OB0 A;  3VAR A;  2PR8 A;  4QBJ A;  3B35 A;  3D7D A;  3KQZ A;  3PB6 X;  1NE9 A;  3T9Y A;  2C6G A;  4INJ A;  4C99 A;  1KWM A;  3VRN A;  5F9M A;  3TYX A;  2Z3M A;  4C9R A;  4CO9 A;  1YK3 A;  1LAP A;  1Y0Y A;  1IIC A;  2QJ8 A;  4ZBG A;  2YNC A;  3VGO A;  1XIX A;  3P2F A;  4P6Y A;  3TLG A;  3WC7 A;  4UIB A;  2G3A A;  2EBJ A;  5ISV A;  3ZJ0 A;  3PFV A;  5KTD A;  4R7M A;  3OB2 B;  4C2X A;  4F0Y A;  2DXQ A;  2V77 A;  2ZEG A;  4FAI A;  3CZX A;  4TJX A;  4TNU A;  4C8T A;  2OH1 A;  2Q44 A;  1CP7 A;  3DR8 A;  4YFJ A;  2Q7S A;  4CAW A;  3T90 A;  3IEH A;  3L2N A;  2GP4 A;  2AFO A;  3I1U A;  4FD7 A;  3T8W A;  1LFW A;  4R8F A;  3GB0 A;  1JDE A;  4B5P A;  1T36 B;  1NXJ A;  4OIW A;  1Y7R A;  2XPL A;  3BI1 A;  1PUA A;  5F09 A;  2WYR A;  4KUA A;  1EO0 A;  3SXN A;  2DEA A;  4RUH A;  1HDQ A;  4B13 A;  2E28 A;  2VEZ A;  4R9M A;  4NGM A;  2J8R A;  4NF1 A;  4XNH C;  3EC4 A;  3GIU A;  4KVX A;  3WT4 A;  4A39 A;  4C86 A;  2Y0M A;  5JYB A;  3D7F A;  2HUZ A;  1CBX A;  1UFH A;  2P6E A;  2PJ4 A;  3K9U A;  5A28 A;  4MJX A;  4O23 A;  2Z3N A;  4IIX A;  1I21 A;  1F2P A;  5LYD A;  1EZB A;  1ZG7 A;  2Q51 A;  4B12 A;  1CP6 A;  2PJC A;  4OME A;  2WSA A;  4H2K A;  4OAD A;  3KL9 A;  4P4E A;  4R76 A;  4WJB A;  4KSI A;  3S9M A;  3VWD A;  4C2Z A;  2C5Q A;  3PRT A;  4NCZ A;  4C8A A;  4COB A;  4P4J A;  5ELY A;  2PJ6 A;  1Z9U A;  4HKF A;  4AXV A;  3KR4 A;  5DS0 A;  3VRQ A;  2FIW A;  2FT0 A;  2CBL A;  3KAS A;  4UFX A;  4A33 A;  2GFQ A;  2EK8 A;  4Q38 A;  4CGO A;  4F8Z A;  4NEX A;  4P4D A;  1PYT B;  2YNE A;  4MI4 A;  4R87 A;  3RO0 A;  1IOF A;  3TFY A;  4X3R A;  3IWW A;  2EVN A;  5EMI A;  1AMP A;  1EZA A;  4C9V A;  3D67 A;  3G3S A;  3SXO A;  4KSF A;  4B6Z A;  1QQ9 A;  2Q0Y A;  2ZEE A;  2NSM A;  3GKR A;  5KTC A;  3K2K A;  3SI2 A;  3LAC A;  2XEI A;  2EZA A;  3H5Z A;  4KUB A;  3TO9 A;  1BO4 A;  3BUW B;  2B4D B;  1N71 A;  2DF5 A;  3FJU A;  5JVL A;  2EZC A;  4F6A A;  1YVK A;  4EFD A;  2V8H A;  1IB1 E;  3HPH E;  4JLY A;  3EZB A;  4E8O A;  4RI1 A;  3RZA A;  5F46 A;  3W6S A;  4A4C A;  5HKZ A;  4UIA A;  1MJA A;  1OZP A;  3TE4 A;  3PB8 X;  2PJ1 A;  4ORF A;  1Y9K A;  2REE A;  4QUS A;  4XPD C;  5LRK A;  2POK A;  4Y49 B;  3SR3 A;  4NGS A;  3T05 A;  1TKJ A;  2ANP A;  2OOT A;  3IFE A;  1NSL A;  3UY5 A;  2B5G B;  4FWU A;  4PXD A;  3CXQ A;  3FEC A;  3NA6 A;  2JEW A;  4MFJ A;  1ELM P;  4MJ8 A;  4C7H A;  4ZY0 A;  1ZG8 A;  4BPX B;  2JLM A;  2QIR A;  2ZEF A;  2N3A B;  3D4U A;  1AYE A;  1VIX A;  3TLG B;  3TLC A;  3BUO B;  1BPM A;  4GS4 A;  4JJX A;  1XMB A;  4MBU A;  3BLN A;  4UWI A;  3B7I A;  1VI4 A;  5HVF A;  2C27 A;  5F47 A;  4NGN A;  3EXN A;  4A37 A;  5F13 A;  4L89 A;  4UFV A;  4C84 A;  1S7N A;  1DIK A;  4IK2 A;  3JVN A;  2F5I A;  4CGP A;  1P4N A;  3PFO A;  3FVL A;  4CPA A;  3LOD A;  1R3N A;  1Q2C A;  3CPA A;  3B3T A;  4X8I A;  4EWT A;  3FB3 A;  4KNG E;  4B5P B;  3F9K C;  1IU8 A;  4P4F A;  2GE3 A;  2Y1M A;  1Q7L A;  3KI9 A;  4YU9 A;  4C85 A;  3N5F A;  1KUV A;  1MK4 A;  4GM5 A;  2Z0Z A;  2J8N A;  1V0C A;  4OC5 A;  4A94 A;  2B0A A;  4UF4 A;  2AUN A;  1ZO0 A;  3S6H A;  2C6C A;  1TIQ A;  1YLE A;  4PK2 A;  3VTA A;  1IGB A;  3VRR A;  2XPN A;  4H89 A;  3H4Q A;  2PRB A;  4A30 A;  4IUS A;  3SJF A;  2ZOG A;  2XEG A;  2CNS A;  8CPA A;  1BAV A;  3B2Y A;  3S6G A;  4GXH A;  2AUM A;  5JM6 A;  1M4I A;  1KUX A;  2R1I A;  3I74 A;  4Z65 A;  4CDJ A;  2B4D A;  4KOW A;  4Q7A A;  4XNH B;  4TJV A;  5HKY A;  1M4L A;  2B58 A;  4BPW B;  3IU1 A;  5HVG A;  3FEE A;  4JXQ A;  2ZEN A;  1OBR A;  1K4J A;  2RC4 A;  4ZX9 A;  3BUM B;  2PJ0 A;  1WJT A;  2ZW4 A;  3KKW A;  1U6M A;  3QAY A;  1YGH A;  2BSW A;  2CXA A;  3BJ8 A;  4KOX A;  3WAB A;  4OAE A;  3NH4 A;  3GLJ A;  4AVA A;  1C30 B;  5K99 A;  5H86 A;  5IR2 A;  4M6H A;  1VGY A;  1LOK A;  5K8N A;  4MFP A;  5AXI A;  5FD8 A;  1LCP A;  2JEV A;  1IYL A;  2B5G A;  2V8D A;  2ZPA A;  3FMC A;  3IWG A;  2FVG A;  2ZOF A;  5GCN A;  4KOY A;  2AFZ A;  4K3N A;  1V6C A;  5THW A;  1LAM A;  3HUV A;  3ZNI A;  4X5K A;  2V8V A;  1WK4 A;  4W9Y A;  4CRY B;  4C8U A;  5F1Y A;  3U1B A;  1CG2 A;  5HKW A;  2H5M A;  3FNC A;  4MFL A;  2PSW A;  4EYS A;  5F49 A;  3RNZ A;  4BBH A;  1S3Z A;  4CRZ B;  2PC1 A;  2R82 A;  3I3G A;  3G23 A;  2ZEH A;  2JDC A;  3V38 A;  1IY7 A;  2AFU A;  2Q7B A;  3VRO A;  4HNW B;  2DIK A;  4MHN A;  4P10 A;  4LX9 A;  2JBK A;  2BUE A;  4X2T A;  3EZA A;  4COG A;  2ARH A;  4F9U A;  2OLS A;  2FIA A;  3IC1 A;  2RFH A;  1QSR A;  2CF4 A;  2Z3P A;  3PT1 A; 
#chains in the Genus database with same CATH homology
 1EE3 P;  3B3W A;  3RAM A;  4UEZ A;  3MN8 A;  4P44 A;  4P45 A;  5J1Q A;  2F7V A;  2IJZ A;  2PE3 A;  3BXM A;  2ZEP A;  5LYI A;  4A38 A;  1F2O A;  3H8E A;  1BLL E;  3IIB A;  3KHZ A;  4MCQ A;  1Y0R A;  3PB4 X;  3ISZ A;  1DE4 C;  2O53 A;  4NGP A;  3S9L A;  1Z8L A;  2HC9 A;  1ARL A;  4C9E A;  2PRQ A;  1ARM A;  1YME A;  4ZYQ A;  1CPX A;  4OC3 A;  1XFO A;  4MMO A;  5I4M A;  1F57 A;  3PBB A;  4PQA A;  2AFM A;  1YLO A;  2GRE A;  1XBU A;  2EK9 A;  1CX8 A;  1Y9Z A;  5HXD A;  4C8C A;  4DYO A;  4MXU A;  3LWU A;  1VHE A;  3NH5 A;  1NSA A;  3WC5 A;  6CPA A;  1YW6 A;  5LYL A;  3RBU A;  2XEJ A;  2Q43 A;  5JGF A;  2C1C A;  4CDK A;  2VL1 A;  4ZY1 A;  2V8G A;  5CBM A;  4IAV A;  2XEF A;  3MRU A;  3FED A;  5CPA A;  1TF8 A;  2WZN A;  2GLJ A;  3D7H A;  1HEE A;  4NGT A;  3I6S A;  3FX6 A;  3KQX A;  4JYW A;  3GUX A;  4MHP A;  2JBJ A;  4PXB A;  1Z5R A;  2CTB A;  2PJ7 A;  3PFE A;  2ZEL A;  1XF1 A;  4FUU A;  3KR5 A;  4PPZ A;  3KHX A;  4ONW A;  3KGQ A;  1TF9 A;  4NJQ A;  4C8P A;  1FT7 A;  4NJR A;  4NFR A;  3JRU A;  3TX8 A;  2AFS A;  4UEF A;  4F9V A;  2J9A A;  3KZW A;  4OKO A;  3ISX A;  5IB9 A;  2I3C A;  4WWV A;  4NGQ A;  2AFW A;  4ZI6 A;  1TKF A;  3H8G A;  3PB7 X;  4MRI A;  3SI0 A;  4LQG A;  3EIF A;  4OC4 A;  4MCP A;  3V7Z A;  2AFX A;  4FBE A;  5LYF A;  2HB6 A;  3VH9 A;  2PJ8 A;  3BI0 A;  2GU2 A;  5D8N A;  1ZG9 A;  4YN3 A;  3SJE A;  2ZEM A;  3ICU A;  1CPS A;  1PCA A;  4DJL A;  5D29 A;  1DTD A;  1XRY A;  2PVV A;  4P4B A;  4JZ0 A;  2GLF A;  1RTQ A;  4OC2 A;  3B3S A;  3D7G A;  4G1P A;  5K8M A;  3LMS A;  3IO1 A;  1LAN A;  2O4H A;  1ZLH A;  2PJ9 A;  2QVP A;  4BD9 A;  2PJ2 A;  1WVM A;  4DUK A;  5K8O A;  2CIJ A;  7CPA A;  4MHZ A;  2ZEO A;  3QNV A;  2EWB A;  2Q4Z A;  1QMU A;  1R43 A;  1XJO A;  4PXC A;  1GYT A;  4OID A;  4IHM A;  3WC6 A;  2PIY A;  2BOA A;  3CDX A;  5HVH A;  3S9N A;  3BHX A;  4OP4 A;  2OR4 A;  1Y7E A;  2ZED A;  3PEI A;  4C9A A;  5K8P A;  3FH4 A;  3NFZ A;  4R6T A;  3FF3 A;  4MCS A;  2PJ3 A;  1YW4 A;  3DLJ A;  2IMO A;  4NGR A;  2PJA A;  3B3C A;  4OC1 A;  1UWY A;  1HDU A;  3SJX A;  3K9T A;  3PBE A;  4YWY A;  3H8F A;  3TC8 A;  1ZLI A;  4OC0 A;  2CTC A;  4P4I A;  2RB7 A;  3DGV A;  4C9U A;  3CT9 A;  4MHY A;  4MCR A;  1VHO A;  3B3V A;  3IJ3 A;  1JQG A;  2G9D A;  1H8L A;  5LRG A;  2PCU A;  1Z2L A;  1FNO A;  3D68 A;  2PJB A;  3SJG A;  4PXE A;  2PVW A;  4ZX8 A;  3SI1 A;  1ELL P;  4TWE A;  3NH8 A;  4ZY2 A;  1YSJ A;  2PJ5 A;  3PB9 X;  1BPN A;  2IQ6 A;  3D66 A;  5LRJ A;  3HLP A;  5JH9 A;  2F8H A;  2ABZ A;  1TXR A;  2C6P A;  2BO9 A;  2NYQ A;  3VAT A;  4UEE A;  4EME A;  2PIZ A;  3CPX A;  2QYV A;  4C8F A;  1TKH A;  3VAR A;  3B35 A;  3D7D A;  3KQZ A;  3PB6 X;  2C6G A;  4C99 A;  1KWM A;  4C9R A;  1LAP A;  1Y0Y A;  2QJ8 A;  4P6Y A;  3WC7 A;  4UIB A;  4R7M A;  4C8T A;  2V77 A;  2ZEG A;  4FAI A;  4TJX A;  4TNU A;  1CP7 A;  3IEH A;  3L2N A;  2GP4 A;  2AFO A;  3I1U A;  3T8W A;  1LFW A;  4R8F A;  3GB0 A;  4OIW A;  3BI1 A;  5F09 A;  2WYR A;  4RUH A;  2DEA A;  1HDQ A;  4NGM A;  3WT4 A;  4C86 A;  4A39 A;  3D7F A;  2PJ4 A;  1CBX A;  4O23 A;  1F2P A;  5LYD A;  1ZG7 A;  2Q51 A;  1CP6 A;  2PJC A;  4OME A;  4H2K A;  4WJB A;  3KL9 A;  4P4E A;  4R76 A;  4KSI A;  3S9M A;  2C5Q A;  3PRT A;  4C8A A;  4P4J A;  5ELY A;  2PJ6 A;  4AXV A;  3KR4 A;  5DS0 A;  3KAS A;  2EK8 A;  4F8Z A;  4P4D A;  1PYT B;  4X3R A;  3IWW A;  1AMP A;  4C9V A;  3D67 A;  4B6Z A;  1QQ9 A;  2ZEE A;  2NSM A;  3K2K A;  3SI2 A;  2XEI A;  3FJU A;  4EFD A;  2V8H A;  3RZA A;  4UIA A;  3PB8 X;  2PJ1 A;  5LRK A;  2POK A;  4NGS A;  1TKJ A;  2ANP A;  2OOT A;  3IFE A;  4FWU A;  4PXD A;  3NA6 A;  3FEC A;  2JEW A;  1ELM P;  4ZY0 A;  1ZG8 A;  2ZEF A;  3D4U A;  1AYE A;  1VIX A;  1BPM A;  1XMB A;  3B7I A;  5HVF A;  4NGN A;  4A37 A;  4C84 A;  4IK2 A;  3PFO A;  3FVL A;  4CPA A;  4X8I A;  1R3N A;  3CPA A;  4EWT A;  3B3T A;  4KNG E;  4P4F A;  3KI9 A;  1Q7L A;  4YU9 A;  4C85 A;  3N5F A;  4GM5 A;  4OC5 A;  4A94 A;  4UF4 A;  2C6C A;  3VTA A;  1IGB A;  3SJF A;  2ZOG A;  2XEG A;  8CPA A;  1BAV A;  3B2Y A;  5JM6 A;  4CDJ A;  3I74 A;  4Z65 A;  4TJV A;  4Q7A A;  1M4L A;  5HVG A;  3FEE A;  2ZEN A;  1OBR A;  4ZX9 A;  2PJ0 A;  3WAB A;  3NH4 A;  3GLJ A;  5IR2 A;  5K8N A;  1VGY A;  1LOK A;  1LCP A;  2V8D A;  3FMC A;  2FVG A;  2ZOF A;  2AFZ A;  4K3N A;  1V6C A;  5THW A;  1LAM A;  3HUV A;  2V8V A;  4W9Y A;  4C8U A;  1CG2 A;  3V38 A;  1IY7 A;  2AFU A;  4MHN A;  4P10 A;  4X2T A;  2JBK A;  4F9U A;  2ZEH A;  3IC1 A;  2RFH A;  2BCO A;  2CF4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...