4LQGA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor ctt1056
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Glutamate carboxypeptidase 2
publication title Structure-Activity Relationship of (18)F-Labeled Phosphoramidate Peptidomimetic Prostate-Specific Membrane Antigen (PSMA)-Targeted Inhibitor Analogues for PET Imaging of Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 264
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4lqgA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4lqgA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4lqgA02
4G1PA 3SJGA 3B35A 2EK8A 2CIJA 3SI0A 2Q51A 2ZENA 3N5FA 4O23A 4C8FA 5K8OA 2PJ0A 2I3CA 2XEFA 3PB8X 3PRTA 4F9VA 4KNGE 2ZEHA 4ZY1A 2PVWA 3KGQA 4ZX8A 4PPZA 1XFOA 2WZNA 1LCPA 4DJLA 5I4MA 4C8PA 1LAMA 1Z2LA 3PFOA 4DUKA 3LWUA 4CDKA 4A94A 3KR5A 3NH4A 4MCRA 4NGMA 1Y0YA 4C9VA 1AYEA 4FAIA 3BHXA 4PXCA 4MHPA 1VIXA 4MRIA 3BXMA 2AFWA 5CBMA 2PJ2A 3S9NA 3S9LA 4YU9A 2CTBA 3JRUA 3SI2A 4CDJA 3MRUA 4CPAA 3SJXA 1DTDA 4UIBA 5HVGA 1R43A 5JH9A 3VARA 3K2KA 2XEGA 2BO9A 4NGTA 3FVLA 2QYVA 1XMBA 2RFHA 4C99A 3NA6A 1UWYA 3ICUA 3S9MA 2PJ6A 3DLJA 1XF1A 2ZEGA 3IIBA 3B7IA 1VHOA 4MMOA 3KZWA 2O4HA 2ZELA 4TNUA 2XEJA 3KR4A 4EWTA 4OC3A 3HLPA 3B2YA 4UIAA 1QMUA 3IC1A 4FWUA 1LFWA 1F2PA 4C85A 1Y9ZA 4MHZA 1HDUA 1AMPA 4ZYQA 1ARLA 5JGFA 2AFUA 1BAVA 4NGSA 3D7HA 2ZEPA 1FNOA 5D8NA 2C6GA 5LRGA 4OC5A 1YLOA 3LMSA 2HB6A 4ZI6A 4P4JA 1EE3P 4P4IA 3CT9A 4A37A 3FF3A 3TC8A 1ELMP 3WC7A 3BI1A 2JBJA 2PJBA 4Z65A 2ZEOA 1ZLHA 2WYRA 3WC6A 3IWWA 2PJ4A 4C8TA 4DYOA 3KL9A 4R8FA 2GLFA 1Y7EA 2JBKA 4JZ0A 1LANA 5K8PA 3B3CA 4C9EA 1IGBA 3KASA 3GLJA 4MHYA 3PB7X 3KHZA 2ZEMA 3NH8A 3KHXA 3GUXA 3IJ3A 2IMOA 4PXDA 4LQGA 2PJ9A 2XEIA 3PB6X 1KWMA 5LYLA 5LRKA 4X8IA 4TJXA 4AXVA 1LOKA 4FUUA 4A39A 4OC0A 3SI1A 2PJ7A 3V7ZA 3RZAA 4H2KA 4PXBA 4BD9A 2ZEFA 4OIWA 4A38A 2AFMA 1CBXA 7CPAA 1TF8A 3CDXA 3PBEA 1YW4A 4C8AA 1HDQA 1CG2A 4NFRA 4P44A 3I74A 4JYWA 2Q43A 4P4DA 1Q7LA 1TF9A 3WABA 4OC2A 5J1QA 1Z5RA 3FMCA 3IEHA 3VH9A 4IK2A 4R76A 4NGQA 2PJ5A 3CPAA 3FECA 2CF4A 2PIZA 2PE3A 3V38A 4B6ZA 2POKA 4P4BA 3ISZA 5CPAA 3D66A 3PBBA 1F57A 2OOTA 4OC1A 2C6CA 1RTQA 2PJ1A 4Q7AA 4C8CA 5D29A 3D67A 2G9DA 1ARMA 1ZG8A 1TKFA 5HXDA 3B3WA 3SJFA 4P4EA 4NJQA 5THWA 2V8VA 2NYQA 1CPXA 3I6SA 2ZEEA 2IQ6A 2GREA 1VGYA 5IB9A 1ELLP 2PJCA 3KQXA 1ZG9A 3B3SA 4C9UA 5ELYA 3FEDA 1ZG7A 4GM5A 3CPXA 4ZY2A 5LYFA 3PB4X 3IO1A 3D7GA 3WT4A 4MHNA 5JM6A 3RAMA 3RBUA 4OIDA 3B3TA 3NFZA 2PVVA 4P45A 8CPAA 2RB7A 1IY7A 4RUHA 3I1UA 3D4UA 4TWEA 2PJ8A 4WWVA 2F8HA 2C1CA 3B3VA 2EK9A 1ZLIA 2V8DA 4YWYA 4P6YA 2V8HA 2C6PA 4UEZA 3TX8A 1YMEA 3T8WA 3L2NA 3QNVA 1Y0RA 3H8FA 2DEAA 2ABZA 1CPSA 2PJAA 5F09A 3D68A 3BI0A 1YW6A 1GYTA 3EIFA 4YN3A 2QVPA 2PCUA 2VL1A 5K8NA 1TKJA 3ISXA 4MXUA 1LAPA 4C9RA 3IFEA 5LRJA 1V6CA 6CPAA 4FBEA 4F9UA 2ANPA 3VTAA 4KSIA 3MN8A 4EFDA 1FT7A 5DS0A 3FX6A 4MCSA 3K9TA 4X3RA 5K8MA 2CTCA 4K3NA 4WJBA 2AFOA 1BPNA 2QJ8A 4P10A 2O53A 3FH4A 2OR4A 3D7FA 2EWBA 3FEEA 4C9AA 2V77A 3DGVA 2AFXA 3H8EA 4UEEA 2BCOA 3KI9A 1F2OA 2V8GA 3FJUA 2GU2A 3HUVA 3D7DA 4R7MA 2HC9A 5LYIA 1NSAA 4OP4A 4NGPA 1BLLE 4IAVA 4ZY0A 4NJRA 2NSMA 1CX8A 1YSJA 2PIYA 3VATA 4PQAA 1M4LA 4UEFA 2JEWA 4ONWA 1JQGA 2PJ3A 3H8GA 1TXRA 1XRYA 4C8UA 2FVGA 4EMEA 1BPMA 3KQZA 1CP7A 2F7VA 4X2TA 4C86A 1H8LA 4MCPA 2ZEDA 4OKOA 4PXEA 2AFZA 4OMEA 2IJZA 1CP6A 2BOAA 4IHMA 1PCAA 1R3NA 1XBUA 4F8ZA 2ZOFA 4ZX9A 1TKHA 1HEEA 1WVMA 1DE4C 4OC4A 2AFSA 3WC5A 2GLJA 5LYDA 3PFEA 1VHEA 4UF4A 3PEIA 2PRQA 4NGRA 4C84A 2Q4ZA 4W9YA 4R6TA 1QQ9A 4TJVA 2ZOGA 1XJOA 5HVHA 1OBRA 4MCQA 4P4FA 3GB0A 1PYTB 5HVFA 4NGNA 3SJEA 3PB9X 1Z8LA 3NH5A 2J9AA
chains in the Genus database with same CATH superfamily
2FIWA 5HMNA 4G1PA 3SJGA 3B35A 2Q04A 2EK8A 4B5PA 4H6ZA 1SQHA 2CIJA 4C7HA 3SI0A 2Q51A 2ZENA 3N5FA 4O23A 3EZEA 5K8OA 4C8FA 5J8CA 3OWCA 3D8PA 4BPXB 4JXQA 2PJ0A 1Z9EA 2XEFA 1B87A 2I3CA 3PB8X 3PRTA 4F9VA 2DIKA 2I00A 1IU8A 2ZEHA 4CYPA 4ZY1A 2PVWA 4KNGE 2HI6A 3KGQA 2Y1MA 1JWQA 3FYNA 4ZX8A 4PPZA 1XFOA 2WZNA 3R9EA 1LCPA 2R82A 4DJLA 2EZAA 2KCWA 2QECA 5I4MA 2D0OA 2NMTA 4C8PA 4HPSA 2VKZG 1LAMA 1Z2LA 4MFQA 3PFOA 4DUKA 4HNWB 1XE4A 2R7HA 3LWUA 1YVHA 5K99A 4CDKA 4A94A 3VRPA 1MJAA 3KR5A 5JVLA 1YVKA 3NH4A 4MCRA 1I1DA 4NGMA 3T07A 3VRNA 2R98A 4KOTA 1Y0YA 2Q7SA 4C9VA 1AYEA 4YRHA 3BJ7A 4FAIA 3BHXA 3JVNA 4PXCA 4FD7A 3EZAA 2ZW7A 3TLGB 4MHPA 2GP4A 4Q36A 1VIXA 3HPHE 4MRIA 3TLCA 1L0CA 3BXMA 2FCKA 2PQ8A 2AFWA 4GS4A 5CBMA 2PJ2A 3S9NA 4JD6A 3TLYA 3S9LA 2ZW6A 4OLLA 5F9MA 3K9UA 3N7ZA 4A4BA 1QSRA 4YU9A 2CTBA 3JRUA 4KSFA 5F47A 3SI2A 4CDJA 3MRUA 4CPAA 3SJXA 1DTDA 3W6SA 1S3ZA 5J8FA 2X7BA 3FIXA 3F8KA 3BUNB 1R43A 2P6FA 4KOSA 2FE7A 4KOWA 4UBRA 4UIBA 5HVGA 3VARA 5JH9A 3EO4A 4BBHA 2EZBA 4A2ZA 5HKYA 3R95A 1WK4A 5JPHA 4NEXA 3DR8A 4BTFA 3K2KA 1Y9KA 3G23A 2XEGA 4UWIA 5HKWA 2BO9A 3VROA 2YNCA 3FRMA 4CAEA 5KTDA 4NGTA 3FVLA 2QYVA 3F9KC 1XMBA 1ZO0A 2RFHA 4C99A 3NA6A 1UWYA 1X12A 3RNZA 3GIUA 1YX0A 4RS2A 3ICUA 3S9MA 3DR6A 2PJ6A 1R57A 2XPOA 1M4DA 3DLJA 4UFXA 3V8IA 5EMIA 2ZEGA 1XF1A 3IIBA 3B7IA 4XPLA 2Q0YA 1VHOA 3W91A 4MMOA 4U9YA 3KZWA 2O4HA 2XPLA 1CM0A 2ZELA 3FB3A 1TIQA 4TNUA 1QSTA 3T5MA 4E94A 2XEJA 3KR4A 4RR2B 4ORFA 1V0CA 4EWTA 2F5IA 5IB0A 2YJVA 1A2ZA 4R3KA 5HKZA 4OC3A 2WPWA 3HLPA 4A32A 2G0BA 3B2YA 4UIAA 3TOAA 2REFA 5H84A 1QMUA 3CXPA 4A33A 3IC1A 2XPPA 4FWUA 4MJ8A 1LFWA 2I79A 4HKFA 1F2PA 4C85A 2K5TA 5IV0A 2B4DA 1Y9ZA 4MHZA 1QSOA 1HDUA 1AMPA 4ZYQA 1ARLA 3VWDA 4DNCA 5JGFA 2AFUA 2Z3LA 2FIAA 2J8NA 4UFVA 3FXTA 4A30A 1BAVA 4NGSA 2CNTA 1J3LA 3D7HA 2ZEPA 1FNOA 5D8NA 2C6GA 5LRGA 4OC5A 1YLOA 2P6EA 2BUEA 3LMSA 2HB6A 4OADA 4P4JA 4ZI6A 1MJBA 1IIDA 1EE3P 4P4IA 4B10A 3OP0A 3CT9A 1B6BA 4MFPA 4A37A 5KTAA 3TLZA 2GFQA 4BINA 1AUGA 5JYBA 3FF3A 3LACA 1ELMP 3DSBA 3TC8A 3WC7A 2OZGA 3BI1A 1M4IA 1UFHA 4XNHC 1C3OB 2JBJA 2PJBA 4Z65A 2HROA 3D2MA 2ZEOA 5F49A 2AJ6A 1PU9A 1ZLHA 4U9ZA 2GIVA 3BUWB 3G8WA 2PSWA 2WYRA 1EZBA 3WC6A 2MP0A 3IWWA 2HUZA 4KVME 2PJ4A 3RO0A 4M6IA 3SHPA 4C8TA 4DYOA 4AVCA 4KOXA 3KL9A 3U88C 4CGOA 1EO0A 4R8FA 3P2FA 4AVBA 4CS0B 2PDOA 1A9XB 3T0TA 2GLFA 2OH1A 3H4QA 1Y7EA 2JBKA 2ATRA 1VI4A 2D0PA 1QSMA 4KS9A 4JZ0A 5AG4A 1XIXA 4UWJA 3G3SA 1J4JA 1LANA 1IOFA 3CXSA 5K8PA 4CYQA 3B3CA 4C9EA 1IGBA 3KASA 2PR8A 3GLJA 1I12A 4MHYA 3TT2A 4AG7A 5F1YA 2DPTA 2GE3A 3PB7X 2EBJA 2ZEMA 3KHXA 3KHZA 3NH8A 5AG5A 3TTHA 3GUXA 3IJ3A 1S7KA 5FVJA 1WJTA 2IMOA 2VXKA 4LQGA 4PXDA 4B12A 2PJ9A 3TO7A 2XEIA 3PT1A 2B0AA 3PB6X 4B5PB 4XNHB 2IL4A 1KWMA 3TO6A 5LYLA 5LRKA 4X8IA 4C86A 1IB1E 1M4GA 2RC4A 3R9GA 3SR3A 4QC6A 5DWNA 5C82A 4TJXA 4AXVA 1LOKA 4FD5A 4FUUA 1JDBC 4A39A 4OC0A 3ZJ0A 2EVNA 5HH1A 4KOVA 3PZJA 3SI1A 3TYXA 3MGDA 2PJ7A 1EZAA 3V7ZA 2UV8G 2Z10A 3LD2A 3RZAA 3KRVA 4UCMA 2CNSA 2Z3PA 4H2KA 1YGHA 4XPKA 4PXBA 4KOUA 3JUWA 4M85A 3WR7A 2Z3KA 2ZEFA 4BD9A 1Z4RA 2ZW4A 5IX3A 4OIWA 4A38A 3T05A 1BXRB 4B14A 2WUUA 5AXIA 2AFMA 2FXFA 1CBXA 4C2ZA 5KTCA 5DWMA 7CPAA 3D2PA 3IWEA 4HNYB 2C5QA 1TF8A 1YLEA 1Z9UA 3CDXA 3LODA 3PBEA 4EYSA 1KBLA 3VRRA 1YW4A 4C8AA 1HDQA 1KZFA 1CG2A 1BOBA 4PK3A 4NFRA 4P44A 3I74A 4JYWA 3S6GA 2Q43A 4P4DA 1Q7LA 1TF9A 3WABA 4OC2A 1YR0A 5J1QA 4B11A 1ZL0A 2C27A 1Q2YA 1Z5RA 3FMCA 3IEHA 4MI1A 4KSAA 3H5ZA 1Z8XA 1M6VB 2FS5A 2JDCA 4KUAA 3VH9A 4IK2A 2AUNA 2J8RA 4R76A 5FD8A 2Q4YA 4NGQA 2AE6A 2PJ5A 3CPAA 1NSLA 1IYKA 1IICA 4KLWA 4NCZA 3FECA 2CF4A 1S7NA 2PIZA 2PE3A 3BLNA 3V38A 2POKA 4B6ZA 4LUAA 4Y49C 4I49A 4C2XA 1KUXA 2JEVA 4P4BA 3ISZA 5CPAA 2ODFA 3D66A 3PBBA 4CAXA 1FBVA 2OOTA 1F57A 2B5GA 4E2AA 4FD6A 4OC1A 2C6CA 2VZZA 4XPDC 1C30B 5H86A 2GANA 1RTQA 4UCPA 1RXTA 3C26A 2PJ1A 1QSNA 2P0WA 4Q7AA 1CE8B 4C8CA 1RO5A 4NSQA 5EC4A 4A95A 5D29A 5I0CA 3UY5A 2JLMA 3D67A 3TO9A 2G9DA 1ON0A 4ONUA 1ARMA 1ZG8A 4UA3A 1S60A 2YNDA 1TKFA 3HMJG 1Q2CA 2D4OA 3B3WA 5HXDA 4CO9A 1N71A 3SJFA 3VGOA 4P4EA 4NJQA 4PV6A 2DLAA 2V8VA 5THWA 3R96A 2HWGA 2PCNA 2NYQA 2QMLA 4KVXA 2ZW5A 4R9MA 3CZXA 1CPXA 3I6SA 2B4BA 2CXAA 4R3LA 3TOBA 2ZEEA 5A28A 4IIYA 3GKRA 2J8MA 3TLAA 1S7LA 2IQ6A 4E5SA 2GREA 4AB7A 1VGYA 2VEZA 2N3AB 5IB9A 1ELLP 4R57A 2PJCA 3KQXA 1ZG9A 3B3SA 5AG6A 3VRQA 4C9UA 3DDDA 5J3XA 3PFVA 2A4NA 2HV2A 5ELYA 2YNEA 3T9YA 3FEDA 3OB2B 4CAFA 4M6HA 5IR2A 4KVOE 1ZG7A 5G20A 4GM5A 3CPXA 4ZY2A 3S6HA 2O28A 5LYFA 4XPDB 3FBUA 5BY0A 1IOIA 3PB4X 1Z8WA 1OZPA 3IO1A 2REEA 4BPWB 3D7GA 4JWPA 3WT4A 1YREA 4MHNA 5JM6A 4PSWA 3RAMA 2ZPAA 2BSWA 3GYAA 3RBUA 1Z8TA 4OIDA 2VZYA 3TLEA 3B3TA 3NFZA 2PVVA 4P45A 8CPAA 4CZ1A 2RB7A 4INJA 3BUXB 2Q4VA 1U6MA 4QBJA 5AG7A 1IY7A 4RUHA 3I1UA 4E8OA 1NBWA 4COBA 4CRZB 4BMHA 3D4UA 4TWEA 2PJ8A 4WWVA 2F8HA 2C1CA 1KUYA 3B3VA 3S6KA 3TFYA 2EK9A 2G3TA 1ZLIA 2V8DA 4YWYA 4P6YA 2V8HA 2BL1A 2C6PA 3I9SA 4UEZA 3TX8A 1YMEA 3T8WA 5BWAB 1S5KA 1M1DA 4C7IA 3BJ8A 3L2NA 3QNVA 2DPSA 1Y0RA 3IU2A 2DF5A 2Y0MA 3H8FA 1P4NA 2DEAA 4MFKA 4GPLB 2ABZA 1CPSA 2PJAA 5F09A 2VBQA 3D68A 3BI0A 1YW6A 1GYTA 1Z4EA 4MFLA 4CGMA 3EIFA 4U5YA 4YN3A 1DIKA 3ZZIA 2QVPA 3DNSA 4ZGYB 5JQ4A 4KLVA 1KUVA 2PCUA 2VL1A 2D4PA 2FL4A 2FSRA 3F0AA 2R1IA 4YFJA 5K8NA 1TKJA 2CNMA 3JTKA 3T90A 1K4JA 3ISXA 4L89A 4MXUA 3EXNA 4CGLA 2E28A 1LAPA 3BUMB 1M44A 4NF1A 4CAWA 2B4JC 3U1BA 5F13A 3QB8A 2YNCC 1GGOA 2YJTA 3K4IA 2PC1A 4C9RA 3R9FA 3IFEA 2ZXVA 5LRJA 3EC4A 1BO4A 3R1KA 1V6CA 1IYLA 4H6UA 4K30A 6CPAA 4R87A 2HQYA 5A27A 2EUIA 3EY5A 3NE7A 2XPNA 4J3GA 1XF8A 2Z11A 4A31A 4FBEA 3TLGA 3IU1A 2ANPA 4F9UA 1P0HA 2H5MA 1NMTA 4KSIA 3VTAA 3P2HA 4MHDA 3RYOA 3MN8A 5F48A 4OAEA 1FT7A 4EFDA 4II9A 5DS0A 3FX6A 4KOYA 1Y9WA 3SXOA 2ARHA 2Q44A 3BUOB 4F6AA 4MCSA 3K9TA 4X3RA 2OZHA 4B13A 2CTCA 4K3NA 4QB9A 4CGPA 1XEBA 4WJBA 5K8MA 1T36B 2AFOA 1FY7A 4JLYA 5CNPA 3KKWA 1BPNA 2QJ8A 1CS0B 4P10A 2O53A 4A4CA 3FH4A 4EVYA 2OR4A 3A9LA 3D7FA 2EWBA 3FEEA 2OZUA 5C88A 4H89A 4C9AA 4E0AA 4H1HA 4MY3A 2P6GA 2V77A 3DGVA 2AFXA 4JXRA 1R61A 3H8EA 4UEEA 4LX9A 1Q2DA 1YQEA 2BCOA 3I3GA 1F2OA 2V8GA 3FJUA 3KI9A 3TCVA 1VBGA 3HPGG 3FNCA 3IGRA 3W6XA 2VQYA 2GU2A 3HUVA 2EZCA 2PR1A 4MFZA 4JJXA 3D7DA 2Z3OA 4IF5A 4M6GA 4R7MA 2HC9A 2WSAA 3NFQA 5LYIA 1S7FA 5G21A 1NSAA 2CY2A 1GHEA 3GY9A 4OP4A 4NGPA 4RI1A 2CBLA 1I21A 1BLLE 2VI7A 5GCNA 2FM4A 3NE8A 1VBHA 4UFWA 3OB1B 4IAVA 4NJRA 2B5GB 2NSMA 4ZY0A 1CX8A 1YSJA 3EZBA 3OAKA 2PIYA 3PP9A 4PSXA 3VATA 4CYOA 5E96A 1NXJA 2OB0A 4KZTA 1MK4A 4PQAA 4HNXB 4MFJA 2Z0ZA 4QVTA 1M4LA 2DXQA 4KUBA 4LQ6A 4NXYA 5F5XA 4UEFA 2JEWA 4ONWA 4CGNA 4IIXA 1JQGA 2OU2A 2PJ3A 3H8GA 3QAHA 4IUSA 4MI4A 1TXRA 1MJ9A 1NE9A 1XRYA 3PGPA 4C8UA 2FVGA 4EMEA 1BPMA 4M8DA 4CAVA 2EO8A 2B3UA 3KQZA 1CP7A 2F7VA 4QUSA 2B4DB 4X2TA 3D3SA 4YGOA 1H8LA 4MBUA 3SXNA 4MY0A 4PK2A 5G1ZA 4Y49B 4B5OA 4MCPA 2Z3MA 4CYNA 2QIRA 3C8OA 2ZEDA 2X0SA 3VWEA 4OKOA 1B47A 2WPXA 4C2YA 4PXEA 1ZRSA 2AFZA 4OMEA 1XOVA 1KEEB 3E0KA 2R8VA 1YK3A 4M3SA 2FT0A 2IJZA 4BPUB 1CP6A 2BOAA 4IHMA 3TLBA 1Q5XA 1PCAA 4AG9A 5F46A 5EBVA 1ZYMA 1R3NA 2BEIA 3NOJA 4FD4A 1XBUA 4RN7A 3O8ZA 4F8ZA 2ZOFA 1JDEA 4KORA 4ZX9A 1TKHA 2OLSA 1HEEA 1WVMA 4UCNA 2JDDA 3ZNIA 1DE4C 1VKCA 2B58A 4OC4A 4J0NA 2AFSA 3WC5A 2GLJA 2AUMA 3EFAA 5LYDA 5ISVA 2Z3NA 3PFEA 1VHEA 1PUAA 5AGEA 4UF4A 4F0YA 2G3AA 3S6FA 3PEIA 2PRQA 1CJWA 3B8GA 4NGRA 4C68A 1XMTA 4C84A 1YVOA 2Q4ZA 2Y1NA 4Q38A 3CXQA 4W9YA 4R6TA 1QQ9A 4JVOA 4ZBGA 4F0XA 2ZOGA 4TJVA 1XJOA 4L8AA 4COGA 2PRBA 3QAYA 5HVHA 1OBRA 1WWZA 3F5BA 4GXHA 4MCQA 4P4FA 2YGWA 1VHSA 3GB0A 1X10A 4X5KA 1KC7A 4CRYB 4MJXA 2Q7BA 1PYTB 5HVFA 4NGNA 3PLFB 3SJEA 4AVAA 3IWGA 1LRZA 3PB9X 1Y7RA 2B3VA 3TE4A 3GJZA 1Z8LA 3NH5A 2J9AA 5G22A
chains in the Genus database with same CATH topology
4G1PA 3SJGA 3B35A 2EK8A 2CIJA 3SI0A 2Q51A 2ZENA 3N5FA 4O23A 4C8FA 5K8OA 2PJ0A 2I3CA 2XEFA 3PB8X 3PRTA 4F9VA 4KNGE 2ZEHA 4ZY1A 2PVWA 3KGQA 4ZX8A 4PPZA 1XFOA 2WZNA 1LCPA 4DJLA 5I4MA 4C8PA 1LAMA 1Z2LA 3PFOA 4DUKA 3LWUA 4CDKA 4A94A 3KR5A 3NH4A 4MCRA 4NGMA 1Y0YA 4C9VA 1AYEA 4FAIA 3BHXA 4PXCA 4MHPA 2GP4A 1VIXA 4MRIA 3BXMA 2AFWA 5CBMA 2PJ2A 3S9NA 3S9LA 4YU9A 2CTBA 3JRUA 3SI2A 4CDJA 3MRUA 4CPAA 3SJXA 1DTDA 4UIBA 5HVGA 1R43A 5JH9A 3VARA 3K2KA 2XEGA 2BO9A 4NGTA 3FVLA 2QYVA 1XMBA 2RFHA 4C99A 3NA6A 1UWYA 3ICUA 3S9MA 2PJ6A 3DLJA 1XF1A 2ZEGA 3IIBA 3B7IA 1VHOA 4MMOA 3KZWA 2O4HA 2ZELA 4TNUA 2XEJA 3KR4A 4EWTA 4OC3A 3HLPA 3B2YA 4UIAA 1QMUA 3IC1A 4FWUA 1LFWA 1F2PA 4C85A 1Y9ZA 4MHZA 1HDUA 1AMPA 4ZYQA 1ARLA 5JGFA 2AFUA 1BAVA 4NGSA 3D7HA 2ZEPA 1FNOA 5D8NA 2C6GA 5LRGA 4OC5A 1YLOA 3LMSA 2HB6A 4ZI6A 4P4JA 1EE3P 4P4IA 3CT9A 4A37A 3FF3A 3TC8A 1ELMP 3WC7A 3BI1A 2JBJA 2PJBA 4Z65A 2ZEOA 1ZLHA 2WYRA 3WC6A 3IWWA 2PJ4A 4C8TA 4DYOA 3KL9A 4R8FA 2GLFA 1Y7EA 2JBKA 4JZ0A 1LANA 5K8PA 3B3CA 4C9EA 1IGBA 3KASA 3GLJA 4MHYA 3PB7X 3KHZA 2ZEMA 3NH8A 3KHXA 3GUXA 3IJ3A 2IMOA 4PXDA 4LQGA 2PJ9A 2XEIA 3PB6X 1KWMA 5LYLA 5LRKA 4X8IA 4TJXA 4AXVA 1LOKA 4FUUA 4A39A 4OC0A 3SI1A 2PJ7A 3V7ZA 3RZAA 4H2KA 4PXBA 4BD9A 2ZEFA 4OIWA 4A38A 2AFMA 1CBXA 7CPAA 2C5QA 1TF8A 3CDXA 3PBEA 1YW4A 4C8AA 1HDQA 1CG2A 4NFRA 4P44A 3I74A 4JYWA 2Q43A 4P4DA 1Q7LA 1TF9A 3WABA 4OC2A 5J1QA 1Z5RA 3FMCA 3IEHA 3VH9A 4IK2A 4R76A 4NGQA 2PJ5A 3CPAA 3FECA 2CF4A 2PIZA 2PE3A 3V38A 4B6ZA 2POKA 4P4BA 3ISZA 5CPAA 3D66A 3PBBA 1F57A 2OOTA 4OC1A 2C6CA 1RTQA 2PJ1A 4Q7AA 4C8CA 5D29A 3D67A 2G9DA 1ARMA 1ZG8A 1TKFA 5HXDA 3B3WA 3SJFA 4P4EA 4NJQA 5THWA 2V8VA 2NYQA 1CPXA 3I6SA 2ZEEA 2IQ6A 2GREA 1VGYA 5IB9A 1ELLP 2PJCA 3KQXA 1ZG9A 3B3SA 4C9UA 5ELYA 3FEDA 5IR2A 1ZG7A 4GM5A 3CPXA 4ZY2A 5LYFA 3PB4X 3IO1A 3D7GA 3WT4A 4MHNA 5JM6A 3RAMA 3RBUA 4OIDA 3B3TA 3NFZA 2PVVA 4P45A 8CPAA 2RB7A 1IY7A 4RUHA 3I1UA 3D4UA 4TWEA 2PJ8A 4WWVA 2F8HA 2C1CA 3B3VA 2EK9A 1ZLIA 2V8DA 4YWYA 4P6YA 2V8HA 2C6PA 4UEZA 3TX8A 1YMEA 3T8WA 3L2NA 3QNVA 1Y0RA 3H8FA 2DEAA 2ABZA 1CPSA 2PJAA 5F09A 3D68A 3BI0A 1YW6A 1GYTA 3EIFA 4YN3A 2QVPA 2PCUA 2VL1A 5K8NA 1TKJA 3ISXA 4MXUA 1LAPA 4C9RA 3IFEA 5LRJA 1V6CA 6CPAA 4FBEA 4F9UA 2ANPA 3VTAA 4KSIA 3MN8A 4EFDA 1FT7A 5DS0A 3FX6A 4MCSA 3K9TA 4X3RA 5K8MA 2CTCA 4K3NA 4WJBA 2AFOA 1BPNA 2QJ8A 4P10A 2O53A 3FH4A 2OR4A 3D7FA 2EWBA 3FEEA 4C9AA 2V77A 3DGVA 2AFXA 3H8EA 4UEEA 2BCOA 3KI9A 1F2OA 2V8GA 3FJUA 2GU2A 3HUVA 3D7DA 4R7MA 2HC9A 5LYIA 1NSAA 4OP4A 4NGPA 1BLLE 4IAVA 4ZY0A 4NJRA 2NSMA 1CX8A 1YSJA 2PIYA 3VATA 4PQAA 1M4LA 4UEFA 2JEWA 4ONWA 1JQGA 2PJ3A 3H8GA 1TXRA 1XRYA 4C8UA 2FVGA 4EMEA 1BPMA 3KQZA 1CP7A 2F7VA 4X2TA 4C86A 1H8LA 4MCPA 2ZEDA 4OKOA 4PXEA 2AFZA 4OMEA 2IJZA 1CP6A 2BOAA 4IHMA 1PCAA 1R3NA 1XBUA 4F8ZA 2ZOFA 4ZX9A 1TKHA 1HEEA 1WVMA 1DE4C 4OC4A 2AFSA 3WC5A 2GLJA 5LYDA 3PFEA 1VHEA 4UF4A 3PEIA 2PRQA 4NGRA 4C84A 2Q4ZA 4W9YA 4R6TA 1QQ9A 4TJVA 2ZOGA 1XJOA 5HVHA 1OBRA 4MCQA 4P4FA 3GB0A 1PYTB 5HVFA 4NGNA 3SJEA 3PB9X 1Z8LA 3NH5A 2J9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G1P A;  3SJG A;  3B35 A;  2EK8 A;  2CIJ A;  3SI0 A;  2Q51 A;  2ZEN A;  3N5F A;  4O23 A;  4C8F A;  5K8O A;  2PJ0 A;  2I3C A;  2XEF A;  3PB8 X;  3PRT A;  4F9V A;  4KNG E;  2ZEH A;  4ZY1 A;  2PVW A;  3KGQ A;  4ZX8 A;  4PPZ A;  1XFO A;  2WZN A;  1LCP A;  4DJL A;  5I4M A;  4C8P A;  1LAM A;  1Z2L A;  3PFO A;  4DUK A;  3LWU A;  4CDK A;  4A94 A;  3KR5 A;  3NH4 A;  4MCR A;  4NGM A;  1Y0Y A;  4C9V A;  1AYE A;  4FAI A;  3BHX A;  4PXC A;  4MHP A;  1VIX A;  4MRI A;  3BXM A;  2AFW A;  5CBM A;  2PJ2 A;  3S9N A;  3S9L A;  4YU9 A;  2CTB A;  3JRU A;  3SI2 A;  4CDJ A;  3MRU A;  4CPA A;  3SJX A;  1DTD A;  4UIB A;  5HVG A;  1R43 A;  5JH9 A;  3VAR A;  3K2K A;  2XEG A;  2BO9 A;  4NGT A;  3FVL A;  2QYV A;  1XMB A;  2RFH A;  4C99 A;  3NA6 A;  1UWY A;  3ICU A;  3S9M A;  2PJ6 A;  3DLJ A;  1XF1 A;  2ZEG A;  3IIB A;  3B7I A;  1VHO A;  4MMO A;  3KZW A;  2O4H A;  2ZEL A;  4TNU A;  2XEJ A;  3KR4 A;  4EWT A;  4OC3 A;  3HLP A;  3B2Y A;  4UIA A;  1QMU A;  3IC1 A;  4FWU A;  1LFW A;  1F2P A;  4C85 A;  1Y9Z A;  4MHZ A;  1HDU A;  1AMP A;  4ZYQ A;  1ARL A;  5JGF A;  2AFU A;  1BAV A;  4NGS A;  3D7H A;  2ZEP A;  1FNO A;  5D8N A;  2C6G A;  5LRG A;  4OC5 A;  1YLO A;  3LMS A;  2HB6 A;  4ZI6 A;  4P4J A;  1EE3 P;  4P4I A;  3CT9 A;  4A37 A;  3FF3 A;  3TC8 A;  1ELM P;  3WC7 A;  3BI1 A;  2JBJ A;  2PJB A;  4Z65 A;  2ZEO A;  1ZLH A;  2WYR A;  3WC6 A;  3IWW A;  2PJ4 A;  4C8T A;  4DYO A;  3KL9 A;  4R8F A;  2GLF A;  1Y7E A;  2JBK A;  4JZ0 A;  1LAN A;  5K8P A;  3B3C A;  4C9E A;  1IGB A;  3KAS A;  3GLJ A;  4MHY A;  3PB7 X;  3KHZ A;  2ZEM A;  3NH8 A;  3KHX A;  3GUX A;  3IJ3 A;  2IMO A;  4PXD A;  4LQG A;  2PJ9 A;  2XEI A;  3PB6 X;  1KWM A;  5LYL A;  5LRK A;  4X8I A;  4TJX A;  4AXV A;  1LOK A;  4FUU A;  4A39 A;  4OC0 A;  3SI1 A;  2PJ7 A;  3V7Z A;  3RZA A;  4H2K A;  4PXB A;  4BD9 A;  2ZEF A;  4OIW A;  4A38 A;  2AFM A;  1CBX A;  7CPA A;  1TF8 A;  3CDX A;  3PBE A;  1YW4 A;  4C8A A;  1HDQ A;  1CG2 A;  4NFR A;  4P44 A;  3I74 A;  4JYW A;  2Q43 A;  4P4D A;  1Q7L A;  1TF9 A;  3WAB A;  4OC2 A;  5J1Q A;  1Z5R A;  3FMC A;  3IEH A;  3VH9 A;  4IK2 A;  4R76 A;  4NGQ A;  2PJ5 A;  3CPA A;  3FEC A;  2CF4 A;  2PIZ A;  2PE3 A;  3V38 A;  4B6Z A;  2POK A;  4P4B A;  3ISZ A;  5CPA A;  3D66 A;  3PBB A;  1F57 A;  2OOT A;  4OC1 A;  2C6C A;  1RTQ A;  2PJ1 A;  4Q7A A;  4C8C A;  5D29 A;  3D67 A;  2G9D A;  1ARM A;  1ZG8 A;  1TKF A;  5HXD A;  3B3W A;  3SJF A;  4P4E A;  4NJQ A;  5THW A;  2V8V A;  2NYQ A;  1CPX A;  3I6S A;  2ZEE A;  2IQ6 A;  2GRE A;  1VGY A;  5IB9 A;  1ELL P;  2PJC A;  3KQX A;  1ZG9 A;  3B3S A;  4C9U A;  5ELY A;  3FED A;  1ZG7 A;  4GM5 A;  3CPX A;  4ZY2 A;  5LYF A;  3PB4 X;  3IO1 A;  3D7G A;  3WT4 A;  4MHN A;  5JM6 A;  3RAM A;  3RBU A;  4OID A;  3B3T A;  3NFZ A;  2PVV A;  4P45 A;  8CPA A;  2RB7 A;  1IY7 A;  4RUH A;  3I1U A;  3D4U A;  4TWE A;  2PJ8 A;  4WWV A;  2F8H A;  2C1C A;  3B3V A;  2EK9 A;  1ZLI A;  2V8D A;  4YWY A;  4P6Y A;  2V8H A;  2C6P A;  4UEZ A;  3TX8 A;  1YME A;  3T8W A;  3L2N A;  3QNV A;  1Y0R A;  3H8F A;  2DEA A;  2ABZ A;  1CPS A;  2PJA A;  5F09 A;  3D68 A;  3BI0 A;  1YW6 A;  1GYT A;  3EIF A;  4YN3 A;  2QVP A;  2PCU A;  2VL1 A;  5K8N A;  1TKJ A;  3ISX A;  4MXU A;  1LAP A;  4C9R A;  3IFE A;  5LRJ A;  1V6C A;  6CPA A;  4FBE A;  4F9U A;  2ANP A;  3VTA A;  4KSI A;  3MN8 A;  4EFD A;  1FT7 A;  5DS0 A;  3FX6 A;  4MCS A;  3K9T A;  4X3R A;  5K8M A;  2CTC A;  4K3N A;  4WJB A;  2AFO A;  1BPN A;  2QJ8 A;  4P10 A;  2O53 A;  3FH4 A;  2OR4 A;  3D7F A;  2EWB A;  3FEE A;  4C9A A;  2V77 A;  3DGV A;  2AFX A;  3H8E A;  4UEE A;  2BCO A;  3KI9 A;  1F2O A;  2V8G A;  3FJU A;  2GU2 A;  3HUV A;  3D7D A;  4R7M A;  2HC9 A;  5LYI A;  1NSA A;  4OP4 A;  4NGP A;  1BLL E;  4IAV A;  4ZY0 A;  4NJR A;  2NSM A;  1CX8 A;  1YSJ A;  2PIY A;  3VAT A;  4PQA A;  1M4L A;  4UEF A;  2JEW A;  4ONW A;  1JQG A;  2PJ3 A;  3H8G A;  1TXR A;  1XRY A;  4C8U A;  2FVG A;  4EME A;  1BPM A;  3KQZ A;  1CP7 A;  2F7V A;  4X2T A;  4C86 A;  1H8L A;  4MCP A;  2ZED A;  4OKO A;  4PXE A;  2AFZ A;  4OME A;  2IJZ A;  1CP6 A;  2BOA A;  4IHM A;  1PCA A;  1R3N A;  1XBU A;  4F8Z A;  2ZOF A;  4ZX9 A;  1TKH A;  1HEE A;  1WVM A;  1DE4 C;  4OC4 A;  2AFS A;  3WC5 A;  2GLJ A;  5LYD A;  3PFE A;  1VHE A;  4UF4 A;  3PEI A;  2PRQ A;  4NGR A;  4C84 A;  2Q4Z A;  4W9Y A;  4R6T A;  1QQ9 A;  4TJV A;  2ZOG A;  1XJO A;  5HVH A;  1OBR A;  4MCQ A;  4P4F A;  3GB0 A;  1PYT B;  5HVF A;  4NGN A;  3SJE A;  3PB9 X;  1Z8L A;  3NH5 A;  2J9A A; 
#chains in the Genus database with same CATH topology
 2FIW A;  5HMN A;  4G1P A;  3SJG A;  3B35 A;  2Q04 A;  2EK8 A;  4B5P A;  4H6Z A;  1SQH A;  2CIJ A;  4C7H A;  3SI0 A;  2Q51 A;  2ZEN A;  3N5F A;  4O23 A;  3EZE A;  5K8O A;  4C8F A;  5J8C A;  3OWC A;  3D8P A;  4BPX B;  4JXQ A;  2PJ0 A;  1Z9E A;  2XEF A;  1B87 A;  2I3C A;  3PB8 X;  3PRT A;  4F9V A;  2DIK A;  2I00 A;  1IU8 A;  2ZEH A;  4CYP A;  4ZY1 A;  2PVW A;  4KNG E;  2HI6 A;  3KGQ A;  2Y1M A;  1JWQ A;  3FYN A;  4ZX8 A;  4PPZ A;  1XFO A;  2WZN A;  3R9E A;  1LCP A;  2R82 A;  4DJL A;  2EZA A;  2KCW A;  2QEC A;  5I4M A;  2D0O A;  2NMT A;  4C8P A;  4HPS A;  2VKZ G;  1LAM A;  1Z2L A;  4MFQ A;  3PFO A;  4DUK A;  4HNW B;  1XE4 A;  2R7H A;  3LWU A;  1YVH A;  5K99 A;  4CDK A;  4A94 A;  3VRP A;  1MJA A;  3KR5 A;  5JVL A;  1YVK A;  3NH4 A;  4MCR A;  1I1D A;  4NGM A;  3T07 A;  3VRN A;  2R98 A;  4KOT A;  1Y0Y A;  2Q7S A;  4C9V A;  1AYE A;  4YRH A;  3BJ7 A;  4FAI A;  3BHX A;  3JVN A;  4PXC A;  4FD7 A;  3EZA A;  2ZW7 A;  3TLG B;  4MHP A;  2GP4 A;  4Q36 A;  1VIX A;  3HPH E;  4MRI A;  3TLC A;  1L0C A;  3BXM A;  2FCK A;  2PQ8 A;  2AFW A;  4GS4 A;  5CBM A;  2PJ2 A;  3S9N A;  4JD6 A;  3TLY A;  3S9L A;  2ZW6 A;  4OLL A;  5F9M A;  3K9U A;  3N7Z A;  4A4B A;  1QSR A;  4YU9 A;  2CTB A;  3JRU A;  4KSF A;  5F47 A;  3SI2 A;  4CDJ A;  3MRU A;  4CPA A;  3SJX A;  1DTD A;  3W6S A;  1S3Z A;  5J8F A;  2X7B A;  3FIX A;  3F8K A;  3BUN B;  1R43 A;  2P6F A;  4KOS A;  2FE7 A;  4KOW A;  4UBR A;  4UIB A;  5HVG A;  3VAR A;  5JH9 A;  3EO4 A;  4BBH A;  2EZB A;  4A2Z A;  5HKY A;  3R95 A;  1WK4 A;  5JPH A;  4NEX A;  3DR8 A;  4BTF A;  3K2K A;  1Y9K A;  3G23 A;  2XEG A;  4UWI A;  5HKW A;  2BO9 A;  3VRO A;  2YNC A;  3FRM A;  4CAE A;  5KTD A;  4NGT A;  3FVL A;  2QYV A;  3F9K C;  1XMB A;  1ZO0 A;  2RFH A;  4C99 A;  3NA6 A;  1UWY A;  1X12 A;  3RNZ A;  3GIU A;  1YX0 A;  4RS2 A;  3ICU A;  3S9M A;  3DR6 A;  2PJ6 A;  1R57 A;  2XPO A;  1M4D A;  3DLJ A;  4UFX A;  3V8I A;  5EMI A;  2ZEG A;  1XF1 A;  3IIB A;  3B7I A;  4XPL A;  2Q0Y A;  1VHO A;  3W91 A;  4MMO A;  4U9Y A;  3KZW A;  2O4H A;  2XPL A;  1CM0 A;  2ZEL A;  3FB3 A;  1TIQ A;  4TNU A;  1QST A;  3T5M A;  4E94 A;  2XEJ A;  3KR4 A;  4RR2 B;  4ORF A;  1V0C A;  4EWT A;  2F5I A;  5IB0 A;  2YJV A;  1A2Z A;  4R3K A;  5HKZ A;  4OC3 A;  2WPW A;  3HLP A;  4A32 A;  2G0B A;  3B2Y A;  4UIA A;  3TOA A;  2REF A;  5H84 A;  1QMU A;  3CXP A;  4A33 A;  3IC1 A;  2XPP A;  4FWU A;  4MJ8 A;  1LFW A;  2I79 A;  4HKF A;  1F2P A;  4C85 A;  2K5T A;  5IV0 A;  2B4D A;  1Y9Z A;  4MHZ A;  1QSO A;  1HDU A;  1AMP A;  4ZYQ A;  1ARL A;  3VWD A;  4DNC A;  5JGF A;  2AFU A;  2Z3L A;  2FIA A;  2J8N A;  4UFV A;  3FXT A;  4A30 A;  1BAV A;  4NGS A;  2CNT A;  1J3L A;  3D7H A;  2ZEP A;  1FNO A;  5D8N A;  2C6G A;  5LRG A;  4OC5 A;  1YLO A;  2P6E A;  2BUE A;  3LMS A;  2HB6 A;  4OAD A;  4P4J A;  4ZI6 A;  1MJB A;  1IID A;  1EE3 P;  4P4I A;  4B10 A;  3OP0 A;  3CT9 A;  1B6B A;  4MFP A;  4A37 A;  5KTA A;  3TLZ A;  2GFQ A;  4BIN A;  1AUG A;  5JYB A;  3FF3 A;  3LAC A;  1ELM P;  3DSB A;  3TC8 A;  3WC7 A;  2OZG A;  3BI1 A;  1M4I A;  1UFH A;  4XNH C;  1C3O B;  2JBJ A;  2PJB A;  4Z65 A;  2HRO A;  3D2M A;  2ZEO A;  5F49 A;  2AJ6 A;  1PU9 A;  1ZLH A;  4U9Z A;  2GIV A;  3BUW B;  3G8W A;  2PSW A;  2WYR A;  1EZB A;  3WC6 A;  2MP0 A;  3IWW A;  2HUZ A;  4KVM E;  2PJ4 A;  3RO0 A;  4M6I A;  3SHP A;  4C8T A;  4DYO A;  4AVC A;  4KOX A;  3KL9 A;  3U88 C;  4CGO A;  1EO0 A;  4R8F A;  3P2F A;  4AVB A;  4CS0 B;  2PDO A;  1A9X B;  3T0T A;  2GLF A;  2OH1 A;  3H4Q A;  1Y7E A;  2JBK A;  2ATR A;  1VI4 A;  2D0P A;  1QSM A;  4KS9 A;  4JZ0 A;  5AG4 A;  1XIX A;  4UWJ A;  3G3S A;  1J4J A;  1LAN A;  1IOF A;  3CXS A;  5K8P A;  4CYQ A;  3B3C A;  4C9E A;  1IGB A;  3KAS A;  2PR8 A;  3GLJ A;  1I12 A;  4MHY A;  3TT2 A;  4AG7 A;  5F1Y A;  2DPT A;  2GE3 A;  3PB7 X;  2EBJ A;  2ZEM A;  3KHX A;  3KHZ A;  3NH8 A;  5AG5 A;  3TTH A;  3GUX A;  3IJ3 A;  1S7K A;  5FVJ A;  1WJT A;  2IMO A;  2VXK A;  4LQG A;  4PXD A;  4B12 A;  2PJ9 A;  3TO7 A;  2XEI A;  3PT1 A;  2B0A A;  3PB6 X;  4B5P B;  4XNH B;  2IL4 A;  1KWM A;  3TO6 A;  5LYL A;  5LRK A;  4X8I A;  4C86 A;  1IB1 E;  1M4G A;  2RC4 A;  3R9G A;  3SR3 A;  4QC6 A;  5DWN A;  5C82 A;  4TJX A;  4AXV A;  1LOK A;  4FD5 A;  4FUU A;  1JDB C;  4A39 A;  4OC0 A;  3ZJ0 A;  2EVN A;  5HH1 A;  4KOV A;  3PZJ A;  3SI1 A;  3TYX A;  3MGD A;  2PJ7 A;  1EZA A;  3V7Z A;  2UV8 G;  2Z10 A;  3LD2 A;  3RZA A;  3KRV A;  4UCM A;  2CNS A;  2Z3P A;  4H2K A;  1YGH A;  4XPK A;  4PXB A;  4KOU A;  3JUW A;  4M85 A;  3WR7 A;  2Z3K A;  2ZEF A;  4BD9 A;  1Z4R A;  2ZW4 A;  5IX3 A;  4OIW A;  4A38 A;  3T05 A;  1BXR B;  4B14 A;  2WUU A;  5AXI A;  2AFM A;  2FXF A;  1CBX A;  4C2Z A;  5KTC A;  5DWM A;  7CPA A;  3D2P A;  3IWE A;  4HNY B;  2C5Q A;  1TF8 A;  1YLE A;  1Z9U A;  3CDX A;  3LOD A;  3PBE A;  4EYS A;  1KBL A;  3VRR A;  1YW4 A;  4C8A A;  1HDQ A;  1KZF A;  1CG2 A;  1BOB A;  4PK3 A;  4NFR A;  4P44 A;  3I74 A;  4JYW A;  3S6G A;  2Q43 A;  4P4D A;  1Q7L A;  1TF9 A;  3WAB A;  4OC2 A;  1YR0 A;  5J1Q A;  4B11 A;  1ZL0 A;  2C27 A;  1Q2Y A;  1Z5R A;  3FMC A;  3IEH A;  4MI1 A;  4KSA A;  3H5Z A;  1Z8X A;  1M6V B;  2FS5 A;  2JDC A;  4KUA A;  3VH9 A;  4IK2 A;  2AUN A;  2J8R A;  4R76 A;  5FD8 A;  2Q4Y A;  4NGQ A;  2AE6 A;  2PJ5 A;  3CPA A;  1NSL A;  1IYK A;  1IIC A;  4KLW A;  4NCZ A;  3FEC A;  2CF4 A;  1S7N A;  2PIZ A;  2PE3 A;  3BLN A;  3V38 A;  2POK A;  4B6Z A;  4LUA A;  4Y49 C;  4I49 A;  4C2X A;  1KUX A;  2JEV A;  4P4B A;  3ISZ A;  5CPA A;  2ODF A;  3D66 A;  3PBB A;  4CAX A;  1FBV A;  2OOT A;  1F57 A;  2B5G A;  4E2A A;  4FD6 A;  4OC1 A;  2C6C A;  2VZZ A;  4XPD C;  1C30 B;  5H86 A;  2GAN A;  1RTQ A;  4UCP A;  1RXT A;  3C26 A;  2PJ1 A;  1QSN A;  2P0W A;  4Q7A A;  1CE8 B;  4C8C A;  1RO5 A;  4NSQ A;  5EC4 A;  4A95 A;  5D29 A;  5I0C A;  3UY5 A;  2JLM A;  3D67 A;  3TO9 A;  2G9D A;  1ON0 A;  4ONU A;  1ARM A;  1ZG8 A;  4UA3 A;  1S60 A;  2YND A;  1TKF A;  3HMJ G;  1Q2C A;  2D4O A;  3B3W A;  5HXD A;  4CO9 A;  1N71 A;  3SJF A;  3VGO A;  4P4E A;  4NJQ A;  4PV6 A;  2DLA A;  2V8V A;  5THW A;  3R96 A;  2HWG A;  2PCN A;  2NYQ A;  2QML A;  4KVX A;  2ZW5 A;  4R9M A;  3CZX A;  1CPX A;  3I6S A;  2B4B A;  2CXA A;  4R3L A;  3TOB A;  2ZEE A;  5A28 A;  4IIY A;  3GKR A;  2J8M A;  3TLA A;  1S7L A;  2IQ6 A;  4E5S A;  2GRE A;  4AB7 A;  1VGY A;  2VEZ A;  2N3A B;  5IB9 A;  1ELL P;  4R57 A;  2PJC A;  3KQX A;  1ZG9 A;  3B3S A;  5AG6 A;  3VRQ A;  4C9U A;  3DDD A;  5J3X A;  3PFV A;  2A4N A;  2HV2 A;  5ELY A;  2YNE A;  3T9Y A;  3FED A;  3OB2 B;  4CAF A;  4M6H A;  5IR2 A;  4KVO E;  1ZG7 A;  5G20 A;  4GM5 A;  3CPX A;  4ZY2 A;  3S6H A;  2O28 A;  5LYF A;  4XPD B;  3FBU A;  5BY0 A;  1IOI A;  3PB4 X;  1Z8W A;  1OZP A;  3IO1 A;  2REE A;  4BPW B;  3D7G A;  4JWP A;  3WT4 A;  1YRE A;  4MHN A;  5JM6 A;  4PSW A;  3RAM A;  2ZPA A;  2BSW A;  3GYA A;  3RBU A;  1Z8T A;  4OID A;  2VZY A;  3TLE A;  3B3T A;  3NFZ A;  2PVV A;  4P45 A;  8CPA A;  4CZ1 A;  2RB7 A;  4INJ A;  3BUX B;  2Q4V A;  1U6M A;  4QBJ A;  5AG7 A;  1IY7 A;  4RUH A;  3I1U A;  4E8O A;  1NBW A;  4COB A;  4CRZ B;  4BMH A;  3D4U A;  4TWE A;  2PJ8 A;  4WWV A;  2F8H A;  2C1C A;  1KUY A;  3B3V A;  3S6K A;  3TFY A;  2EK9 A;  2G3T A;  1ZLI A;  2V8D A;  4YWY A;  4P6Y A;  2V8H A;  2BL1 A;  2C6P A;  3I9S A;  4UEZ A;  3TX8 A;  1YME A;  3T8W A;  5BWA B;  1S5K A;  1M1D A;  4C7I A;  3BJ8 A;  3L2N A;  3QNV A;  2DPS A;  1Y0R A;  3IU2 A;  2DF5 A;  2Y0M A;  3H8F A;  1P4N A;  2DEA A;  4MFK A;  4GPL B;  2ABZ A;  1CPS A;  2PJA A;  5F09 A;  2VBQ A;  3D68 A;  3BI0 A;  1YW6 A;  1GYT A;  1Z4E A;  4MFL A;  4CGM A;  3EIF A;  4U5Y A;  4YN3 A;  1DIK A;  3ZZI A;  2QVP A;  3DNS A;  4ZGY B;  5JQ4 A;  4KLV A;  1KUV A;  2PCU A;  2VL1 A;  2D4P A;  2FL4 A;  2FSR A;  3F0A A;  2R1I A;  4YFJ A;  5K8N A;  1TKJ A;  2CNM A;  3JTK A;  3T90 A;  1K4J A;  3ISX A;  4L89 A;  4MXU A;  3EXN A;  4CGL A;  2E28 A;  1LAP A;  3BUM B;  1M44 A;  4NF1 A;  4CAW A;  2B4J C;  3U1B A;  5F13 A;  3QB8 A;  2YNC C;  1GGO A;  2YJT A;  3K4I A;  2PC1 A;  4C9R A;  3R9F A;  3IFE A;  2ZXV A;  5LRJ A;  3EC4 A;  1BO4 A;  3R1K A;  1V6C A;  1IYL A;  4H6U A;  4K30 A;  6CPA A;  4R87 A;  2HQY A;  5A27 A;  2EUI A;  3EY5 A;  3NE7 A;  2XPN A;  4J3G A;  1XF8 A;  2Z11 A;  4A31 A;  4FBE A;  3TLG A;  3IU1 A;  2ANP A;  4F9U A;  1P0H A;  2H5M A;  1NMT A;  4KSI A;  3VTA A;  3P2H A;  4MHD A;  3RYO A;  3MN8 A;  5F48 A;  4OAE A;  1FT7 A;  4EFD A;  4II9 A;  5DS0 A;  3FX6 A;  4KOY A;  1Y9W A;  3SXO A;  2ARH A;  2Q44 A;  3BUO B;  4F6A A;  4MCS A;  3K9T A;  4X3R A;  2OZH A;  4B13 A;  2CTC A;  4K3N A;  4QB9 A;  4CGP A;  1XEB A;  4WJB A;  5K8M A;  1T36 B;  2AFO A;  1FY7 A;  4JLY A;  5CNP A;  3KKW A;  1BPN A;  2QJ8 A;  1CS0 B;  4P10 A;  2O53 A;  4A4C A;  3FH4 A;  4EVY A;  2OR4 A;  3A9L A;  3D7F A;  2EWB A;  3FEE A;  2OZU A;  5C88 A;  4H89 A;  4C9A A;  4E0A A;  4H1H A;  4MY3 A;  2P6G A;  2V77 A;  3DGV A;  2AFX A;  4JXR A;  1R61 A;  3H8E A;  4UEE A;  4LX9 A;  1Q2D A;  1YQE A;  2BCO A;  3I3G A;  1F2O A;  2V8G A;  3FJU A;  3KI9 A;  3TCV A;  1VBG A;  3HPG G;  3FNC A;  3IGR A;  3W6X A;  2VQY A;  2GU2 A;  3HUV A;  2EZC A;  2PR1 A;  4MFZ A;  4JJX A;  3D7D A;  2Z3O A;  4IF5 A;  4M6G A;  4R7M A;  2HC9 A;  2WSA A;  3NFQ A;  5LYI A;  1S7F A;  5G21 A;  1NSA A;  2CY2 A;  1GHE A;  3GY9 A;  4OP4 A;  4NGP A;  4RI1 A;  2CBL A;  1I21 A;  1BLL E;  2VI7 A;  5GCN A;  2FM4 A;  3NE8 A;  1VBH A;  4UFW A;  3OB1 B;  4IAV A;  4NJR A;  2B5G B;  2NSM A;  4ZY0 A;  1CX8 A;  1YSJ A;  3EZB A;  3OAK A;  2PIY A;  3PP9 A;  4PSX A;  3VAT A;  4CYO A;  5E96 A;  1NXJ A;  2OB0 A;  4KZT A;  1MK4 A;  4PQA A;  4HNX B;  4MFJ A;  2Z0Z A;  4QVT A;  1M4L A;  2DXQ A;  4KUB A;  4LQ6 A;  4NXY A;  5F5X A;  4UEF A;  2JEW A;  4ONW A;  4CGN A;  4IIX A;  1JQG A;  2OU2 A;  2PJ3 A;  3H8G A;  3QAH A;  4IUS A;  4MI4 A;  1TXR A;  1MJ9 A;  1NE9 A;  1XRY A;  3PGP A;  4C8U A;  2FVG A;  4EME A;  1BPM A;  4M8D A;  4CAV A;  2EO8 A;  2B3U A;  3KQZ A;  1CP7 A;  2F7V A;  4QUS A;  2B4D B;  4X2T A;  3D3S A;  4YGO A;  1H8L A;  4MBU A;  3SXN A;  4MY0 A;  4PK2 A;  5G1Z A;  4Y49 B;  4B5O A;  4MCP A;  2Z3M A;  4CYN A;  2QIR A;  3C8O A;  2ZED A;  2X0S A;  3VWE A;  4OKO A;  1B47 A;  2WPX A;  4C2Y A;  4PXE A;  1ZRS A;  2AFZ A;  4OME A;  1XOV A;  1KEE B;  3E0K A;  2R8V A;  1YK3 A;  4M3S A;  2FT0 A;  2IJZ A;  4BPU B;  1CP6 A;  2BOA A;  4IHM A;  3TLB A;  1Q5X A;  1PCA A;  4AG9 A;  5F46 A;  5EBV A;  1ZYM A;  1R3N A;  2BEI A;  3NOJ A;  4FD4 A;  1XBU A;  4RN7 A;  3O8Z A;  4F8Z A;  2ZOF A;  1JDE A;  4KOR A;  4ZX9 A;  1TKH A;  2OLS A;  1HEE A;  1WVM A;  4UCN A;  2JDD A;  3ZNI A;  1DE4 C;  1VKC A;  2B58 A;  4OC4 A;  4J0N A;  2AFS A;  3WC5 A;  2GLJ A;  2AUM A;  3EFA A;  5LYD A;  5ISV A;  2Z3N A;  3PFE A;  1VHE A;  1PUA A;  5AGE A;  4UF4 A;  4F0Y A;  2G3A A;  3S6F A;  3PEI A;  2PRQ A;  1CJW A;  3B8G A;  4NGR A;  4C68 A;  1XMT A;  4C84 A;  1YVO A;  2Q4Z A;  2Y1N A;  4Q38 A;  3CXQ A;  4W9Y A;  4R6T A;  1QQ9 A;  4JVO A;  4ZBG A;  4F0X A;  2ZOG A;  4TJV A;  1XJO A;  4L8A A;  4COG A;  2PRB A;  3QAY A;  5HVH A;  1OBR A;  1WWZ A;  3F5B A;  4GXH A;  4MCQ A;  4P4F A;  2YGW A;  1VHS A;  3GB0 A;  1X10 A;  4X5K A;  1KC7 A;  4CRY B;  4MJX A;  2Q7B A;  1PYT B;  5HVF A;  4NGN A;  3PLF B;  3SJE A;  4AVA A;  3IWG A;  1LRZ A;  3PB9 X;  1Y7R A;  2B3V A;  3TE4 A;  3GJZ A;  1Z8L A;  3NH5 A;  2J9A A;  5G22 A; 
#chains in the Genus database with same CATH homology
 4G1P A;  3SJG A;  3B35 A;  2EK8 A;  2CIJ A;  3SI0 A;  2Q51 A;  2ZEN A;  3N5F A;  4O23 A;  4C8F A;  5K8O A;  2PJ0 A;  2I3C A;  2XEF A;  3PB8 X;  3PRT A;  4F9V A;  4KNG E;  2ZEH A;  4ZY1 A;  2PVW A;  3KGQ A;  4ZX8 A;  4PPZ A;  1XFO A;  2WZN A;  1LCP A;  4DJL A;  5I4M A;  4C8P A;  1LAM A;  1Z2L A;  3PFO A;  4DUK A;  3LWU A;  4CDK A;  4A94 A;  3KR5 A;  3NH4 A;  4MCR A;  4NGM A;  1Y0Y A;  4C9V A;  1AYE A;  4FAI A;  3BHX A;  4PXC A;  4MHP A;  2GP4 A;  1VIX A;  4MRI A;  3BXM A;  2AFW A;  5CBM A;  2PJ2 A;  3S9N A;  3S9L A;  4YU9 A;  2CTB A;  3JRU A;  3SI2 A;  4CDJ A;  3MRU A;  4CPA A;  3SJX A;  1DTD A;  4UIB A;  5HVG A;  1R43 A;  5JH9 A;  3VAR A;  3K2K A;  2XEG A;  2BO9 A;  4NGT A;  3FVL A;  2QYV A;  1XMB A;  2RFH A;  4C99 A;  3NA6 A;  1UWY A;  3ICU A;  3S9M A;  2PJ6 A;  3DLJ A;  1XF1 A;  2ZEG A;  3IIB A;  3B7I A;  1VHO A;  4MMO A;  3KZW A;  2O4H A;  2ZEL A;  4TNU A;  2XEJ A;  3KR4 A;  4EWT A;  4OC3 A;  3HLP A;  3B2Y A;  4UIA A;  1QMU A;  3IC1 A;  4FWU A;  1LFW A;  1F2P A;  4C85 A;  1Y9Z A;  4MHZ A;  1HDU A;  1AMP A;  4ZYQ A;  1ARL A;  5JGF A;  2AFU A;  1BAV A;  4NGS A;  3D7H A;  2ZEP A;  1FNO A;  5D8N A;  2C6G A;  5LRG A;  4OC5 A;  1YLO A;  3LMS A;  2HB6 A;  4ZI6 A;  4P4J A;  1EE3 P;  4P4I A;  3CT9 A;  4A37 A;  3FF3 A;  3TC8 A;  1ELM P;  3WC7 A;  3BI1 A;  2JBJ A;  2PJB A;  4Z65 A;  2ZEO A;  1ZLH A;  2WYR A;  3WC6 A;  3IWW A;  2PJ4 A;  4C8T A;  4DYO A;  3KL9 A;  4R8F A;  2GLF A;  1Y7E A;  2JBK A;  4JZ0 A;  1LAN A;  5K8P A;  3B3C A;  4C9E A;  1IGB A;  3KAS A;  3GLJ A;  4MHY A;  3PB7 X;  3KHZ A;  2ZEM A;  3NH8 A;  3KHX A;  3GUX A;  3IJ3 A;  2IMO A;  4PXD A;  4LQG A;  2PJ9 A;  2XEI A;  3PB6 X;  1KWM A;  5LYL A;  5LRK A;  4X8I A;  4TJX A;  4AXV A;  1LOK A;  4FUU A;  4A39 A;  4OC0 A;  3SI1 A;  2PJ7 A;  3V7Z A;  3RZA A;  4H2K A;  4PXB A;  4BD9 A;  2ZEF A;  4OIW A;  4A38 A;  2AFM A;  1CBX A;  7CPA A;  2C5Q A;  1TF8 A;  3CDX A;  3PBE A;  1YW4 A;  4C8A A;  1HDQ A;  1CG2 A;  4NFR A;  4P44 A;  3I74 A;  4JYW A;  2Q43 A;  4P4D A;  1Q7L A;  1TF9 A;  3WAB A;  4OC2 A;  5J1Q A;  1Z5R A;  3FMC A;  3IEH A;  3VH9 A;  4IK2 A;  4R76 A;  4NGQ A;  2PJ5 A;  3CPA A;  3FEC A;  2CF4 A;  2PIZ A;  2PE3 A;  3V38 A;  4B6Z A;  2POK A;  4P4B A;  3ISZ A;  5CPA A;  3D66 A;  3PBB A;  1F57 A;  2OOT A;  4OC1 A;  2C6C A;  1RTQ A;  2PJ1 A;  4Q7A A;  4C8C A;  5D29 A;  3D67 A;  2G9D A;  1ARM A;  1ZG8 A;  1TKF A;  5HXD A;  3B3W A;  3SJF A;  4P4E A;  4NJQ A;  5THW A;  2V8V A;  2NYQ A;  1CPX A;  3I6S A;  2ZEE A;  2IQ6 A;  2GRE A;  1VGY A;  5IB9 A;  1ELL P;  2PJC A;  3KQX A;  1ZG9 A;  3B3S A;  4C9U A;  5ELY A;  3FED A;  5IR2 A;  1ZG7 A;  4GM5 A;  3CPX A;  4ZY2 A;  5LYF A;  3PB4 X;  3IO1 A;  3D7G A;  3WT4 A;  4MHN A;  5JM6 A;  3RAM A;  3RBU A;  4OID A;  3B3T A;  3NFZ A;  2PVV A;  4P45 A;  8CPA A;  2RB7 A;  1IY7 A;  4RUH A;  3I1U A;  3D4U A;  4TWE A;  2PJ8 A;  4WWV A;  2F8H A;  2C1C A;  3B3V A;  2EK9 A;  1ZLI A;  2V8D A;  4YWY A;  4P6Y A;  2V8H A;  2C6P A;  4UEZ A;  3TX8 A;  1YME A;  3T8W A;  3L2N A;  3QNV A;  1Y0R A;  3H8F A;  2DEA A;  2ABZ A;  1CPS A;  2PJA A;  5F09 A;  3D68 A;  3BI0 A;  1YW6 A;  1GYT A;  3EIF A;  4YN3 A;  2QVP A;  2PCU A;  2VL1 A;  5K8N A;  1TKJ A;  3ISX A;  4MXU A;  1LAP A;  4C9R A;  3IFE A;  5LRJ A;  1V6C A;  6CPA A;  4FBE A;  4F9U A;  2ANP A;  3VTA A;  4KSI A;  3MN8 A;  4EFD A;  1FT7 A;  5DS0 A;  3FX6 A;  4MCS A;  3K9T A;  4X3R A;  5K8M A;  2CTC A;  4K3N A;  4WJB A;  2AFO A;  1BPN A;  2QJ8 A;  4P10 A;  2O53 A;  3FH4 A;  2OR4 A;  3D7F A;  2EWB A;  3FEE A;  4C9A A;  2V77 A;  3DGV A;  2AFX A;  3H8E A;  4UEE A;  2BCO A;  3KI9 A;  1F2O A;  2V8G A;  3FJU A;  2GU2 A;  3HUV A;  3D7D A;  4R7M A;  2HC9 A;  5LYI A;  1NSA A;  4OP4 A;  4NGP A;  1BLL E;  4IAV A;  4ZY0 A;  4NJR A;  2NSM A;  1CX8 A;  1YSJ A;  2PIY A;  3VAT A;  4PQA A;  1M4L A;  4UEF A;  2JEW A;  4ONW A;  1JQG A;  2PJ3 A;  3H8G A;  1TXR A;  1XRY A;  4C8U A;  2FVG A;  4EME A;  1BPM A;  3KQZ A;  1CP7 A;  2F7V A;  4X2T A;  4C86 A;  1H8L A;  4MCP A;  2ZED A;  4OKO A;  4PXE A;  2AFZ A;  4OME A;  2IJZ A;  1CP6 A;  2BOA A;  4IHM A;  1PCA A;  1R3N A;  1XBU A;  4F8Z A;  2ZOF A;  4ZX9 A;  1TKH A;  1HEE A;  1WVM A;  1DE4 C;  4OC4 A;  2AFS A;  3WC5 A;  2GLJ A;  5LYD A;  3PFE A;  1VHE A;  4UF4 A;  3PEI A;  2PRQ A;  4NGR A;  4C84 A;  2Q4Z A;  4W9Y A;  4R6T A;  1QQ9 A;  4TJV A;  2ZOG A;  1XJO A;  5HVH A;  1OBR A;  4MCQ A;  4P4F A;  3GB0 A;  1PYT B;  5HVF A;  4NGN A;  3SJE A;  3PB9 X;  1Z8L A;  3NH5 A;  2J9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...