4LQGA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor ctt1056
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
692
Chain Sequence
b'KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structure-Activity Relationship of (18)F-Labeled Phosphoramidate Peptidomimetic Prostate-Specific Membrane Antigen (PSMA)-Targeted Inhibitor Analogues for PET Imaging of Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 264
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4lqgA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4lqgA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4lqgA02
1NSAA 3PB4X 3RAMA 2O53A 4C8TA 1GYTA 3KQXA 4X8IA 1Z8LA 4MRIA 1DE4C 3SI0A 2O4HA 4JZ0A 4RUHA 5CPAA 1V6CA 2QVPA 2RB7A 4YU9A 4OC0A 2PCUA 4W9YA 3KHZA 1F57A 1AYEA 2POKA 1AMPA 2F7VA 3B35A 1CX8A 4DUKA 3B3TA 4R76A 3FX6A 4PXBA 4DYOA 5F09A 5CBMA 2PJ6A 4MHYA 4CDKA 3K9TA 3NH4A 2JBJA 3PBEA 4OC2A 1CG2A 3MN8A 4KSIA 5JH9A 3KGQA 3H8GA 4PPZA 2DEAA 4B6ZA 1ZG7A 3BHXA 3JRUA 2XEJA 5D29A 3HLPA 5JM6A 4OC4A 3WC7A 4P45A 4K3NA 2ZELA 3PFOA 2ZENA 1TKJA 2FVGA 3PEIA 3BXMA 4MMOA 1LAMA 4C9VA 4MHZA 2ZEMA 5LYDA 3KHXA 3BI0A 1HEEA 3ISXA 3D4UA 4C86A 1UWYA 4P10A 3VTAA 4R7MA 4C8PA 3RZAA 5HVHA 4FBEA 3PB6X 1OBRA 3IFEA 4X3RA 4C9EA 4UEFA 1JQGA 1RTQA 4P4EA 4FUUA 2PVVA 1CPSA 4UEEA 2IQ6A 4A39A 1Y9ZA 3I6SA 4C99A 3H8EA 3D68A 4IK2A 4P44A 3WT4A 2ZEPA 5DS0A 4UEZA 2PJ3A 2V8VA 2ZEOA 4TWEA 1XFOA 1Y0RA 3WABA 2RFHA 4C8UA 1ELLP 3TX8A 2PJAA 4BD9A 4OC1A 1CP6A 2BCOA 2C6CA 4Q7AA 1LAPA 4OC3A 5K8MA 1XMBA 4TJVA 2F8HA 3KL9A 1CBXA 4NGMA 1XJOA 2ZEFA 4NJRA 4A38A 2CTBA 4UIAA 3D67A 3KASA 1BAVA 2BO9A 2AFXA 2GLJA 1VGYA 2PIZA 4P4JA 3S9MA 1TKFA 1XBUA 5LYIA 4UIBA 4A37A 2Q4ZA 5ELYA 4NGSA 2WZNA 1TKHA 4R6TA 3S9NA 4MHNA 2Q43A 3D7GA 4P6YA 1FT7A 4PXCA 1QQ9A 3GUXA 4EWTA 2NSMA 4GM5A 2EK8A 1DTDA 4OKOA 4ZY0A 2HB6A 2PIYA 3I74A 4EFDA 1IY7A 2V8DA 4G1PA 3VATA 3FEDA 4IHMA 4PQAA 2PJ1A 1ARLA 4FAIA 3IJ3A 2EWBA 3SJEA 4H2KA 2GU2A 4NGTA 3D7DA 1Y0YA 2BOAA 2JEWA 3PB8X 3V7ZA 4JYWA 4P4DA 1ZG9A 1LANA 3WC6A 3I1UA 4P4BA 5LRKA 3DGVA 2XEIA 2NYQA 4ZX9A 2AFUA 1Q7LA 3K2KA 2Q51A 3ICUA 4P4FA 4ZYQA 4NJQA 1YW6A 4YWYA 3SJFA 1LCPA 4ZY1A 4AXVA 2PJ4A 3LMSA 3D7HA 3T8WA 2XEFA 3VARA 4F9VA 4WWVA 2C6PA 4P4IA 4C85A 1F2PA 2PE3A 3SJXA 1KWMA 1TF9A 2ZEDA 3EIFA 2ZEGA 2PJ5A 4F8ZA 3IC1A 3NH8A 3BI1A 1TXRA 3IO1A 2OR4A 1F2OA 3MRUA 5I4MA 2AFSA 1PCAA 3KR5A 1YLOA 4TNUA 3FECA 2HC9A 2PJ8A 5IB9A 1LOKA 4IAVA 1XF1A 4PXDA 3KZWA 4F9UA 2WYRA 2PJBA 3FF3A 3FH4A 4MCRA 3IWWA 1Z2LA 1R43A 1VHEA 5D8NA 4C8AA 3NA6A 4LQGA 2AFOA 4OC5A 5K8NA 4TJXA 4UF4A 3TC8A 3PB7X 2ZOFA 3WC5A 4EMEA 2OOTA 4NGPA 2PVWA 4DJLA 3QNVA 2JBKA 3B3WA 4PXEA 5K8PA 3D7FA 5HXDA 1BPNA 4ZX8A 4C8FA 4OP4A 1TF8A 2GLFA 3S9LA 4MCQA 2QJ8A 3SI2A 1QMUA 3D66A 3PBBA 1YSJA 1WVMA 5JGFA 2C1CA 3KQZA 3SI1A 7CPAA 3KI9A 2V77A 3LWUA 3H8FA 4YN3A 2CTCA 4C84A 1YMEA 1YW4A 2I3CA 3N5FA 2IMOA 1H8LA 2PJCA 3CDXA 2CF4A 4R8FA 3ISZA 5LYLA 4OIWA 3IIBA 3FMCA 1CPXA 1PYTB 2PJ9A 1Y7EA 4ONWA 2AFWA 2ABZA 1ELMP 5LYFA 4NFRA 3B7IA 1XRYA 2G9DA 2PJ7A 4O23A 1VHOA 2GREA 2ZEEA 2XEGA 3B2YA 4C9RA 4MCSA 2EK9A 1CP7A 2V8GA 3NH5A 4KNGE 4ZI6A 1R3NA 1LFWA 4C9AA 5LRGA 3KR4A 2CIJA 4MHPA 4MXUA 4ZY2A 2V8HA 3VH9A 3CPXA 4OMEA 3FJUA 5THWA 1FNOA 5HVFA 2PJ2A 4NGRA 1ZG8A 3L2NA 4OIDA 3PB9X 3CPAA 3B3SA 3FEEA 3RBUA 2ZOGA 3DLJA 4WJBA 3GLJA 1VIXA 4Z65A 4NGQA 2VL1A 5HVGA 6CPAA 3GB0A 4C8CA 4MCPA 4X2TA 2QYVA 8CPAA 3HUVA 2ANPA 1ZLIA 4FWUA 2C6GA 1M4LA 2IJZA 5J1QA 2J9AA 3B3VA 1BPMA 1HDUA 1ARMA 3SJGA 5K8OA 2PJ0A 1ZLHA 3V38A 1Z5RA 4A94A 2AFMA 3B3CA 4NGNA 1HDQA 1BLLE 2ZEHA 4C9UA 4CDJA 3NFZA 2AFZA 3CT9A 1EE3P 3FVLA 3PRTA 1IGBA 4CPAA 5LRJA 2PRQA 3PFEA 3IEHA
chains in the Genus database with same CATH superfamily
2OH1A 1NSAA 3JVNA 3PB4X 1L0CA 3EZAA 4IIYA 2O28A 4MJ8A 2VZZA 3RAMA 2O53A 3D8PA 4M6HA 3UY5A 5IX3A 1BXRB 3T90A 5KTDA 3TLGB 2B5GA 4NSQA 4C8TA 1GYTA 3KQXA 1M4DA 1YVOA 2H5MA 1Z9UA 1Z8LA 4UCNA 4PSXA 4MRIA 4X8IA 3RNZA 1DE4C 1Z8WA 3SI0A 4A31A 5K99A 2FM4A 2O4HA 4JZ0A 4NEXA 5CPAA 4RUHA 1V6CA 4EYSA 2QVPA 4H6UA 2RB7A 3F9KC 2Y1MA 3IWGA 5FVJA 4YU9A 3MGDA 4OC0A 2PCUA 4JWPA 1Q5XA 5I0CA 2FE7A 3TE4A 4W9YA 3KHZA 1F57A 2C27A 3O8ZA 4NF1A 5G22A 1AYEA 4OAEA 2POKA 1I12A 4GPLB 2A4NA 1FY7A 1AMPA 3R95A 4Y49C 2F7VA 4B5PB 5IR2A 3QAYA 3B35A 1YR0A 1CX8A 2REEA 4DUKA 4RI1A 3B3TA 4CGMA 2AUNA 1WK4A 3KRVA 4R76A 3FX6A 5AGEA 3BUOB 1X12A 4PXBA 4DYOA 3TYXA 1XEBA 3BJ8A 4R9MA 1VBHA 5F09A 2X7BA 3DDDA 3SHPA 4CYOA 5KTAA 3CXQA 4C68A 5CBMA 2PJ6A 2YNCA 1A9XB 3D2MA 3NE7A 2XPNA 4MHYA 2K5TA 2OU2A 4CDKA 4KLWA 3K9TA 3VGOA 3NH4A 2JBJA 1CM0A 1C3OB 3PBEA 4IIXA 4OC2A 2VEZA 3SR3A 2Z3NA 1CG2A 3MN8A 1M44A 4KSIA 1CJWA 5JH9A 3KGQA 4OADA 3H8GA 3TLCA 1Z9EA 2WPWA 4PK3A 4U5YA 4PPZA 1CS0B 2DEAA 4B6ZA 4AG7A 3OB1B 2HUZA 1ZG7A 2R1IA 2CNMA 4M6GA 1K4JA 4KUBA 3BHXA 3JRUA 2XEJA 4HNWB 4EVYA 2BEIA 1AUGA 5D29A 3HLPA 4KS9A 4OC4A 1IOFA 3WC7A 5JM6A 4P45A 3W6SA 2Y1NA 2Z3OA 4K3NA 2ZELA 3PFOA 2ZENA 1TIQA 4KOYA 3S6HA 5AG7A 2VKZG 2XPLA 1TKJA 2FVGA 3PEIA 4OLLA 2ZPAA 4H89A 3BXMA 4MMOA 1LAMA 4C9VA 4MHZA 2ZEMA 1Z4RA 5LYDA 3KHXA 3D2PA 1MJ9A 3BI0A 2OZGA 1HEEA 2CNTA 2GFQA 2HROA 3P2HA 4B12A 1Z8XA 5ISVA 5FD8A 2EZAA 3ISXA 3D4UA 2ODFA 4C86A 1UWYA 1S60A 5EBVA 3HPHE 2FL4A 2CXAA 3NFQA 3TFYA 4P10A 4KOSA 3VTAA 4R7MA 4LX9A 2PC1A 5C88A 4C8PA 2OLSA 2EO8A 4C2ZA 2YNDA 2BUEA 3BLNA 3RZAA 5HVHA 4FBEA 4U9ZA 3PB6X 1OBRA 1S7LA 5JYBA 1SQHA 4MFJA 3IFEA 2DF5A 4X3RA 4A4CA 1IICA 1S7NA 2AJ6A 4C9EA 4UEFA 4RR2B 1JQGA 3H5ZA 1RTQA 4P4EA 4FUUA 4YGOA 2B5GB 4A33A 2N3AB 2PVVA 1CPSA 4UEEA 5F47A 2HQYA 1VHSA 2IQ6A 3RYOA 4A39A 1Y9ZA 1LRZA 3I6SA 1EZBA 3PT1A 3FBUA 3S6KA 4C99A 3H8EA 2P6FA 3D68A 4IK2A 2B0AA 3WR7A 4P44A 2B4DA 3WT4A 4MY3A 4R87A 2ZEPA 3T0TA 1XOVA 5DS0A 4UEZA 3TOBA 2PJ3A 2V8VA 2ZEOA 4E2AA 2YNEA 4TWEA 1XFOA 2FXFA 1KUXA 1ON0A 3GYAA 4UFVA 1Y0RA 4UCPA 4XPDB 3WABA 2RFHA 5J8CA 4II9A 1ZYMA 4C8UA 1ELLP 3TX8A 1UFHA 3B8GA 4B5OA 2PJAA 2FS5A 4JJXA 1MK4A 4BD9A 4UWJA 4OC1A 2F5IA 4RS2A 1CP6A 5H84A 1KEEB 2CBLA 4FD6A 4HPSA 2BCOA 5F13A 2BSWA 2C6CA 5F1YA 3N7ZA 3TLBA 4Q7AA 4DNCA 1LAPA 4OC3A 1Q2CA 2I00A 2PR1A 2QMLA 3T07A 4C8FA 5K8MA 1XMBA 1B47A 4TJVA 2F8HA 3DR6A 4HNYB 3KL9A 4FAIA 1CBXA 4NGMA 1XJOA 2ZEFA 2YJTA 3G8WA 4NJRA 1J3LA 1JDEA 4A38A 3EXNA 2CTBA 3IU1A 4GXHA 4MFZA 3D67A 3KASA 4UIAA 1BAVA 1ZO0A 2AFXA 2BO9A 2FCKA 2AUMA 5HH1A 1GHEA 2JDCA 2ZW5A 5HMNA 3OP0A 1VGYA 2GLJA 1EO0A 2PIZA 1S3ZA 4P4JA 3S9MA 1IIDA 2B3UA 1TKFA 2R7HA 1XBUA 3S6FA 4U9YA 5AG5A 4UCMA 5LYIA 4UIBA 1Q2DA 3LACA 4PV6A 4A37A 2Q4ZA 3PLFB 5ELYA 4NGSA 3OB2B 3CXPA 3PP9A 4JLYA 3U1BA 5CNPA 2WZNA 4CZ1A 4R3LA 5F48A 1TKHA 2D4PA 4R6TA 2G0BA 4MHDA 2DIKA 3S9NA 4MHNA 4XNHB 2Q43A 3D7GA 2P6EA 4P6YA 1FT7A 3K4IA 4PXCA 4XPKA 3GJZA 4COBA 3JTKA 1QQ9A 3GUXA 4A30A 4EWTA 5BY0A 1QSRA 2NSMA 4GM5A 2EK8A 1DTDA 4OKOA 4X5KA 2HB6A 2PIYA 4KOTA 4ZY0A 1C30B 3VRRA 1IOIA 1IY7A 2G3TA 2V8DA 4G1PA 4UA3A 3FIXA 3VATA 3FEDA 2GIVA 4IHMA 4PQAA 4I49A 2PJ1A 4QVTA 4CAFA 2OB0A 1ARLA 2P6GA 1OZPA 4E8OA 2Z10A 3IJ3A 4KOVA 2R8VA 4AG9A 2EWBA 4IUSA 3SJEA 1Q2YA 1QSTA 5AG4A 2PRBA 3VWEA 1M1DA 3PGPA 1XF8A 1FBVA 1YLEA 2Z3KA 4H2KA 2GU2A 4KVOE 4A2ZA 4NGTA 4F0XA 3D7DA 1Y0YA 2BOAA 2AE6A 2JEWA 3PB8X 2PQ8A 4JYWA 4UFXA 3V7ZA 4P4DA 1ZG9A 1LANA 3NOJA 4KZTA 3VRPA 2Q44A 1N71A 3WC6A 2ZW4A 5HKWA 2NMTA 3I1UA 4P4BA 4IF5A 5LRKA 5F5XA 1ZL0A 4CGLA 2XPPA 3DGVA 2D4OA 2GE3A 2XEIA 4H1HA 2NYQA 2CNSA 4JXQA 4ZX9A 4BTFA 1Q7LA 2AFUA 2Q51A 1P4NA 3K2KA 3ICUA 4P4FA 3ZZIA 4ZBGA 2JDDA 1XMTA 3F5BA 3EZEA 4HKFA 4ZYQA 3OAKA 4NJQA 2ZW7A 4QB9A 4MBUA 3VRNA 4BBHA 5H86A 1R61A 3EO4A 4YRHA 1YW6A 4YWYA 5AXIA 3SJFA 1LCPA 3KKWA 4ZY1A 4AXVA 4RN7A 2PJ4A 3E0KA 3LMSA 3LD2A 3D7HA 4M6IA 2YGWA 3TTHA 4KOUA 2XEFA 2KCWA 3FRMA 5G21A 4MFQA 3T8WA 3VARA 4MI1A 4MI4A 4BPXB 3VROA 4F9VA 4NXYA 2Z3LA 4AB7A 4WWVA 2C6PA 1S5KA 4B10A 1NXJA 2Q04A 3CXSA 4A32A 3D3SA 4P4IA 4C85A 1F2PA 2PE3A 3SJXA 3TOAA 5J8FA 1KWMA 4ORFA 4BPUB 1TF9A 4LQ6A 2YJVA 2ZEDA 1Z8TA 3EIFA 2ZXVA 2ZEGA 2WUUA 2PJ5A 4L89A 1M6VB 1NE9A 4AVCA 3IC1A 3NH8A 3BI1A 1TXRA 3IO1A 4F8ZA 2OR4A 1Z4EA 4GS4A 1F2OA 2Q7SA 4K30A 4R3KA 1CE8B 2EZCA 3MRUA 5IB0A 4BPWB 2REFA 5I4MA 2AFSA 2FIAA 4JD6A 3PZJA 1S7FA 4C7HA 3PFVA 1PCAA 3I74A 2C5QA 3T9YA 3KR5A 3BUNB 5JQ4A 1YLOA 4TNUA 4C2YA 1A2ZA 3FECA 2HC9A 2PJ8A 4XPLA 4A95A 4B14A 3ZJ0A 4C2XA 1LOKA 5IB9A 3TLEA 3TLZA 4IAVA 1XF1A 4PXDA 4CS0B 5HKYA 3KZWA 3TLAA 3BUMB 4ZGYB 4F9UA 3DNSA 3OWCA 2WYRA 2PJBA 4UBRA 3TCVA 4YFJA 3FF3A 5HKZA 4JVOA 3FH4A 3LODA 2EVNA 4M3SA 5EMIA 4MCRA 1P0HA 1PUAA 3S6GA 3IWWA 1Z2LA 2VQYA 3TO9A 2QECA 3F8KA 3HMJG 1IU8A 3T5MA 4E94A 1R43A 5G20A 1VHEA 5D8NA 3EFAA 5G1ZA 1Y9WA 4C8AA 4B13A 1WJTA 4JXRA 1M4GA 3NA6A 4LQGA 4KVXA 2I79A 2B3VA 2UV8G 4QUSA 2AFOA 2Q7BA 5KTCA 4XPDC 4OC5A 5K8NA 2PR8A 4KSFA 4TJXA 4H6ZA 4UF4A 3TC8A 4QBJA 3PB7X 2ZOFA 1T36B 2CY2A 2EBJA 3WC5A 4EMEA 2D0OA 2VBQA 1EZAA 3HPGG 2OOTA 4NGPA 3EC4A 2PVWA 4DJLA 1NBWA 3V8IA 2B4BA 3QNVA 2JBKA 3B3WA 4PXEA 2D0PA 3U88C 5JVLA 5K8PA 3D7FA 5HXDA 2GANA 2B4JC 1BPNA 4KOXA 4ZX8A 4OP4A 1TF8A 2GLFA 1YQEA 5F49A 3W6XA 3S9LA 2ARHA 2WPXA 1RXTA 4MCQA 2QJ8A 4HNXB 3SI2A 3VWDA 5AG6A 1QMUA 4AVAA 2DXQA 2P0WA 2Z3MA 3D66A 4CYQA 4CYNA 3DSBA 3PBBA 2EZBA 1YSJA 2EUIA 4Y49B 1WVMA 4INJA 1NSLA 5JGFA 2C1CA 2J8NA 3BUXB 5F46A 5E96A 1JWQA 2J8MA 2FIWA 4EFDA 4CO9A 3R9FA 3KQZA 4KOWA 2JEVA 3SI1A 7CPAA 1YREA 3KI9A 3K9UA 4M85A 2JLMA 5BWAB 1NMTA 2V77A 3RO0A 3R96A 3LWUA 4MY0A 2Z0ZA 3FNCA 3H8FA 3QAHA 3R1KA 1PU9A 2R98A 1JDBC 4FD5A 2PCNA 2CTCA 2QIRA 5GCNA 2FT0A 2PDOA 4YN3A 4C84A 1YMEA 1YW4A 2I3CA 2FSRA 3GY9A 2IMOA 1Y7RA 1H8LA 1KUVA 3F0AA 3I3GA 3N5FA 2PJCA 4CYPA 1M4IA 2OZUA 4XNHC 1WWZA 3CDXA 1YGHA 2VI7A 3EY5A 2CF4A 2DPTA 4R8FA 3ISZA 4Q36A 4OIWA 5LYLA 4KORA 4J3GA 3IIBA 4KSAA 4C7IA 3FMCA 1CPXA 1I21A 4E0AA 3C8OA 3QB8A 1PYTB 1Y9KA 2DLAA 4CRYB 3FYNA 2PJ9A 1Y7EA 2VZYA 4CGNA 4ONWA 4FD4A 2AFWA 2ABZA 1R57A 3W91A 4KVME 3VRQA 4AVBA 3TLGA 1ELMP 5LYFA 1YX0A 1B6BA 4CAVA 1IYLA 3SXOA 2PSWA 1KZFA 4NFRA 4UFWA 3G3SA 4LUAA 4MJXA 4BMHA 1S7KA 2B4DB 3JUWA 1BO4A 1J4JA 4CGOA 5EC4A 3B7IA 2R82A 3IGRA 1XRYA 2G9DA 2PJ7A 3GKRA 1ZRSA 4O23A 1VHOA 2GREA 2ZEEA 4CAWA 2XEGA 1RO5A 1X10A 3B2YA 3TT2A 1DIKA 4C9RA 1QSMA 3GIUA 2Z3PA 1KC7A 4MCSA 2EK9A 4A4BA 1CP7A 1YK3A 2V8GA 4CAXA 3NH5A 4KNGE 1KBLA 2J8RA 4ZI6A 3TO6A 1R3NA 1LFWA 2ATRA 1BOBA 4C9AA 4KUAA 1QSNA 4MFPA 4R57A 5LRGA 4B5PA 1VI4A 3KR4A 2CIJA 4MHPA 4MXUA 2GP4A 3R9EA 4ZY2A 1MJBA 5A27A 2OZHA 1GGOA 2V8HA 3VH9A 3CPXA 4OMEA 1B87A 1XIXA 3FJUA 5THWA 3EZBA 1FNOA 1XE4A 3ZNIA 5DWNA 5HVFA 2HV2A 2PJ2A 4NGRA 1ZG8A 3I9SA 3L2NA 3IU2A 4F6AA 4OIDA 5JPHA 4CGPA 2G3AA 2RC4A 1I1DA 2Q4YA 3PB9X 5F9MA 3CPAA 4PK2A 3B3SA 4FD7A 3DR8A 3FEEA 3RBUA 1KUYA 2ZOGA 3BJ7A 4CRZB 2VXKA 1IYKA 3DLJA 4PSWA 4WJBA 3GLJA 4KLVA 4CAEA 1VIXA 5IV0A 4Z65A 4NGQA 1MJAA 2VL1A 5HVGA 4J0NA 6CPAA 3FXTA 3GB0A 4MFLA 3G23A 2Z11A 4C8CA 5J3XA 4MCPA 2B58A 3A9LA 4X2TA 3TLYA 5A28A 1VKCA 1QSOA 2Q0YA 2QYVA 8CPAA 2HI6A 3C26A 3HUVA 1VBGA 2MP0A 2ANPA 1ZLIA 1YVHA 4FWUA 2C6GA 1M4LA 3IWEA 4F0YA 5C82A 2XPOA 4BINA 2IJZA 3SXNA 5J1QA 3CZXA 2HWGA 2J9AA 3B3VA 4ONUA 2E28A 2Y0MA 1BPMA 1HDUA 1IB1E 1ARMA 3SJGA 1U6MA 4E5SA 4UWIA 5K8OA 2PJ0A 4Q38A 1YVKA 1ZLHA 4QC6A 3V38A 1Z5RA 3NE8A 4A94A 2AFMA 3B3CA 2X0SA 3BUWB 4NGNA 1HDQA 2WSAA 2ZW6A 4M8DA 2Q4VA 1BLLE 2ZEHA 3H4QA 4L8AA 2BL1A 4C9UA 4CDJA 1V0CA 3NFZA 3P2FA 2AFZA 3R9GA 4COGA 3CT9A 1EE3P 3FVLA 4MFKA 2IL4A 2DPSA 3PRTA 3FB3A 4NCZA 3T05A 3TO7A 1IGBA 4CPAA 4B11A 5DWMA 5LRJA 2PRQA 3PFEA 3IEHA 2YNCC
chains in the Genus database with same CATH topology
1NSAA 3PB4X 3RAMA 2O53A 4C8TA 1GYTA 3KQXA 4X8IA 1Z8LA 4MRIA 1DE4C 3SI0A 2O4HA 4JZ0A 4RUHA 5CPAA 1V6CA 2QVPA 2RB7A 4YU9A 4OC0A 2PCUA 4W9YA 3KHZA 1F57A 1AYEA 2POKA 1AMPA 5IR2A 2F7VA 3B35A 1CX8A 4DUKA 3B3TA 4R76A 3FX6A 4PXBA 4DYOA 5F09A 5CBMA 2PJ6A 4MHYA 4CDKA 3K9TA 3NH4A 2JBJA 3PBEA 4OC2A 1CG2A 3MN8A 4KSIA 5JH9A 3KGQA 3H8GA 4PPZA 2DEAA 4B6ZA 1ZG7A 3BHXA 3JRUA 2XEJA 5D29A 3HLPA 5JM6A 4OC4A 3WC7A 4P45A 4K3NA 2ZELA 3PFOA 2ZENA 1TKJA 2FVGA 3PEIA 3BXMA 4MMOA 1LAMA 4C9VA 4MHZA 2ZEMA 5LYDA 3KHXA 3BI0A 1HEEA 3ISXA 3D4UA 4C86A 1UWYA 4P10A 3VTAA 4R7MA 4C8PA 3RZAA 5HVHA 4FBEA 3PB6X 1OBRA 3IFEA 4X3RA 4C9EA 4UEFA 1JQGA 1RTQA 4P4EA 4FUUA 2PVVA 1CPSA 4UEEA 2IQ6A 4A39A 1Y9ZA 3I6SA 4C99A 3H8EA 3D68A 4IK2A 4P44A 3WT4A 2ZEPA 5DS0A 4UEZA 2PJ3A 2V8VA 2ZEOA 4TWEA 1XFOA 1Y0RA 3WABA 2RFHA 4C8UA 1ELLP 3TX8A 2PJAA 4BD9A 4OC1A 1CP6A 2BCOA 2C6CA 4Q7AA 1LAPA 4OC3A 5K8MA 1XMBA 4TJVA 2F8HA 3KL9A 1CBXA 4NGMA 1XJOA 2ZEFA 4NJRA 4A38A 2CTBA 4UIAA 3D67A 3KASA 1BAVA 2BO9A 2AFXA 2GLJA 1VGYA 2PIZA 4P4JA 3S9MA 1TKFA 1XBUA 5LYIA 4UIBA 4A37A 2Q4ZA 5ELYA 4NGSA 2WZNA 1TKHA 4R6TA 3S9NA 4MHNA 2Q43A 3D7GA 4P6YA 1FT7A 4PXCA 1QQ9A 3GUXA 4EWTA 2NSMA 4GM5A 2EK8A 1DTDA 4OKOA 4ZY0A 2HB6A 2PIYA 3I74A 4EFDA 1IY7A 2V8DA 4G1PA 3VATA 3FEDA 4IHMA 4PQAA 2PJ1A 1ARLA 4FAIA 3IJ3A 2EWBA 3SJEA 4H2KA 2GU2A 4NGTA 3D7DA 1Y0YA 2BOAA 2JEWA 3PB8X 3V7ZA 4JYWA 4P4DA 1ZG9A 1LANA 3WC6A 3I1UA 4P4BA 5LRKA 3DGVA 2XEIA 2NYQA 4ZX9A 2AFUA 1Q7LA 3K2KA 2Q51A 3ICUA 4P4FA 4ZYQA 4NJQA 1YW6A 4YWYA 3SJFA 1LCPA 4ZY1A 4AXVA 2PJ4A 3LMSA 3D7HA 3T8WA 2XEFA 3VARA 4F9VA 4WWVA 2C6PA 4P4IA 4C85A 1F2PA 2PE3A 3SJXA 1KWMA 1TF9A 2ZEDA 3EIFA 2ZEGA 2PJ5A 4F8ZA 3IC1A 3NH8A 3BI1A 1TXRA 3IO1A 2OR4A 1F2OA 3MRUA 5I4MA 2AFSA 1PCAA 2C5QA 3KR5A 1YLOA 4TNUA 3FECA 2HC9A 2PJ8A 5IB9A 1LOKA 4IAVA 1XF1A 4PXDA 3KZWA 4F9UA 2WYRA 2PJBA 3FF3A 3FH4A 4MCRA 3IWWA 1Z2LA 1R43A 1VHEA 5D8NA 4C8AA 3NA6A 4LQGA 2AFOA 4OC5A 5K8NA 4TJXA 4UF4A 3TC8A 3PB7X 2ZOFA 3WC5A 4EMEA 2OOTA 4NGPA 2PVWA 4DJLA 3QNVA 2JBKA 3B3WA 4PXEA 5K8PA 3D7FA 5HXDA 1BPNA 4ZX8A 4C8FA 4OP4A 1TF8A 2GLFA 3S9LA 4MCQA 2QJ8A 3SI2A 1QMUA 3D66A 3PBBA 1YSJA 1WVMA 5JGFA 2C1CA 3KQZA 3SI1A 7CPAA 3KI9A 2V77A 3LWUA 3H8FA 4YN3A 2CTCA 4C84A 1YMEA 1YW4A 2I3CA 3N5FA 2IMOA 1H8LA 2PJCA 3CDXA 2CF4A 4R8FA 3ISZA 5LYLA 4OIWA 3IIBA 3FMCA 1CPXA 1PYTB 2PJ9A 1Y7EA 4ONWA 2AFWA 2ABZA 1ELMP 5LYFA 4NFRA 3B7IA 1XRYA 2G9DA 2PJ7A 4O23A 1VHOA 2GREA 2ZEEA 2XEGA 3B2YA 4C9RA 4MCSA 2EK9A 1CP7A 2V8GA 3NH5A 4KNGE 4ZI6A 1R3NA 1LFWA 4C9AA 5LRGA 3KR4A 2CIJA 4MHPA 4MXUA 2GP4A 4ZY2A 2V8HA 3VH9A 3CPXA 4OMEA 3FJUA 5THWA 1FNOA 5HVFA 2PJ2A 4NGRA 1ZG8A 3L2NA 4OIDA 3PB9X 3CPAA 3B3SA 3FEEA 3RBUA 2ZOGA 3DLJA 4WJBA 3GLJA 1VIXA 4Z65A 4NGQA 2VL1A 5HVGA 6CPAA 3GB0A 4C8CA 4MCPA 4X2TA 2QYVA 8CPAA 3HUVA 2ANPA 1ZLIA 4FWUA 2C6GA 1M4LA 2IJZA 5J1QA 2J9AA 3B3VA 1BPMA 1HDUA 1ARMA 3SJGA 5K8OA 2PJ0A 1ZLHA 3V38A 1Z5RA 4A94A 2AFMA 3B3CA 4NGNA 1HDQA 1BLLE 2ZEHA 4C9UA 4CDJA 3NFZA 2AFZA 3CT9A 1EE3P 3FVLA 3PRTA 1IGBA 4CPAA 5LRJA 2PRQA 3PFEA 3IEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NSA A;  3PB4 X;  3RAM A;  2O53 A;  4C8T A;  1GYT A;  3KQX A;  4X8I A;  1Z8L A;  4MRI A;  1DE4 C;  3SI0 A;  2O4H A;  4JZ0 A;  4RUH A;  5CPA A;  1V6C A;  2QVP A;  2RB7 A;  4YU9 A;  4OC0 A;  2PCU A;  4W9Y A;  3KHZ A;  1F57 A;  1AYE A;  2POK A;  1AMP A;  2F7V A;  3B35 A;  1CX8 A;  4DUK A;  3B3T A;  4R76 A;  3FX6 A;  4PXB A;  4DYO A;  5F09 A;  5CBM A;  2PJ6 A;  4MHY A;  4CDK A;  3K9T A;  3NH4 A;  2JBJ A;  3PBE A;  4OC2 A;  1CG2 A;  3MN8 A;  4KSI A;  5JH9 A;  3KGQ A;  3H8G A;  4PPZ A;  2DEA A;  4B6Z A;  1ZG7 A;  3BHX A;  3JRU A;  2XEJ A;  5D29 A;  3HLP A;  5JM6 A;  4OC4 A;  3WC7 A;  4P45 A;  4K3N A;  2ZEL A;  3PFO A;  2ZEN A;  1TKJ A;  2FVG A;  3PEI A;  3BXM A;  4MMO A;  1LAM A;  4C9V A;  4MHZ A;  2ZEM A;  5LYD A;  3KHX A;  3BI0 A;  1HEE A;  3ISX A;  3D4U A;  4C86 A;  1UWY A;  4P10 A;  3VTA A;  4R7M A;  4C8P A;  3RZA A;  5HVH A;  4FBE A;  3PB6 X;  1OBR A;  3IFE A;  4X3R A;  4C9E A;  4UEF A;  1JQG A;  1RTQ A;  4P4E A;  4FUU A;  2PVV A;  1CPS A;  4UEE A;  2IQ6 A;  4A39 A;  1Y9Z A;  3I6S A;  4C99 A;  3H8E A;  3D68 A;  4IK2 A;  4P44 A;  3WT4 A;  2ZEP A;  5DS0 A;  4UEZ A;  2PJ3 A;  2V8V A;  2ZEO A;  4TWE A;  1XFO A;  1Y0R A;  3WAB A;  2RFH A;  4C8U A;  1ELL P;  3TX8 A;  2PJA A;  4BD9 A;  4OC1 A;  1CP6 A;  2BCO A;  2C6C A;  4Q7A A;  1LAP A;  4OC3 A;  5K8M A;  1XMB A;  4TJV A;  2F8H A;  3KL9 A;  1CBX A;  4NGM A;  1XJO A;  2ZEF A;  4NJR A;  4A38 A;  2CTB A;  4UIA A;  3D67 A;  3KAS A;  1BAV A;  2BO9 A;  2AFX A;  2GLJ A;  1VGY A;  2PIZ A;  4P4J A;  3S9M A;  1TKF A;  1XBU A;  5LYI A;  4UIB A;  4A37 A;  2Q4Z A;  5ELY A;  4NGS A;  2WZN A;  1TKH A;  4R6T A;  3S9N A;  4MHN A;  2Q43 A;  3D7G A;  4P6Y A;  1FT7 A;  4PXC A;  1QQ9 A;  3GUX A;  4EWT A;  2NSM A;  4GM5 A;  2EK8 A;  1DTD A;  4OKO A;  4ZY0 A;  2HB6 A;  2PIY A;  3I74 A;  4EFD A;  1IY7 A;  2V8D A;  4G1P A;  3VAT A;  3FED A;  4IHM A;  4PQA A;  2PJ1 A;  1ARL A;  4FAI A;  3IJ3 A;  2EWB A;  3SJE A;  4H2K A;  2GU2 A;  4NGT A;  3D7D A;  1Y0Y A;  2BOA A;  2JEW A;  3PB8 X;  3V7Z A;  4JYW A;  4P4D A;  1ZG9 A;  1LAN A;  3WC6 A;  3I1U A;  4P4B A;  5LRK A;  3DGV A;  2XEI A;  2NYQ A;  4ZX9 A;  2AFU A;  1Q7L A;  3K2K A;  2Q51 A;  3ICU A;  4P4F A;  4ZYQ A;  4NJQ A;  1YW6 A;  4YWY A;  3SJF A;  1LCP A;  4ZY1 A;  4AXV A;  2PJ4 A;  3LMS A;  3D7H A;  3T8W A;  2XEF A;  3VAR A;  4F9V A;  4WWV A;  2C6P A;  4P4I A;  4C85 A;  1F2P A;  2PE3 A;  3SJX A;  1KWM A;  1TF9 A;  2ZED A;  3EIF A;  2ZEG A;  2PJ5 A;  4F8Z A;  3IC1 A;  3NH8 A;  3BI1 A;  1TXR A;  3IO1 A;  2OR4 A;  1F2O A;  3MRU A;  5I4M A;  2AFS A;  1PCA A;  3KR5 A;  1YLO A;  4TNU A;  3FEC A;  2HC9 A;  2PJ8 A;  5IB9 A;  1LOK A;  4IAV A;  1XF1 A;  4PXD A;  3KZW A;  4F9U A;  2WYR A;  2PJB A;  3FF3 A;  3FH4 A;  4MCR A;  3IWW A;  1Z2L A;  1R43 A;  1VHE A;  5D8N A;  4C8A A;  3NA6 A;  4LQG A;  2AFO A;  4OC5 A;  5K8N A;  4TJX A;  4UF4 A;  3TC8 A;  3PB7 X;  2ZOF A;  3WC5 A;  4EME A;  2OOT A;  4NGP A;  2PVW A;  4DJL A;  3QNV A;  2JBK A;  3B3W A;  4PXE A;  5K8P A;  3D7F A;  5HXD A;  1BPN A;  4ZX8 A;  4C8F A;  4OP4 A;  1TF8 A;  2GLF A;  3S9L A;  4MCQ A;  2QJ8 A;  3SI2 A;  1QMU A;  3D66 A;  3PBB A;  1YSJ A;  1WVM A;  5JGF A;  2C1C A;  3KQZ A;  3SI1 A;  7CPA A;  3KI9 A;  2V77 A;  3LWU A;  3H8F A;  4YN3 A;  2CTC A;  4C84 A;  1YME A;  1YW4 A;  2I3C A;  3N5F A;  2IMO A;  1H8L A;  2PJC A;  3CDX A;  2CF4 A;  4R8F A;  3ISZ A;  5LYL A;  4OIW A;  3IIB A;  3FMC A;  1CPX A;  1PYT B;  2PJ9 A;  1Y7E A;  4ONW A;  2AFW A;  2ABZ A;  1ELM P;  5LYF A;  4NFR A;  3B7I A;  1XRY A;  2G9D A;  2PJ7 A;  4O23 A;  1VHO A;  2GRE A;  2ZEE A;  2XEG A;  3B2Y A;  4C9R A;  4MCS A;  2EK9 A;  1CP7 A;  2V8G A;  3NH5 A;  4KNG E;  4ZI6 A;  1R3N A;  1LFW A;  4C9A A;  5LRG A;  3KR4 A;  2CIJ A;  4MHP A;  4MXU A;  4ZY2 A;  2V8H A;  3VH9 A;  3CPX A;  4OME A;  3FJU A;  5THW A;  1FNO A;  5HVF A;  2PJ2 A;  4NGR A;  1ZG8 A;  3L2N A;  4OID A;  3PB9 X;  3CPA A;  3B3S A;  3FEE A;  3RBU A;  2ZOG A;  3DLJ A;  4WJB A;  3GLJ A;  1VIX A;  4Z65 A;  4NGQ A;  2VL1 A;  5HVG A;  6CPA A;  3GB0 A;  4C8C A;  4MCP A;  4X2T A;  2QYV A;  8CPA A;  3HUV A;  2ANP A;  1ZLI A;  4FWU A;  2C6G A;  1M4L A;  2IJZ A;  5J1Q A;  2J9A A;  3B3V A;  1BPM A;  1HDU A;  1ARM A;  3SJG A;  5K8O A;  2PJ0 A;  1ZLH A;  3V38 A;  1Z5R A;  4A94 A;  2AFM A;  3B3C A;  4NGN A;  1HDQ A;  1BLL E;  2ZEH A;  4C9U A;  4CDJ A;  3NFZ A;  2AFZ A;  3CT9 A;  1EE3 P;  3FVL A;  3PRT A;  1IGB A;  4CPA A;  5LRJ A;  2PRQ A;  3PFE A;  3IEH A; 
#chains in the Genus database with same CATH topology
 2OH1 A;  1NSA A;  3JVN A;  3PB4 X;  1L0C A;  3EZA A;  4IIY A;  2O28 A;  4MJ8 A;  2VZZ A;  3RAM A;  2O53 A;  3D8P A;  4M6H A;  3UY5 A;  5IX3 A;  1BXR B;  3T90 A;  5KTD A;  3TLG B;  2B5G A;  4NSQ A;  4C8T A;  1GYT A;  3KQX A;  1M4D A;  1YVO A;  2H5M A;  1Z9U A;  1Z8L A;  4UCN A;  4PSX A;  4MRI A;  4X8I A;  3RNZ A;  1DE4 C;  1Z8W A;  3SI0 A;  4A31 A;  5K99 A;  2FM4 A;  2O4H A;  4JZ0 A;  4NEX A;  5CPA A;  4RUH A;  1V6C A;  4EYS A;  2QVP A;  4H6U A;  2RB7 A;  3F9K C;  2Y1M A;  3IWG A;  5FVJ A;  4YU9 A;  3MGD A;  4OC0 A;  2PCU A;  4JWP A;  1Q5X A;  5I0C A;  2FE7 A;  3TE4 A;  4W9Y A;  3KHZ A;  1F57 A;  2C27 A;  3O8Z A;  4NF1 A;  5G22 A;  1AYE A;  4OAE A;  2POK A;  1I12 A;  4GPL B;  2A4N A;  1FY7 A;  1AMP A;  3R95 A;  4Y49 C;  2F7V A;  4B5P B;  5IR2 A;  3QAY A;  3B35 A;  1YR0 A;  1CX8 A;  2REE A;  4DUK A;  4RI1 A;  3B3T A;  4CGM A;  2AUN A;  1WK4 A;  3KRV A;  4R76 A;  3FX6 A;  5AGE A;  3BUO B;  1X12 A;  4PXB A;  4DYO A;  3TYX A;  1XEB A;  3BJ8 A;  4R9M A;  1VBH A;  5F09 A;  2X7B A;  3DDD A;  3SHP A;  4CYO A;  5KTA A;  3CXQ A;  4C68 A;  5CBM A;  2PJ6 A;  2YNC A;  1A9X B;  3D2M A;  3NE7 A;  2XPN A;  4MHY A;  2K5T A;  2OU2 A;  4CDK A;  4KLW A;  3K9T A;  3VGO A;  3NH4 A;  2JBJ A;  1CM0 A;  1C3O B;  3PBE A;  4IIX A;  4OC2 A;  2VEZ A;  3SR3 A;  2Z3N A;  1CG2 A;  3MN8 A;  1M44 A;  4KSI A;  1CJW A;  5JH9 A;  3KGQ A;  4OAD A;  3H8G A;  3TLC A;  1Z9E A;  2WPW A;  4PK3 A;  4U5Y A;  4PPZ A;  1CS0 B;  2DEA A;  4B6Z A;  4AG7 A;  3OB1 B;  2HUZ A;  1ZG7 A;  2R1I A;  2CNM A;  4M6G A;  1K4J A;  4KUB A;  3BHX A;  3JRU A;  2XEJ A;  4HNW B;  4EVY A;  2BEI A;  1AUG A;  5D29 A;  3HLP A;  4KS9 A;  4OC4 A;  1IOF A;  3WC7 A;  5JM6 A;  4P45 A;  3W6S A;  2Y1N A;  2Z3O A;  4K3N A;  2ZEL A;  3PFO A;  2ZEN A;  1TIQ A;  4KOY A;  3S6H A;  5AG7 A;  2VKZ G;  2XPL A;  1TKJ A;  2FVG A;  3PEI A;  4OLL A;  2ZPA A;  4H89 A;  3BXM A;  4MMO A;  1LAM A;  4C9V A;  4MHZ A;  2ZEM A;  1Z4R A;  5LYD A;  3KHX A;  3D2P A;  1MJ9 A;  3BI0 A;  2OZG A;  1HEE A;  2CNT A;  2GFQ A;  2HRO A;  3P2H A;  4B12 A;  1Z8X A;  5ISV A;  5FD8 A;  2EZA A;  3ISX A;  3D4U A;  2ODF A;  4C86 A;  1UWY A;  1S60 A;  5EBV A;  3HPH E;  2FL4 A;  2CXA A;  3NFQ A;  3TFY A;  4P10 A;  4KOS A;  3VTA A;  4R7M A;  4LX9 A;  2PC1 A;  5C88 A;  4C8P A;  2OLS A;  2EO8 A;  4C2Z A;  2YND A;  2BUE A;  3BLN A;  3RZA A;  5HVH A;  4FBE A;  4U9Z A;  3PB6 X;  1OBR A;  1S7L A;  5JYB A;  1SQH A;  4MFJ A;  3IFE A;  2DF5 A;  4X3R A;  4A4C A;  1IIC A;  1S7N A;  2AJ6 A;  4C9E A;  4UEF A;  4RR2 B;  1JQG A;  3H5Z A;  1RTQ A;  4P4E A;  4FUU A;  4YGO A;  2B5G B;  4A33 A;  2N3A B;  2PVV A;  1CPS A;  4UEE A;  5F47 A;  2HQY A;  1VHS A;  2IQ6 A;  3RYO A;  4A39 A;  1Y9Z A;  1LRZ A;  3I6S A;  1EZB A;  3PT1 A;  3FBU A;  3S6K A;  4C99 A;  3H8E A;  2P6F A;  3D68 A;  4IK2 A;  2B0A A;  3WR7 A;  4P44 A;  2B4D A;  3WT4 A;  4MY3 A;  4R87 A;  2ZEP A;  3T0T A;  1XOV A;  5DS0 A;  4UEZ A;  3TOB A;  2PJ3 A;  2V8V A;  2ZEO A;  4E2A A;  2YNE A;  4TWE A;  1XFO A;  2FXF A;  1KUX A;  1ON0 A;  3GYA A;  4UFV A;  1Y0R A;  4UCP A;  4XPD B;  3WAB A;  2RFH A;  5J8C A;  4II9 A;  1ZYM A;  4C8U A;  1ELL P;  3TX8 A;  1UFH A;  3B8G A;  4B5O A;  2PJA A;  2FS5 A;  4JJX A;  1MK4 A;  4BD9 A;  4UWJ A;  4OC1 A;  2F5I A;  4RS2 A;  1CP6 A;  5H84 A;  1KEE B;  2CBL A;  4FD6 A;  4HPS A;  2BCO A;  5F13 A;  2BSW A;  2C6C A;  5F1Y A;  3N7Z A;  3TLB A;  4Q7A A;  4DNC A;  1LAP A;  4OC3 A;  1Q2C A;  2I00 A;  2PR1 A;  2QML A;  3T07 A;  4C8F A;  5K8M A;  1XMB A;  1B47 A;  4TJV A;  2F8H A;  3DR6 A;  4HNY B;  3KL9 A;  4FAI A;  1CBX A;  4NGM A;  1XJO A;  2ZEF A;  2YJT A;  3G8W A;  4NJR A;  1J3L A;  1JDE A;  4A38 A;  3EXN A;  2CTB A;  3IU1 A;  4GXH A;  4MFZ A;  3D67 A;  3KAS A;  4UIA A;  1BAV A;  1ZO0 A;  2AFX A;  2BO9 A;  2FCK A;  2AUM A;  5HH1 A;  1GHE A;  2JDC A;  2ZW5 A;  5HMN A;  3OP0 A;  1VGY A;  2GLJ A;  1EO0 A;  2PIZ A;  1S3Z A;  4P4J A;  3S9M A;  1IID A;  2B3U A;  1TKF A;  2R7H A;  1XBU A;  3S6F A;  4U9Y A;  5AG5 A;  4UCM A;  5LYI A;  4UIB A;  1Q2D A;  3LAC A;  4PV6 A;  4A37 A;  2Q4Z A;  3PLF B;  5ELY A;  4NGS A;  3OB2 B;  3CXP A;  3PP9 A;  4JLY A;  3U1B A;  5CNP A;  2WZN A;  4CZ1 A;  4R3L A;  5F48 A;  1TKH A;  2D4P A;  4R6T A;  2G0B A;  4MHD A;  2DIK A;  3S9N A;  4MHN A;  4XNH B;  2Q43 A;  3D7G A;  2P6E A;  4P6Y A;  1FT7 A;  3K4I A;  4PXC A;  4XPK A;  3GJZ A;  4COB A;  3JTK A;  1QQ9 A;  3GUX A;  4A30 A;  4EWT A;  5BY0 A;  1QSR A;  2NSM A;  4GM5 A;  2EK8 A;  1DTD A;  4OKO A;  4X5K A;  2HB6 A;  2PIY A;  4KOT A;  4ZY0 A;  1C30 B;  3VRR A;  1IOI A;  1IY7 A;  2G3T A;  2V8D A;  4G1P A;  4UA3 A;  3FIX A;  3VAT A;  3FED A;  2GIV A;  4IHM A;  4PQA A;  4I49 A;  2PJ1 A;  4QVT A;  4CAF A;  2OB0 A;  1ARL A;  2P6G A;  1OZP A;  4E8O A;  2Z10 A;  3IJ3 A;  4KOV A;  2R8V A;  4AG9 A;  2EWB A;  4IUS A;  3SJE A;  1Q2Y A;  1QST A;  5AG4 A;  2PRB A;  3VWE A;  1M1D A;  3PGP A;  1XF8 A;  1FBV A;  1YLE A;  2Z3K A;  4H2K A;  2GU2 A;  4KVO E;  4A2Z A;  4NGT A;  4F0X A;  3D7D A;  1Y0Y A;  2BOA A;  2AE6 A;  2JEW A;  3PB8 X;  2PQ8 A;  4JYW A;  4UFX A;  3V7Z A;  4P4D A;  1ZG9 A;  1LAN A;  3NOJ A;  4KZT A;  3VRP A;  2Q44 A;  1N71 A;  3WC6 A;  2ZW4 A;  5HKW A;  2NMT A;  3I1U A;  4P4B A;  4IF5 A;  5LRK A;  5F5X A;  1ZL0 A;  4CGL A;  2XPP A;  3DGV A;  2D4O A;  2GE3 A;  2XEI A;  4H1H A;  2NYQ A;  2CNS A;  4JXQ A;  4ZX9 A;  4BTF A;  1Q7L A;  2AFU A;  2Q51 A;  1P4N A;  3K2K A;  3ICU A;  4P4F A;  3ZZI A;  4ZBG A;  2JDD A;  1XMT A;  3F5B A;  3EZE A;  4HKF A;  4ZYQ A;  3OAK A;  4NJQ A;  2ZW7 A;  4QB9 A;  4MBU A;  3VRN A;  4BBH A;  5H86 A;  1R61 A;  3EO4 A;  4YRH A;  1YW6 A;  4YWY A;  5AXI A;  3SJF A;  1LCP A;  3KKW A;  4ZY1 A;  4AXV A;  4RN7 A;  2PJ4 A;  3E0K A;  3LMS A;  3LD2 A;  3D7H A;  4M6I A;  2YGW A;  3TTH A;  4KOU A;  2XEF A;  2KCW A;  3FRM A;  5G21 A;  4MFQ A;  3T8W A;  3VAR A;  4MI1 A;  4MI4 A;  4BPX B;  3VRO A;  4F9V A;  4NXY A;  2Z3L A;  4AB7 A;  4WWV A;  2C6P A;  1S5K A;  4B10 A;  1NXJ A;  2Q04 A;  3CXS A;  4A32 A;  3D3S A;  4P4I A;  4C85 A;  1F2P A;  2PE3 A;  3SJX A;  3TOA A;  5J8F A;  1KWM A;  4ORF A;  4BPU B;  1TF9 A;  4LQ6 A;  2YJV A;  2ZED A;  1Z8T A;  3EIF A;  2ZXV A;  2ZEG A;  2WUU A;  2PJ5 A;  4L89 A;  1M6V B;  1NE9 A;  4AVC A;  3IC1 A;  3NH8 A;  3BI1 A;  1TXR A;  3IO1 A;  4F8Z A;  2OR4 A;  1Z4E A;  4GS4 A;  1F2O A;  2Q7S A;  4K30 A;  4R3K A;  1CE8 B;  2EZC A;  3MRU A;  5IB0 A;  4BPW B;  2REF A;  5I4M A;  2AFS A;  2FIA A;  4JD6 A;  3PZJ A;  1S7F A;  4C7H A;  3PFV A;  1PCA A;  3I74 A;  2C5Q A;  3T9Y A;  3KR5 A;  3BUN B;  5JQ4 A;  1YLO A;  4TNU A;  4C2Y A;  1A2Z A;  3FEC A;  2HC9 A;  2PJ8 A;  4XPL A;  4A95 A;  4B14 A;  3ZJ0 A;  4C2X A;  1LOK A;  5IB9 A;  3TLE A;  3TLZ A;  4IAV A;  1XF1 A;  4PXD A;  4CS0 B;  5HKY A;  3KZW A;  3TLA A;  3BUM B;  4ZGY B;  4F9U A;  3DNS A;  3OWC A;  2WYR A;  2PJB A;  4UBR A;  3TCV A;  4YFJ A;  3FF3 A;  5HKZ A;  4JVO A;  3FH4 A;  3LOD A;  2EVN A;  4M3S A;  5EMI A;  4MCR A;  1P0H A;  1PUA A;  3S6G A;  3IWW A;  1Z2L A;  2VQY A;  3TO9 A;  2QEC A;  3F8K A;  3HMJ G;  1IU8 A;  3T5M A;  4E94 A;  1R43 A;  5G20 A;  1VHE A;  5D8N A;  3EFA A;  5G1Z A;  1Y9W A;  4C8A A;  4B13 A;  1WJT A;  4JXR A;  1M4G A;  3NA6 A;  4LQG A;  4KVX A;  2I79 A;  2B3V A;  2UV8 G;  4QUS A;  2AFO A;  2Q7B A;  5KTC A;  4XPD C;  4OC5 A;  5K8N A;  2PR8 A;  4KSF A;  4TJX A;  4H6Z A;  4UF4 A;  3TC8 A;  4QBJ A;  3PB7 X;  2ZOF A;  1T36 B;  2CY2 A;  2EBJ A;  3WC5 A;  4EME A;  2D0O A;  2VBQ A;  1EZA A;  3HPG G;  2OOT A;  4NGP A;  3EC4 A;  2PVW A;  4DJL A;  1NBW A;  3V8I A;  2B4B A;  3QNV A;  2JBK A;  3B3W A;  4PXE A;  2D0P A;  3U88 C;  5JVL A;  5K8P A;  3D7F A;  5HXD A;  2GAN A;  2B4J C;  1BPN A;  4KOX A;  4ZX8 A;  4OP4 A;  1TF8 A;  2GLF A;  1YQE A;  5F49 A;  3W6X A;  3S9L A;  2ARH A;  2WPX A;  1RXT A;  4MCQ A;  2QJ8 A;  4HNX B;  3SI2 A;  3VWD A;  5AG6 A;  1QMU A;  4AVA A;  2DXQ A;  2P0W A;  2Z3M A;  3D66 A;  4CYQ A;  4CYN A;  3DSB A;  3PBB A;  2EZB A;  1YSJ A;  2EUI A;  4Y49 B;  1WVM A;  4INJ A;  1NSL A;  5JGF A;  2C1C A;  2J8N A;  3BUX B;  5F46 A;  5E96 A;  1JWQ A;  2J8M A;  2FIW A;  4EFD A;  4CO9 A;  3R9F A;  3KQZ A;  4KOW A;  2JEV A;  3SI1 A;  7CPA A;  1YRE A;  3KI9 A;  3K9U A;  4M85 A;  2JLM A;  5BWA B;  1NMT A;  2V77 A;  3RO0 A;  3R96 A;  3LWU A;  4MY0 A;  2Z0Z A;  3FNC A;  3H8F A;  3QAH A;  3R1K A;  1PU9 A;  2R98 A;  1JDB C;  4FD5 A;  2PCN A;  2CTC A;  2QIR A;  5GCN A;  2FT0 A;  2PDO A;  4YN3 A;  4C84 A;  1YME A;  1YW4 A;  2I3C A;  2FSR A;  3GY9 A;  2IMO A;  1Y7R A;  1H8L A;  1KUV A;  3F0A A;  3I3G A;  3N5F A;  2PJC A;  4CYP A;  1M4I A;  2OZU A;  4XNH C;  1WWZ A;  3CDX A;  1YGH A;  2VI7 A;  3EY5 A;  2CF4 A;  2DPT A;  4R8F A;  3ISZ A;  4Q36 A;  4OIW A;  5LYL A;  4KOR A;  4J3G A;  3IIB A;  4KSA A;  4C7I A;  3FMC A;  1CPX A;  1I21 A;  4E0A A;  3C8O A;  3QB8 A;  1PYT B;  1Y9K A;  2DLA A;  4CRY B;  3FYN A;  2PJ9 A;  1Y7E A;  2VZY A;  4CGN A;  4ONW A;  4FD4 A;  2AFW A;  2ABZ A;  1R57 A;  3W91 A;  4KVM E;  3VRQ A;  4AVB A;  3TLG A;  1ELM P;  5LYF A;  1YX0 A;  1B6B A;  4CAV A;  1IYL A;  3SXO A;  2PSW A;  1KZF A;  4NFR A;  4UFW A;  3G3S A;  4LUA A;  4MJX A;  4BMH A;  1S7K A;  2B4D B;  3JUW A;  1BO4 A;  1J4J A;  4CGO A;  5EC4 A;  3B7I A;  2R82 A;  3IGR A;  1XRY A;  2G9D A;  2PJ7 A;  3GKR A;  1ZRS A;  4O23 A;  1VHO A;  2GRE A;  2ZEE A;  4CAW A;  2XEG A;  1RO5 A;  1X10 A;  3B2Y A;  3TT2 A;  1DIK A;  4C9R A;  1QSM A;  3GIU A;  2Z3P A;  1KC7 A;  4MCS A;  2EK9 A;  4A4B A;  1CP7 A;  1YK3 A;  2V8G A;  4CAX A;  3NH5 A;  4KNG E;  1KBL A;  2J8R A;  4ZI6 A;  3TO6 A;  1R3N A;  1LFW A;  2ATR A;  1BOB A;  4C9A A;  4KUA A;  1QSN A;  4MFP A;  4R57 A;  5LRG A;  4B5P A;  1VI4 A;  3KR4 A;  2CIJ A;  4MHP A;  4MXU A;  2GP4 A;  3R9E A;  4ZY2 A;  1MJB A;  5A27 A;  2OZH A;  1GGO A;  2V8H A;  3VH9 A;  3CPX A;  4OME A;  1B87 A;  1XIX A;  3FJU A;  5THW A;  3EZB A;  1FNO A;  1XE4 A;  3ZNI A;  5DWN A;  5HVF A;  2HV2 A;  2PJ2 A;  4NGR A;  1ZG8 A;  3I9S A;  3L2N A;  3IU2 A;  4F6A A;  4OID A;  5JPH A;  4CGP A;  2G3A A;  2RC4 A;  1I1D A;  2Q4Y A;  3PB9 X;  5F9M A;  3CPA A;  4PK2 A;  3B3S A;  4FD7 A;  3DR8 A;  3FEE A;  3RBU A;  1KUY A;  2ZOG A;  3BJ7 A;  4CRZ B;  2VXK A;  1IYK A;  3DLJ A;  4PSW A;  4WJB A;  3GLJ A;  4KLV A;  4CAE A;  1VIX A;  5IV0 A;  4Z65 A;  4NGQ A;  1MJA A;  2VL1 A;  5HVG A;  4J0N A;  6CPA A;  3FXT A;  3GB0 A;  4MFL A;  3G23 A;  2Z11 A;  4C8C A;  5J3X A;  4MCP A;  2B58 A;  3A9L A;  4X2T A;  3TLY A;  5A28 A;  1VKC A;  1QSO A;  2Q0Y A;  2QYV A;  8CPA A;  2HI6 A;  3C26 A;  3HUV A;  1VBG A;  2MP0 A;  2ANP A;  1ZLI A;  1YVH A;  4FWU A;  2C6G A;  1M4L A;  3IWE A;  4F0Y A;  5C82 A;  2XPO A;  4BIN A;  2IJZ A;  3SXN A;  5J1Q A;  3CZX A;  2HWG A;  2J9A A;  3B3V A;  4ONU A;  2E28 A;  2Y0M A;  1BPM A;  1HDU A;  1IB1 E;  1ARM A;  3SJG A;  1U6M A;  4E5S A;  4UWI A;  5K8O A;  2PJ0 A;  4Q38 A;  1YVK A;  1ZLH A;  4QC6 A;  3V38 A;  1Z5R A;  3NE8 A;  4A94 A;  2AFM A;  3B3C A;  2X0S A;  3BUW B;  4NGN A;  1HDQ A;  2WSA A;  2ZW6 A;  4M8D A;  2Q4V A;  1BLL E;  2ZEH A;  3H4Q A;  4L8A A;  2BL1 A;  4C9U A;  4CDJ A;  1V0C A;  3NFZ A;  3P2F A;  2AFZ A;  3R9G A;  4COG A;  3CT9 A;  1EE3 P;  3FVL A;  4MFK A;  2IL4 A;  2DPS A;  3PRT A;  3FB3 A;  4NCZ A;  3T05 A;  3TO7 A;  1IGB A;  4CPA A;  4B11 A;  5DWM A;  5LRJ A;  2PRQ A;  3PFE A;  3IEH A;  2YNC C; 
#chains in the Genus database with same CATH homology
 1NSA A;  3PB4 X;  3RAM A;  2O53 A;  4C8T A;  1GYT A;  3KQX A;  4X8I A;  1Z8L A;  4MRI A;  1DE4 C;  3SI0 A;  2O4H A;  4JZ0 A;  4RUH A;  5CPA A;  1V6C A;  2QVP A;  2RB7 A;  4YU9 A;  4OC0 A;  2PCU A;  4W9Y A;  3KHZ A;  1F57 A;  1AYE A;  2POK A;  1AMP A;  5IR2 A;  2F7V A;  3B35 A;  1CX8 A;  4DUK A;  3B3T A;  4R76 A;  3FX6 A;  4PXB A;  4DYO A;  5F09 A;  5CBM A;  2PJ6 A;  4MHY A;  4CDK A;  3K9T A;  3NH4 A;  2JBJ A;  3PBE A;  4OC2 A;  1CG2 A;  3MN8 A;  4KSI A;  5JH9 A;  3KGQ A;  3H8G A;  4PPZ A;  2DEA A;  4B6Z A;  1ZG7 A;  3BHX A;  3JRU A;  2XEJ A;  5D29 A;  3HLP A;  5JM6 A;  4OC4 A;  3WC7 A;  4P45 A;  4K3N A;  2ZEL A;  3PFO A;  2ZEN A;  1TKJ A;  2FVG A;  3PEI A;  3BXM A;  4MMO A;  1LAM A;  4C9V A;  4MHZ A;  2ZEM A;  5LYD A;  3KHX A;  3BI0 A;  1HEE A;  3ISX A;  3D4U A;  4C86 A;  1UWY A;  4P10 A;  3VTA A;  4R7M A;  4C8P A;  3RZA A;  5HVH A;  4FBE A;  3PB6 X;  1OBR A;  3IFE A;  4X3R A;  4C9E A;  4UEF A;  1JQG A;  1RTQ A;  4P4E A;  4FUU A;  2PVV A;  1CPS A;  4UEE A;  2IQ6 A;  4A39 A;  1Y9Z A;  3I6S A;  4C99 A;  3H8E A;  3D68 A;  4IK2 A;  4P44 A;  3WT4 A;  2ZEP A;  5DS0 A;  4UEZ A;  2PJ3 A;  2V8V A;  2ZEO A;  4TWE A;  1XFO A;  1Y0R A;  3WAB A;  2RFH A;  4C8U A;  1ELL P;  3TX8 A;  2PJA A;  4BD9 A;  4OC1 A;  1CP6 A;  2BCO A;  2C6C A;  4Q7A A;  1LAP A;  4OC3 A;  5K8M A;  1XMB A;  4TJV A;  2F8H A;  3KL9 A;  1CBX A;  4NGM A;  1XJO A;  2ZEF A;  4NJR A;  4A38 A;  2CTB A;  4UIA A;  3D67 A;  3KAS A;  1BAV A;  2BO9 A;  2AFX A;  2GLJ A;  1VGY A;  2PIZ A;  4P4J A;  3S9M A;  1TKF A;  1XBU A;  5LYI A;  4UIB A;  4A37 A;  2Q4Z A;  5ELY A;  4NGS A;  2WZN A;  1TKH A;  4R6T A;  3S9N A;  4MHN A;  2Q43 A;  3D7G A;  4P6Y A;  1FT7 A;  4PXC A;  1QQ9 A;  3GUX A;  4EWT A;  2NSM A;  4GM5 A;  2EK8 A;  1DTD A;  4OKO A;  4ZY0 A;  2HB6 A;  2PIY A;  3I74 A;  4EFD A;  1IY7 A;  2V8D A;  4G1P A;  3VAT A;  3FED A;  4IHM A;  4PQA A;  2PJ1 A;  1ARL A;  4FAI A;  3IJ3 A;  2EWB A;  3SJE A;  4H2K A;  2GU2 A;  4NGT A;  3D7D A;  1Y0Y A;  2BOA A;  2JEW A;  3PB8 X;  3V7Z A;  4JYW A;  4P4D A;  1ZG9 A;  1LAN A;  3WC6 A;  3I1U A;  4P4B A;  5LRK A;  3DGV A;  2XEI A;  2NYQ A;  4ZX9 A;  2AFU A;  1Q7L A;  3K2K A;  2Q51 A;  3ICU A;  4P4F A;  4ZYQ A;  4NJQ A;  1YW6 A;  4YWY A;  3SJF A;  1LCP A;  4ZY1 A;  4AXV A;  2PJ4 A;  3LMS A;  3D7H A;  3T8W A;  2XEF A;  3VAR A;  4F9V A;  4WWV A;  2C6P A;  4P4I A;  4C85 A;  1F2P A;  2PE3 A;  3SJX A;  1KWM A;  1TF9 A;  2ZED A;  3EIF A;  2ZEG A;  2PJ5 A;  4F8Z A;  3IC1 A;  3NH8 A;  3BI1 A;  1TXR A;  3IO1 A;  2OR4 A;  1F2O A;  3MRU A;  5I4M A;  2AFS A;  1PCA A;  2C5Q A;  3KR5 A;  1YLO A;  4TNU A;  3FEC A;  2HC9 A;  2PJ8 A;  5IB9 A;  1LOK A;  4IAV A;  1XF1 A;  4PXD A;  3KZW A;  4F9U A;  2WYR A;  2PJB A;  3FF3 A;  3FH4 A;  4MCR A;  3IWW A;  1Z2L A;  1R43 A;  1VHE A;  5D8N A;  4C8A A;  3NA6 A;  4LQG A;  2AFO A;  4OC5 A;  5K8N A;  4TJX A;  4UF4 A;  3TC8 A;  3PB7 X;  2ZOF A;  3WC5 A;  4EME A;  2OOT A;  4NGP A;  2PVW A;  4DJL A;  3QNV A;  2JBK A;  3B3W A;  4PXE A;  5K8P A;  3D7F A;  5HXD A;  1BPN A;  4ZX8 A;  4C8F A;  4OP4 A;  1TF8 A;  2GLF A;  3S9L A;  4MCQ A;  2QJ8 A;  3SI2 A;  1QMU A;  3D66 A;  3PBB A;  1YSJ A;  1WVM A;  5JGF A;  2C1C A;  3KQZ A;  3SI1 A;  7CPA A;  3KI9 A;  2V77 A;  3LWU A;  3H8F A;  4YN3 A;  2CTC A;  4C84 A;  1YME A;  1YW4 A;  2I3C A;  3N5F A;  2IMO A;  1H8L A;  2PJC A;  3CDX A;  2CF4 A;  4R8F A;  3ISZ A;  5LYL A;  4OIW A;  3IIB A;  3FMC A;  1CPX A;  1PYT B;  2PJ9 A;  1Y7E A;  4ONW A;  2AFW A;  2ABZ A;  1ELM P;  5LYF A;  4NFR A;  3B7I A;  1XRY A;  2G9D A;  2PJ7 A;  4O23 A;  1VHO A;  2GRE A;  2ZEE A;  2XEG A;  3B2Y A;  4C9R A;  4MCS A;  2EK9 A;  1CP7 A;  2V8G A;  3NH5 A;  4KNG E;  4ZI6 A;  1R3N A;  1LFW A;  4C9A A;  5LRG A;  3KR4 A;  2CIJ A;  4MHP A;  4MXU A;  2GP4 A;  4ZY2 A;  2V8H A;  3VH9 A;  3CPX A;  4OME A;  3FJU A;  5THW A;  1FNO A;  5HVF A;  2PJ2 A;  4NGR A;  1ZG8 A;  3L2N A;  4OID A;  3PB9 X;  3CPA A;  3B3S A;  3FEE A;  3RBU A;  2ZOG A;  3DLJ A;  4WJB A;  3GLJ A;  1VIX A;  4Z65 A;  4NGQ A;  2VL1 A;  5HVG A;  6CPA A;  3GB0 A;  4C8C A;  4MCP A;  4X2T A;  2QYV A;  8CPA A;  3HUV A;  2ANP A;  1ZLI A;  4FWU A;  2C6G A;  1M4L A;  2IJZ A;  5J1Q A;  2J9A A;  3B3V A;  1BPM A;  1HDU A;  1ARM A;  3SJG A;  5K8O A;  2PJ0 A;  1ZLH A;  3V38 A;  1Z5R A;  4A94 A;  2AFM A;  3B3C A;  4NGN A;  1HDQ A;  1BLL E;  2ZEH A;  4C9U A;  4CDJ A;  3NFZ A;  2AFZ A;  3CT9 A;  1EE3 P;  3FVL A;  3PRT A;  1IGB A;  4CPA A;  5LRJ A;  2PRQ A;  3PFE A;  3IEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...