4LQGA

X-ray structure of human glutamate carboxypeptidase ii (gcpii) in complex with a phosphoramidate inhibitor ctt1056
Total Genus 264
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
264
sequence length
696
structure length
692
Chain Sequence
KHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Glutamate carboxypeptidase 2
publication title Structure-Activity Relationship of (18)F-Labeled Phosphoramidate Peptidomimetic Prostate-Specific Membrane Antigen (PSMA)-Targeted Inhibitor Analogues for PET Imaging of Prostate Cancer.
pubmed doi rcsb
source organism Homo sapiens
total genus 264
structure length 692
sequence length 696
ec nomenclature ec 3.4.17.21: Glutamate carboxypeptidase II.
pdb deposition date 2013-07-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02225 PA PA domain
A PF04253 TFR_dimer Transferrin receptor-like dimerisation domain
A PF04389 Peptidase_M28 Peptidase family M28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.40 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Transferrin receptor-like, dimerisation domain 4lqgA03
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4lqgA01
3.50.30.30 Alpha Beta 3-Layer(bba) Sandwich Glucose Oxidase; domain 1 Glucose Oxidase; domain 1 4lqgA02
3BHXA 4MXUA 3SJXA 3PB9X 4C8AA 5LRKA 3IFEA 1TKJA 2HC9A 4K3NA 1ZG9A 3B3VA 4YN3A 3LMSA 1PYTB 4C8PA 3D7FA 1VHOA 4MCQA 2PJ0A 3ICUA 1Z5RA 4B6ZA 4OKOA 1BPMA 2C6CA 2PVWA 3RZAA 2AFUA 5CPAA 3IO1A 4FAIA 3IC1A 2O4HA 2POKA 4C9VA 1XMBA 3B3SA 3SJEA 1V6CA 1VHEA 4Z65A 1CPXA 2PIYA 4UEFA 1F57A 2QYVA 2V8HA 1IGBA 4EMEA 3RAMA 4TJXA 3KI9A 4YU9A 1TF9A 3K2KA 1EE3P 4ZYQA 2C6PA 2GLJA 4IK2A 1R43A 2ZEMA 1AYEA 5J1QA 4C9RA 1Z2LA 2C6GA 3D7GA 2OR4A 3KASA 4NFRA 2ZOFA 1VGYA 5HVGA 4C9AA 2EK8A 3L2NA 2RB7A 5F09A 1OBRA 3GLJA 2IQ6A 1BPNA 2DEAA 3S9LA 1ARLA 4P4DA 2PVVA 4EFDA 1FT7A 3WC6A 3CPAA 3KGQA 4FWUA 2Q51A 2ZEGA 2PJAA 5D8NA 4IHMA 7CPAA 4C8FA 4R6TA 3B3CA 4P4EA 5K8OA 2BCOA 4A39A 3PBBA 4MCSA 3NH8A 2C1CA 5LYDA 5I4MA 2G9DA 3ISXA 3N5FA 2GREA 3SI1A 4C9UA 4X2TA 4P6YA 2ZEPA 1WVMA 2PCUA 3TC8A 1CBXA 2PE3A 4C8CA 4PPZA 4MMOA 1IY7A 1PCAA 5IB9A 5LRJA 3VTAA 1XF1A 3PB8X 2WYRA 3FEEA 1JQGA 3JRUA 3PB4X 2AFXA 4ZY1A 3FMCA 1CG2A 2F7VA 4UIBA 2PRQA 4OMEA 1R3NA 4OC0A 1BAVA 2FVGA 4G1PA 4OP4A 4JYWA 3PFEA 2ZEHA 5DS0A 4O23A 2J9AA 3WC5A 2ZELA 2GLFA 3PFOA 4UF4A 2EWBA 4OC1A 4CDKA 3VATA 2QJ8A 2CTBA 1BLLE 4MRIA 2V8VA 3IIBA 4FUUA 1LOKA 4EWTA 4ZY2A 2AFSA 3B7IA 3HLPA 3MN8A 5JM6A 1YSJA 3PB7X 2NYQA 5LYIA 4OC3A 4F8ZA 3FJUA 3D66A 4R7MA 4PXEA 3D7HA 3KQZA 2CIJA 4ZX9A 2OOTA 3T8WA 4RUHA 2ABZA 4NGTA 4NGQA 4ZI6A 3FEDA 1ELMP 1HDUA 3CDXA 4P4BA 3KZWA 2ZENA 4LQGA 2AFOA 1H8LA 3H8GA 4KSIA 4DUKA 4MHZA 2AFMA 3PBEA 4MHYA 3KL9A 2EK9A 3TX8A 1NSAA 4A38A 4ZX8A 1GYTA 3SI0A 4TJVA 4A94A 3FF3A 4AXVA 5HXDA 1M4LA 2AFWA 3HUVA 2PJBA 3LWUA 1YMEA 2PJCA 3PRTA 2JBJA 2IMOA 2PJ9A 4H2KA 4NJRA 4DJLA 2Q4ZA 4X8IA 1LCPA 1ZG7A 4Q7AA 3GUXA 4PXBA 4NGPA 2WZNA 1DTDA 1TKHA 2PJ3A 3SJFA 1CX8A 2V8GA 3KHZA 3IWWA 3PB6X 4OIDA 1ARMA 3B2YA 1ZLIA 3FH4A 1YW6A 4P4IA 2I3CA 1F2PA 2V8DA 3BI1A 1YLOA 1CPSA 1XRYA 3K9TA 5LRGA 2F8HA 5HVFA 1TF8A 2CF4A 1QQ9A 1FNOA 1LAMA 3FECA 3B35A 4FBEA 2XEJA 4ZY0A 2IJZA 2QVPA 4PQAA 5JH9A 3DGVA 2O53A 4X3RA 4YWYA 4C84A 2ZEOA 4P10A 4MHPA 4F9UA 2V77A 4UEEA 3IEHA 3DLJA 1LANA 2PJ5A 4KNGE 3CT9A 3NA6A 4DYOA 3S9NA 2PJ6A 4OC4A 4R8FA 5THWA 3D67A 3WC7A 3FX6A 4IAVA 4JZ0A 1HEEA 2XEIA 2PJ8A 5LYLA 4PXDA 5K8PA 1ZG8A 3KQXA 3KHXA 1Y7EA 2CTCA 5HVHA 4C99A 3RBUA 1KWMA 4UEZA 1ZLHA 3I1UA 3SI2A 3WT4A 4NGNA 4P4JA 3BXMA 4MCRA 4OC2A 3NH4A 4NJQA 3FVLA 3WABA 4TWEA 3NH5A 3D68A 3VARA 2JBKA 2HB6A 4MHNA 3B3TA 4R76A 5K8NA 1UWYA 1Y0RA 2ZEEA 2AFZA 2PJ2A 4C86A 1YW4A 3SJGA 3D7DA 1Y0YA 1DE4C 2PJ7A 5ELYA 1LFWA 5CBMA 2Q43A 1HDQA 2ZEDA 2JEWA 2RFHA 4TNUA 1XFOA 1CP7A 4NGSA 5JGFA 4CDJA 4P4FA 2BOAA 4WWVA 2VL1A 4C8TA 1XBUA 8CPAA 3KR4A 3B3WA 1TKFA 3CPXA 2BO9A 4C85A 3ISZA 4W9YA 2XEFA 3H8EA 3V38A 4C8UA 4CPAA 3I74A 4P44A 1LAPA 2ZOGA 6CPAA 1TXRA 3GB0A 2XEGA 1CP6A 4NGRA 5LYFA 5D29A 1XJOA 4BD9A 2PJ4A 4ONWA 2ZEFA 4OIWA 3KR5A 2GU2A 2PJ1A 4PXCA 1AMPA 4A37A 1Q7LA 3QNVA 3IJ3A 2NSMA 4GM5A 4WJBA 3S9MA 4F9VA 4P45A 3H8FA 3BI0A 3VH9A 1Y9ZA 1QMUA 4UIAA 3D4UA 4NGMA 3NFZA 1ELLP 3PEIA 2ANPA 3MRUA 4MCPA 2PIZA 1VIXA 4OC5A 3I6SA 1F2OA 4C9EA 3EIFA 3V7ZA 5K8MA 1RTQA 1Z8LA
chains in the Genus database with same CATH superfamily
3ZNIA 3BHXA 4MXUA 1SQHA 2REFA 1S5KA 2IL4A 3SJXA 3PB9X 5FD8A 1VKCA 5C82A 1ZL0A 4C8AA 5LRKA 3IFEA 1TKJA 2HC9A 2R98A 4QC6A 4AG9A 4E8OA 4K3NA 4MJXA 3FBUA 2KCWA 2F5IA 3D2MA 1ZG9A 3B3VA 3PGPA 3LMSA 4GS4A 4YN3A 2DLAA 4L89A 5JYBA 1PYTB 4XPDC 5FVJA 1A2ZA 1UFHA 4C8PA 2Z3LA 3D7FA 1Z4RA 1VHOA 5G21A 2GFQA 1NBWA 5IV0A 5G20A 2Q4VA 4MCQA 2EUIA 1MJ9A 5IX3A 2PJ0A 3ICUA 4IF5A 4NXYA 3GJZA 4JLYA 5EC4A 1ZRSA 1Z5RA 1IYKA 2B4BA 3R95A 4B6ZA 4OKOA 1BPMA 4GPLB 1Q2YA 2Q0YA 4KOSA 3T9YA 2C6CA 2J8RA 2PVWA 3RZAA 2OLSA 2AFUA 3G3SA 4H89A 5CPAA 3IO1A 4FAIA 5AXIA 3DDDA 3IC1A 4CGPA 4J3GA 4A32A 2O4HA 2POKA 2ZW5A 4C9VA 1X10A 1XMBA 3B3SA 3SJEA 1V6CA 3OB2B 4NCZA 1VHEA 3RYOA 4Z65A 1CPXA 2PIYA 3FXTA 4I49A 4UEFA 1F57A 4Q38A 3VWDA 1NSLA 2BEIA 2QYVA 2V8HA 1IGBA 3TCVA 4B11A 4CGMA 4EMEA 5F46A 2AUMA 1PUAA 4IIXA 3RAMA 2MP0A 3VRPA 3KI9A 4TJXA 3T07A 3G23A 4YU9A 3U1BA 1TF9A 1CS0B 1MJAA 3K2KA 2PR1A 3CZXA 4KOYA 5AGEA 2Q44A 3LODA 5A27A 1EE3P 5H84A 4ZYQA 1EO0A 2C6PA 2GLJA 4BPXB 2JDCA 4IK2A 1R43A 3HPGG 2ZEMA 1AYEA 5J1QA 3P2FA 2ZW4A 1Z2LA 4C9RA 2C6GA 3D7GA 1NMTA 3B8GA 5F9MA 2OR4A 5DWNA 1M4DA 3KASA 4NFRA 4XNHB 2ZOFA 3G8WA 1VGYA 4YFJA 5HVGA 3TTHA 4C9AA 5HH1A 2EK8A 3L2NA 4AB7A 2RB7A 5F09A 1OBRA 2EO8A 3GLJA 3U88C 3TO6A 3T0TA 3IU1A 1M6VB 1ZYMA 2IQ6A 1BPNA 2DEAA 3S9LA 2CNSA 1ARLA 2D4OA 3D8PA 5EMIA 4CRYB 4MFQA 3NE8A 4B5PB 4C2ZA 4UFVA 4P4DA 2PVVA 4EFDA 1FT7A 4M85A 3WC6A 3CPAA 4FD7A 2XPOA 2R1IA 3KGQA 4FWUA 4A2ZA 2Q51A 2ZEGA 2PJAA 5D8NA 4IHMA 7CPAA 4RN7A 1CE8B 2OZUA 3B3CA 4MHDA 4P4EA 4R6TA 5K8OA 4C8FA 2BCOA 4HPSA 5H86A 4A39A 4COBA 3PBBA 4MCSA 5HKYA 1QSOA 2C1CA 3FB3A 3NH8A 2G9DA 3ISXA 3N5FA 2GREA 5LYDA 1R57A 3SI1A 3GKRA 3V8IA 3TLCA 4C9UA 4X2TA 1IOFA 4P6YA 2I79A 2ZEPA 1WVMA 2PCUA 2R7HA 3TC8A 1Z4EA 2Z3MA 1GGOA 1I21A 1CBXA 2PE3A 4C8CA 4PPZA 4MMOA 1X12A 1IY7A 1PCAA 4KVME 1J3LA 4LX9A 3DR6A 4AVAA 4R57A 5IB9A 4JVOA 3KRVA 5LRJA 3VTAA 1XF1A 4PK3A 3PB8X 3R96A 1U6MA 3VWEA 4QB9A 2FS5A 2WYRA 3TLBA 4BTFA 3FEEA 3R1KA 1JQGA 4NF1A 4PK2A 4CAWA 3JRUA 3PB4X 3CXPA 4MY3A 4KORA 4UBRA 2AFXA 2PCNA 4ZY1A 1DIKA 2CNTA 2WPXA 3FMCA 2B5GA 1CG2A 2F7VA 4UIBA 2P6EA 2PRQA 2HUZA 4OMEA 1PU9A 4FD4A 5GCNA 2YGWA 1R3NA 4OC0A 1BAVA 3VRQA 2FVGA 2E28A 4G1PA 1BOBA 4OP4A 4B5OA 3KKWA 2VKZG 1S7NA 4JYWA 3DR8A 3IWEA 3PFEA 2Z3PA 4OADA 3E0KA 1Z8WA 2GIVA 3TO7A 2ZEHA 4CRZB 5HMNA 3TLAA 5DS0A 1XMTA 4O23A 2J9AA 3IU2A 3HPHE 3WC5A 2ZELA 3DSBA 3O8ZA 3IGRA 3HMJG 4KUBA 4COGA 4F6AA 3BUWB 1B6BA 1ON0A 2GLFA 3PFOA 1M4IA 4M3SA 4PV6A 2EWBA 4OC1A 2VI7A 4UF4A 4CDKA 3VATA 2QJ8A 4MFJA 2CTBA 4JD6A 2VXKA 1BLLE 2FL4A 4MRIA 4BPWB 3TOBA 4E0AA 4CGOA 2V8VA 3IIBA 4FUUA 2NMTA 1LOKA 1QSRA 1IB1E 4CYQA 3MGDA 5AG7A 4CYPA 2HWGA 4EWTA 4ZY2A 1WK4A 3PP9A 4MI1A 2AFSA 3B7IA 3HLPA 4X5KA 4F0XA 5BY0A 4UFWA 3MN8A 5JM6A 4INJA 2PRBA 1VI4A 1YSJA 3TT2A 3R9FA 2G3AA 1XEBA 1Z9UA 3PB7X 3FYNA 2NYQA 4NSQA 3NE7A 4HNWB 5LYIA 4CAFA 4CAEA 1NXJA 2AUNA 4FD6A 4OC3A 4F8ZA 3FJUA 3D66A 4BMHA 1WJTA 1Q5XA 4R7MA 3W91A 1M1DA 2Z3OA 1S7FA 3OP0A 3QAYA 2Z11A 4H6UA 4U5YA 3T05A 3RNZA 4PXEA 3D7HA 2G3TA 3KQZA 4HNYB 3TLZA 3T5MA 4RS2A 2RC4A 4A33A 4LUAA 2QIRA 2HI6A 2CIJA 4L8AA 4UCNA 2B4DA 2WSAA 1IOIA 2Z3NA 4ZX9A 1P4NA 1C30B 2OOTA 3T8WA 4RUHA 4CZ1A 2C27A 2ABZA 4NGTA 4NGQA 4ZI6A 4B14A 3FEDA 1ELMP 2VZZA 2ZXVA 5DWMA 3SR3A 1KEEB 3TE4A 1HDUA 3CDXA 3JTKA 2B3UA 3K9UA 4UCMA 4P4BA 4XPKA 3KZWA 3D2PA 1RO5A 3VROA 3RO0A 3PT1A 2ZENA 5KTCA 4CO9A 4LQGA 4KUAA 4QVTA 2AFOA 4ZBGA 1H8LA 1IIDA 2R8VA 3H8GA 4KSIA 4K30A 3I3GA 4DUKA 4MHZA 1LRZA 2AFMA 3PBEA 4MHYA 2FIWA 3KL9A 4QUSA 2EK9A 2PDOA 3BLNA 3TX8A 4CAXA 1NSAA 4A38A 2PSWA 1QSNA 2OU2A 4ZX8A 4KOVA 1GYTA 1MK4A 2D4PA 4KVXA 3R9GA 3SI0A 3W6SA 4A94A 4TJVA 3FF3A 4AXVA 4KS9A 3SHPA 5AG4A 5HXDA 2YJVA 1M4LA 1M4GA 2AFWA 4C2XA 2P6FA 3HUVA 1M44A 3TLGA 2I00A 2PJBA 3LWUA 1S3ZA 1YMEA 2PJCA 4HNXB 5IR2A 3TLYA 3PRTA 4E5SA 2B0AA 2JBJA 2IMOA 2PJ9A 4HKFA 4C7HA 4H2KA 4NJRA 4DJLA 1KBLA 3OAKA 4CYNA 5JVLA 2Q4ZA 3SXNA 2FCKA 1Y9KA 2FSRA 4KOWA 4MBUA 4X8IA 1LCPA 1ZG7A 1V0CA 2DPTA 4Q7AA 4DNCA 1VBGA 1AUGA 3GUXA 4KSAA 4KZTA 2JDDA 4PXBA 4NGPA 1Q2CA 2WZNA 5F48A 1DTDA 5A28A 2FE7A 3EXNA 1I12A 3TLEA 3EC4A 5KTAA 2XPNA 1TKHA 2PJ3A 3BUMB 3FNCA 3SJFA 4YRHA 1CX8A 2GANA 4RI1A 2V8GA 3JUWA 4CYOA 3KHZA 3IWWA 2Q04A 3EY5A 3PB6X 5JQ4A 4OIDA 3CXSA 2CNMA 3A9LA 4CGNA 1XF8A 5EBVA 1ARMA 3B2YA 4ZGYB 1ZLIA 2HQYA 2Z10A 3FH4A 1VHSA 1YW6A 5J3XA 4R3LA 4IUSA 3IWGA 1R61A 5K99A 4P4IA 1S7LA 5I4MA 2I3CA 5HKZA 1YVKA 1F2PA 2V8DA 4AVBA 3FRMA 1YK3A 3BI1A 1YLOA 1CPSA 2UV8G 1K4JA 1FBVA 2Q7SA 4MY0A 1XRYA 1XIXA 3K9TA 5LRGA 2F8HA 1ZO0A 2Y0MA 4U9YA 5HVFA 2YJTA 3K4IA 1Z9EA 2Y1MA 1TF8A 3F8KA 2N3AB 1IICA 2CF4A 1QQ9A 1FNOA 1KUYA 1LAMA 1YREA 3FECA 3B35A 1KZFA 2XEJA 2QECA 4MFKA 2B5GB 4Y49C 4FBEA 4ZY0A 2CY2A 1T36B 5G22A 3EZAA 4IIYA 5F1YA 2JLMA 2IJZA 4KOUA 3P2HA 2QVPA 4PQAA 5JH9A 3DGVA 1FY7A 2XPLA 4C68A 2A4NA 2O53A 2OB0A 4KVOE 4AG7A 4X3RA 4YWYA 3BUNB 3S6FA 3EZEA 1Y7RA 3VGOA 3ZJ0A 1JDBC 4MJ8A 1YLEA 2GE3A 1MJBA 5CNPA 2ZW7A 4QBJA 4C84A 2ZEOA 4P10A 4MHPA 4KOXA 4F9UA 4EYSA 2V77A 4UEEA 4EVYA 3IEHA 3DLJA 1LANA 2XPPA 2PJ5A 4ORFA 3BUXB 4KNGE 4UCPA 2YNDA 2PC1A 3CT9A 2VEZA 3NA6A 4YGOA 4JXRA 1XE4A 4DYOA 4BPUB 3S9NA 4KOTA 5AG6A 2PJ6A 4OC4A 2CXAA 4R8FA 5THWA 3D67A 3WC7A 2HROA 3OB1B 3FX6A 3DNSA 4JWPA 4H1HA 2Y1NA 4IAVA 4Q36A 4B10A 3R9EA 2C5QA 4JZ0A 1HEEA 2XEIA 1S60A 2FXFA 2WUUA 4M6IA 4M6HA 2PJ8A 4ONUA 4AVCA 5IB0A 2CBLA 5LYLA 4E2AA 1YGHA 4PXDA 3PLFB 5K8PA 2X0SA 1OZPA 1ZG8A 3S6GA 3KQXA 3KHXA 1P0HA 1Y7EA 2K5TA 3GY9A 2CTCA 1YR0A 3T90A 4KSFA 3JVNA 5HVHA 4II9A 4B13A 1Z8XA 4UFXA 4UA3A 3TO9A 4C99A 3RBUA 3EZBA 1KWMA 1VBHA 1EZBA 4UEZA 4R3KA 2JEVA 4MFLA 1ZLHA 1IYLA 4LQ6A 4BINA 1QSMA 2BSWA 2PR8A 1Q2DA 3EO4A 3I1UA 2B4DB 3QAHA 4XPLA 3SI2A 4C2YA 3WT4A 2ARHA 4R87A 4NGNA 1JDEA 4J0NA 4P4JA 2ZPAA 5F5XA 1EZAA 4MFZA 2AJ6A 3BXMA 4MCRA 4PSWA 2J8MA 1KUXA 4OC2A 3H5ZA 1IU8A 3S6HA 3W6XA 4CAVA 3D3SA 3NH4A 2AE6A 2EZAA 3PFVA 4NJQA 3FVLA 3WABA 2EZBA 3N7ZA 4TWEA 4M6GA 1YQEA 3NH5A 3D68A 5J8FA 3VARA 1GHEA 1NE9A 2JBKA 2HB6A 2P0WA 4H6ZA 4MHNA 1YVOA 2BL1A 3B3TA 4PSXA 4R76A 5K8NA 1UWYA 1Y0RA 2QMLA 2ZEEA 4KLWA 1TIQA 5F49A 2R82A 4RR2B 2AFZA 2VZYA 2PJ2A 2Q4YA 4C86A 1WWZA 3SJGA 1YW4A 3D7DA 1YX0A 2DF5A 1Y0YA 3VRRA 4R9MA 4A95A 1DE4C 2O28A 3WR7A 4JJXA 5I0CA 2PJ7A 5ELYA 2REEA 5E96A 4C7IA 1YVHA 1LFWA 5CBMA 2DIKA 3GYAA 2Q43A 1HDQA 3TLGB 4KLVA 2FT0A 2ZEDA 1CJWA 2JEWA 2RFHA 4TNUA 1JWQA 3SXOA 3S6KA 1XFOA 2B58A 1CP7A 2P6GA 3LACA 3UY5A 4NGSA 1KUVA 1RXTA 4B12A 5JGFA 4M8DA 4OLLA 3BJ8A 4B5PA 5HKWA 2OZHA 4MI4A 2ZW6A 4CDJA 4P4FA 3PZJA 2BOAA 2H5MA 4U9ZA 4WWVA 2FM4A 2OZGA 2VL1A 2YNCA 4UWJA 4C8TA 1XBUA 8CPAA 2ODFA 3KR4A 3B3WA 5F47A 3TOAA 5JPHA 5BWAB 4XNHC 2YNEA 1TKFA 3CPXA 2BO9A 1J4JA 4A4CA 1BXRB 2OH1A 1B87A 4C85A 3ISZA 2G0BA 4W9YA 2WPWA 1S7KA 2Z3KA 3H4QA 4Y49B 2XEFA 3F5BA 3H8EA 3V38A 5ISVA 4CPAA 3FIXA 3I74A 4C8UA 4F0YA 2GP4A 4P44A 1LAPA 2ZOGA 1C3OB 5F13A 6CPAA 1TXRA 3GB0A 2XEGA 2PQ8A 2D0OA 2DPSA 2EBJA 3QB8A 2Q7BA 1CP6A 4NGRA 5AG5A 4A30A 5LYFA 5D29A 5KTDA 2B3VA 2D0PA 1XJOA 2YNCC 4BD9A 2PJ4A 4ONWA 2ZEFA 4OIWA 3KR5A 4A4BA 2X7BA 2GU2A 2PJ1A 3EFAA 3BUOB 2EVNA 4PXCA 1AMPA 4A37A 2BUEA 1Q7LA 4BBHA 3QNVA 5J8CA 3IJ3A 2NSMA 2VBQA 4GM5A 4WJBA 3NOJA 3GIUA 3S9MA 4F9VA 2DXQA 4P45A 3NFQA 3H8FA 3BI0A 2ATRA 1QSTA 3LD2A 3VH9A 4OAEA 3I9SA 3ZZIA 1Y9ZA 1QMUA 1Z8TA 1KC7A 3TYXA 4UIAA 3D4UA 5G1ZA 3VRNA 4NGMA 3NFZA 2HV2A 2FIAA 4JXQA 4UWIA 3C8OA 1ELLP 3PEIA 2ANPA 3CXQA 3MRUA 4MCPA 1I1DA 2PIZA 4NEXA 1VIXA 4GXHA 3F0AA 3BJ7A 1CM0A 4OC5A 1B47A 4CS0B 3C26A 5C88A 4E94A 3F9KC 3TFYA 3I6SA 1BO4A 1F2OA 2B4JC 1XOVA 2J8NA 2VQYA 3OWCA 4FD5A 4CGLA 2Z0ZA 1Y9WA 1A9XB 3EIFA 4C9EA 4XPDB 3V7ZA 2EZCA 1N71A 1RTQA 4MFPA 5K8MA 4A31A 1L0CA 1Z8LA
chains in the Genus database with same CATH topology
3BHXA 4MXUA 3SJXA 3PB9X 4C8AA 5LRKA 3IFEA 1TKJA 2HC9A 4K3NA 1ZG9A 3B3VA 4YN3A 3LMSA 1PYTB 4C8PA 3D7FA 1VHOA 4MCQA 2PJ0A 3ICUA 1Z5RA 4B6ZA 4OKOA 1BPMA 2C6CA 2PVWA 3RZAA 2AFUA 5CPAA 3IO1A 4FAIA 3IC1A 2O4HA 2POKA 4C9VA 1XMBA 3B3SA 3SJEA 1V6CA 1VHEA 4Z65A 1CPXA 2PIYA 4UEFA 1F57A 2QYVA 2V8HA 1IGBA 4EMEA 3RAMA 4TJXA 3KI9A 4YU9A 1TF9A 3K2KA 1EE3P 4ZYQA 2C6PA 2GLJA 4IK2A 1R43A 2ZEMA 1AYEA 5J1QA 4C9RA 1Z2LA 2C6GA 3D7GA 2OR4A 3KASA 4NFRA 2ZOFA 1VGYA 5HVGA 4C9AA 2EK8A 3L2NA 2RB7A 5F09A 1OBRA 3GLJA 2IQ6A 1BPNA 2DEAA 3S9LA 1ARLA 4P4DA 2PVVA 4EFDA 1FT7A 3WC6A 3CPAA 3KGQA 4FWUA 2Q51A 2ZEGA 2PJAA 5D8NA 4IHMA 7CPAA 4C8FA 4R6TA 3B3CA 4P4EA 5K8OA 2BCOA 4A39A 3PBBA 4MCSA 3NH8A 2C1CA 5LYDA 5I4MA 2G9DA 3ISXA 3N5FA 2GREA 3SI1A 4C9UA 4X2TA 4P6YA 2ZEPA 1WVMA 2PCUA 3TC8A 1CBXA 2PE3A 4C8CA 4PPZA 4MMOA 1IY7A 1PCAA 5IB9A 5LRJA 3VTAA 1XF1A 3PB8X 2WYRA 3FEEA 1JQGA 3JRUA 3PB4X 2AFXA 4ZY1A 3FMCA 1CG2A 2F7VA 4UIBA 2PRQA 4OMEA 1R3NA 4OC0A 1BAVA 2FVGA 4G1PA 4OP4A 4JYWA 3PFEA 2ZEHA 5DS0A 4O23A 2J9AA 3WC5A 2ZELA 2GLFA 3PFOA 4UF4A 2EWBA 4OC1A 4CDKA 3VATA 2QJ8A 2CTBA 1BLLE 4MRIA 2V8VA 3IIBA 4FUUA 1LOKA 4EWTA 4ZY2A 2AFSA 3B7IA 3HLPA 3MN8A 5JM6A 1YSJA 3PB7X 2NYQA 5LYIA 4OC3A 4F8ZA 3FJUA 3D66A 4R7MA 4PXEA 3D7HA 3KQZA 2CIJA 4ZX9A 2OOTA 3T8WA 4RUHA 2ABZA 4NGTA 4NGQA 4ZI6A 3FEDA 1ELMP 1HDUA 3CDXA 4P4BA 3KZWA 2ZENA 4LQGA 2AFOA 1H8LA 3H8GA 4KSIA 4DUKA 4MHZA 2AFMA 3PBEA 4MHYA 3KL9A 2EK9A 3TX8A 1NSAA 4A38A 4ZX8A 1GYTA 3SI0A 4TJVA 4A94A 3FF3A 4AXVA 5HXDA 1M4LA 2AFWA 3HUVA 2PJBA 3LWUA 1YMEA 2PJCA 5IR2A 3PRTA 2JBJA 2IMOA 2PJ9A 4H2KA 4NJRA 4DJLA 2Q4ZA 4X8IA 1LCPA 1ZG7A 4Q7AA 3GUXA 4PXBA 4NGPA 2WZNA 1DTDA 1TKHA 2PJ3A 3SJFA 1CX8A 2V8GA 3KHZA 3IWWA 3PB6X 4OIDA 1ARMA 3B2YA 1ZLIA 3FH4A 1YW6A 4P4IA 2I3CA 1F2PA 2V8DA 3BI1A 1YLOA 1CPSA 1XRYA 3K9TA 5LRGA 2F8HA 5HVFA 1TF8A 2CF4A 1QQ9A 1FNOA 1LAMA 3FECA 3B35A 4FBEA 2XEJA 4ZY0A 2IJZA 2QVPA 4PQAA 5JH9A 3DGVA 2O53A 4X3RA 4YWYA 4C84A 2ZEOA 4P10A 4MHPA 4F9UA 2V77A 4UEEA 3IEHA 3DLJA 1LANA 2PJ5A 4KNGE 3CT9A 3NA6A 4DYOA 3S9NA 2PJ6A 4OC4A 4R8FA 5THWA 3D67A 3WC7A 3FX6A 4IAVA 2C5QA 4JZ0A 1HEEA 2XEIA 2PJ8A 5LYLA 4PXDA 5K8PA 1ZG8A 3KQXA 3KHXA 1Y7EA 2CTCA 5HVHA 4C99A 3RBUA 1KWMA 4UEZA 1ZLHA 3I1UA 3SI2A 3WT4A 4NGNA 4P4JA 3BXMA 4MCRA 4OC2A 3NH4A 4NJQA 3FVLA 3WABA 4TWEA 3NH5A 3D68A 3VARA 2JBKA 2HB6A 4MHNA 3B3TA 4R76A 5K8NA 1UWYA 1Y0RA 2ZEEA 2AFZA 2PJ2A 4C86A 1YW4A 3SJGA 3D7DA 1Y0YA 1DE4C 2PJ7A 5ELYA 1LFWA 5CBMA 2Q43A 1HDQA 2ZEDA 2JEWA 2RFHA 4TNUA 1XFOA 1CP7A 4NGSA 5JGFA 4CDJA 4P4FA 2BOAA 4WWVA 2VL1A 4C8TA 1XBUA 8CPAA 3KR4A 3B3WA 1TKFA 3CPXA 2BO9A 4C85A 3ISZA 4W9YA 2XEFA 3H8EA 3V38A 4C8UA 4CPAA 3I74A 2GP4A 4P44A 1LAPA 2ZOGA 6CPAA 1TXRA 3GB0A 2XEGA 1CP6A 4NGRA 5LYFA 5D29A 1XJOA 4BD9A 2PJ4A 4ONWA 2ZEFA 4OIWA 3KR5A 2GU2A 2PJ1A 4PXCA 1AMPA 4A37A 1Q7LA 3QNVA 3IJ3A 2NSMA 4GM5A 4WJBA 3S9MA 4F9VA 4P45A 3H8FA 3BI0A 3VH9A 1Y9ZA 1QMUA 4UIAA 3D4UA 4NGMA 3NFZA 1ELLP 3PEIA 2ANPA 3MRUA 4MCPA 2PIZA 1VIXA 4OC5A 3I6SA 1F2OA 4C9EA 3EIFA 3V7ZA 5K8MA 1RTQA 1Z8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BHX A;  4MXU A;  3SJX A;  3PB9 X;  4C8A A;  5LRK A;  3IFE A;  1TKJ A;  2HC9 A;  4K3N A;  1ZG9 A;  3B3V A;  4YN3 A;  3LMS A;  1PYT B;  4C8P A;  3D7F A;  1VHO A;  4MCQ A;  2PJ0 A;  3ICU A;  1Z5R A;  4B6Z A;  4OKO A;  1BPM A;  2C6C A;  2PVW A;  3RZA A;  2AFU A;  5CPA A;  3IO1 A;  4FAI A;  3IC1 A;  2O4H A;  2POK A;  4C9V A;  1XMB A;  3B3S A;  3SJE A;  1V6C A;  1VHE A;  4Z65 A;  1CPX A;  2PIY A;  4UEF A;  1F57 A;  2QYV A;  2V8H A;  1IGB A;  4EME A;  3RAM A;  4TJX A;  3KI9 A;  4YU9 A;  1TF9 A;  3K2K A;  1EE3 P;  4ZYQ A;  2C6P A;  2GLJ A;  4IK2 A;  1R43 A;  2ZEM A;  1AYE A;  5J1Q A;  4C9R A;  1Z2L A;  2C6G A;  3D7G A;  2OR4 A;  3KAS A;  4NFR A;  2ZOF A;  1VGY A;  5HVG A;  4C9A A;  2EK8 A;  3L2N A;  2RB7 A;  5F09 A;  1OBR A;  3GLJ A;  2IQ6 A;  1BPN A;  2DEA A;  3S9L A;  1ARL A;  4P4D A;  2PVV A;  4EFD A;  1FT7 A;  3WC6 A;  3CPA A;  3KGQ A;  4FWU A;  2Q51 A;  2ZEG A;  2PJA A;  5D8N A;  4IHM A;  7CPA A;  4C8F A;  4R6T A;  3B3C A;  4P4E A;  5K8O A;  2BCO A;  4A39 A;  3PBB A;  4MCS A;  3NH8 A;  2C1C A;  5LYD A;  5I4M A;  2G9D A;  3ISX A;  3N5F A;  2GRE A;  3SI1 A;  4C9U A;  4X2T A;  4P6Y A;  2ZEP A;  1WVM A;  2PCU A;  3TC8 A;  1CBX A;  2PE3 A;  4C8C A;  4PPZ A;  4MMO A;  1IY7 A;  1PCA A;  5IB9 A;  5LRJ A;  3VTA A;  1XF1 A;  3PB8 X;  2WYR A;  3FEE A;  1JQG A;  3JRU A;  3PB4 X;  2AFX A;  4ZY1 A;  3FMC A;  1CG2 A;  2F7V A;  4UIB A;  2PRQ A;  4OME A;  1R3N A;  4OC0 A;  1BAV A;  2FVG A;  4G1P A;  4OP4 A;  4JYW A;  3PFE A;  2ZEH A;  5DS0 A;  4O23 A;  2J9A A;  3WC5 A;  2ZEL A;  2GLF A;  3PFO A;  4UF4 A;  2EWB A;  4OC1 A;  4CDK A;  3VAT A;  2QJ8 A;  2CTB A;  1BLL E;  4MRI A;  2V8V A;  3IIB A;  4FUU A;  1LOK A;  4EWT A;  4ZY2 A;  2AFS A;  3B7I A;  3HLP A;  3MN8 A;  5JM6 A;  1YSJ A;  3PB7 X;  2NYQ A;  5LYI A;  4OC3 A;  4F8Z A;  3FJU A;  3D66 A;  4R7M A;  4PXE A;  3D7H A;  3KQZ A;  2CIJ A;  4ZX9 A;  2OOT A;  3T8W A;  4RUH A;  2ABZ A;  4NGT A;  4NGQ A;  4ZI6 A;  3FED A;  1ELM P;  1HDU A;  3CDX A;  4P4B A;  3KZW A;  2ZEN A;  4LQG A;  2AFO A;  1H8L A;  3H8G A;  4KSI A;  4DUK A;  4MHZ A;  2AFM A;  3PBE A;  4MHY A;  3KL9 A;  2EK9 A;  3TX8 A;  1NSA A;  4A38 A;  4ZX8 A;  1GYT A;  3SI0 A;  4TJV A;  4A94 A;  3FF3 A;  4AXV A;  5HXD A;  1M4L A;  2AFW A;  3HUV A;  2PJB A;  3LWU A;  1YME A;  2PJC A;  3PRT A;  2JBJ A;  2IMO A;  2PJ9 A;  4H2K A;  4NJR A;  4DJL A;  2Q4Z A;  4X8I A;  1LCP A;  1ZG7 A;  4Q7A A;  3GUX A;  4PXB A;  4NGP A;  2WZN A;  1DTD A;  1TKH A;  2PJ3 A;  3SJF A;  1CX8 A;  2V8G A;  3KHZ A;  3IWW A;  3PB6 X;  4OID A;  1ARM A;  3B2Y A;  1ZLI A;  3FH4 A;  1YW6 A;  4P4I A;  2I3C A;  1F2P A;  2V8D A;  3BI1 A;  1YLO A;  1CPS A;  1XRY A;  3K9T A;  5LRG A;  2F8H A;  5HVF A;  1TF8 A;  2CF4 A;  1QQ9 A;  1FNO A;  1LAM A;  3FEC A;  3B35 A;  4FBE A;  2XEJ A;  4ZY0 A;  2IJZ A;  2QVP A;  4PQA A;  5JH9 A;  3DGV A;  2O53 A;  4X3R A;  4YWY A;  4C84 A;  2ZEO A;  4P10 A;  4MHP A;  4F9U A;  2V77 A;  4UEE A;  3IEH A;  3DLJ A;  1LAN A;  2PJ5 A;  4KNG E;  3CT9 A;  3NA6 A;  4DYO A;  3S9N A;  2PJ6 A;  4OC4 A;  4R8F A;  5THW A;  3D67 A;  3WC7 A;  3FX6 A;  4IAV A;  4JZ0 A;  1HEE A;  2XEI A;  2PJ8 A;  5LYL A;  4PXD A;  5K8P A;  1ZG8 A;  3KQX A;  3KHX A;  1Y7E A;  2CTC A;  5HVH A;  4C99 A;  3RBU A;  1KWM A;  4UEZ A;  1ZLH A;  3I1U A;  3SI2 A;  3WT4 A;  4NGN A;  4P4J A;  3BXM A;  4MCR A;  4OC2 A;  3NH4 A;  4NJQ A;  3FVL A;  3WAB A;  4TWE A;  3NH5 A;  3D68 A;  3VAR A;  2JBK A;  2HB6 A;  4MHN A;  3B3T A;  4R76 A;  5K8N A;  1UWY A;  1Y0R A;  2ZEE A;  2AFZ A;  2PJ2 A;  4C86 A;  1YW4 A;  3SJG A;  3D7D A;  1Y0Y A;  1DE4 C;  2PJ7 A;  5ELY A;  1LFW A;  5CBM A;  2Q43 A;  1HDQ A;  2ZED A;  2JEW A;  2RFH A;  4TNU A;  1XFO A;  1CP7 A;  4NGS A;  5JGF A;  4CDJ A;  4P4F A;  2BOA A;  4WWV A;  2VL1 A;  4C8T A;  1XBU A;  8CPA A;  3KR4 A;  3B3W A;  1TKF A;  3CPX A;  2BO9 A;  4C85 A;  3ISZ A;  4W9Y A;  2XEF A;  3H8E A;  3V38 A;  4C8U A;  4CPA A;  3I74 A;  4P44 A;  1LAP A;  2ZOG A;  6CPA A;  1TXR A;  3GB0 A;  2XEG A;  1CP6 A;  4NGR A;  5LYF A;  5D29 A;  1XJO A;  4BD9 A;  2PJ4 A;  4ONW A;  2ZEF A;  4OIW A;  3KR5 A;  2GU2 A;  2PJ1 A;  4PXC A;  1AMP A;  4A37 A;  1Q7L A;  3QNV A;  3IJ3 A;  2NSM A;  4GM5 A;  4WJB A;  3S9M A;  4F9V A;  4P45 A;  3H8F A;  3BI0 A;  3VH9 A;  1Y9Z A;  1QMU A;  4UIA A;  3D4U A;  4NGM A;  3NFZ A;  1ELL P;  3PEI A;  2ANP A;  3MRU A;  4MCP A;  2PIZ A;  1VIX A;  4OC5 A;  3I6S A;  1F2O A;  4C9E A;  3EIF A;  3V7Z A;  5K8M A;  1RTQ A;  1Z8L A; 
#chains in the Genus database with same CATH topology
 3ZNI A;  3BHX A;  4MXU A;  1SQH A;  2REF A;  1S5K A;  2IL4 A;  3SJX A;  3PB9 X;  5FD8 A;  1VKC A;  5C82 A;  1ZL0 A;  4C8A A;  5LRK A;  3IFE A;  1TKJ A;  2HC9 A;  2R98 A;  4QC6 A;  4AG9 A;  4E8O A;  4K3N A;  4MJX A;  3FBU A;  2KCW A;  2F5I A;  3D2M A;  1ZG9 A;  3B3V A;  3PGP A;  3LMS A;  4GS4 A;  4YN3 A;  2DLA A;  4L89 A;  5JYB A;  1PYT B;  4XPD C;  5FVJ A;  1A2Z A;  1UFH A;  4C8P A;  2Z3L A;  3D7F A;  1Z4R A;  1VHO A;  5G21 A;  2GFQ A;  1NBW A;  5IV0 A;  5G20 A;  2Q4V A;  4MCQ A;  2EUI A;  1MJ9 A;  5IX3 A;  2PJ0 A;  3ICU A;  4IF5 A;  4NXY A;  3GJZ A;  4JLY A;  5EC4 A;  1ZRS A;  1Z5R A;  1IYK A;  2B4B A;  3R95 A;  4B6Z A;  4OKO A;  1BPM A;  4GPL B;  1Q2Y A;  2Q0Y A;  4KOS A;  3T9Y A;  2C6C A;  2J8R A;  2PVW A;  3RZA A;  2OLS A;  2AFU A;  3G3S A;  4H89 A;  5CPA A;  3IO1 A;  4FAI A;  5AXI A;  3DDD A;  3IC1 A;  4CGP A;  4J3G A;  4A32 A;  2O4H A;  2POK A;  2ZW5 A;  4C9V A;  1X10 A;  1XMB A;  3B3S A;  3SJE A;  1V6C A;  3OB2 B;  4NCZ A;  1VHE A;  3RYO A;  4Z65 A;  1CPX A;  2PIY A;  3FXT A;  4I49 A;  4UEF A;  1F57 A;  4Q38 A;  3VWD A;  1NSL A;  2BEI A;  2QYV A;  2V8H A;  1IGB A;  3TCV A;  4B11 A;  4CGM A;  4EME A;  5F46 A;  2AUM A;  1PUA A;  4IIX A;  3RAM A;  2MP0 A;  3VRP A;  3KI9 A;  4TJX A;  3T07 A;  3G23 A;  4YU9 A;  3U1B A;  1TF9 A;  1CS0 B;  1MJA A;  3K2K A;  2PR1 A;  3CZX A;  4KOY A;  5AGE A;  2Q44 A;  3LOD A;  5A27 A;  1EE3 P;  5H84 A;  4ZYQ A;  1EO0 A;  2C6P A;  2GLJ A;  4BPX B;  2JDC A;  4IK2 A;  1R43 A;  3HPG G;  2ZEM A;  1AYE A;  5J1Q A;  3P2F A;  2ZW4 A;  1Z2L A;  4C9R A;  2C6G A;  3D7G A;  1NMT A;  3B8G A;  5F9M A;  2OR4 A;  5DWN A;  1M4D A;  3KAS A;  4NFR A;  4XNH B;  2ZOF A;  3G8W A;  1VGY A;  4YFJ A;  5HVG A;  3TTH A;  4C9A A;  5HH1 A;  2EK8 A;  3L2N A;  4AB7 A;  2RB7 A;  5F09 A;  1OBR A;  2EO8 A;  3GLJ A;  3U88 C;  3TO6 A;  3T0T A;  3IU1 A;  1M6V B;  1ZYM A;  2IQ6 A;  1BPN A;  2DEA A;  3S9L A;  2CNS A;  1ARL A;  2D4O A;  3D8P A;  5EMI A;  4CRY B;  4MFQ A;  3NE8 A;  4B5P B;  4C2Z A;  4UFV A;  4P4D A;  2PVV A;  4EFD A;  1FT7 A;  4M85 A;  3WC6 A;  3CPA A;  4FD7 A;  2XPO A;  2R1I A;  3KGQ A;  4FWU A;  4A2Z A;  2Q51 A;  2ZEG A;  2PJA A;  5D8N A;  4IHM A;  7CPA A;  4RN7 A;  1CE8 B;  2OZU A;  3B3C A;  4MHD A;  4P4E A;  4R6T A;  5K8O A;  4C8F A;  2BCO A;  4HPS A;  5H86 A;  4A39 A;  4COB A;  3PBB A;  4MCS A;  5HKY A;  1QSO A;  2C1C A;  3FB3 A;  3NH8 A;  2G9D A;  3ISX A;  3N5F A;  2GRE A;  5LYD A;  1R57 A;  3SI1 A;  3GKR A;  3V8I A;  3TLC A;  4C9U A;  4X2T A;  1IOF A;  4P6Y A;  2I79 A;  2ZEP A;  1WVM A;  2PCU A;  2R7H A;  3TC8 A;  1Z4E A;  2Z3M A;  1GGO A;  1I21 A;  1CBX A;  2PE3 A;  4C8C A;  4PPZ A;  4MMO A;  1X12 A;  1IY7 A;  1PCA A;  4KVM E;  1J3L A;  4LX9 A;  3DR6 A;  4AVA A;  4R57 A;  5IB9 A;  4JVO A;  3KRV A;  5LRJ A;  3VTA A;  1XF1 A;  4PK3 A;  3PB8 X;  3R96 A;  1U6M A;  3VWE A;  4QB9 A;  2FS5 A;  2WYR A;  3TLB A;  4BTF A;  3FEE A;  3R1K A;  1JQG A;  4NF1 A;  4PK2 A;  4CAW A;  3JRU A;  3PB4 X;  3CXP A;  4MY3 A;  4KOR A;  4UBR A;  2AFX A;  2PCN A;  4ZY1 A;  1DIK A;  2CNT A;  2WPX A;  3FMC A;  2B5G A;  1CG2 A;  2F7V A;  4UIB A;  2P6E A;  2PRQ A;  2HUZ A;  4OME A;  1PU9 A;  4FD4 A;  5GCN A;  2YGW A;  1R3N A;  4OC0 A;  1BAV A;  3VRQ A;  2FVG A;  2E28 A;  4G1P A;  1BOB A;  4OP4 A;  4B5O A;  3KKW A;  2VKZ G;  1S7N A;  4JYW A;  3DR8 A;  3IWE A;  3PFE A;  2Z3P A;  4OAD A;  3E0K A;  1Z8W A;  2GIV A;  3TO7 A;  2ZEH A;  4CRZ B;  5HMN A;  3TLA A;  5DS0 A;  1XMT A;  4O23 A;  2J9A A;  3IU2 A;  3HPH E;  3WC5 A;  2ZEL A;  3DSB A;  3O8Z A;  3IGR A;  3HMJ G;  4KUB A;  4COG A;  4F6A A;  3BUW B;  1B6B A;  1ON0 A;  2GLF A;  3PFO A;  1M4I A;  4M3S A;  4PV6 A;  2EWB A;  4OC1 A;  2VI7 A;  4UF4 A;  4CDK A;  3VAT A;  2QJ8 A;  4MFJ A;  2CTB A;  4JD6 A;  2VXK A;  1BLL E;  2FL4 A;  4MRI A;  4BPW B;  3TOB A;  4E0A A;  4CGO A;  2V8V A;  3IIB A;  4FUU A;  2NMT A;  1LOK A;  1QSR A;  1IB1 E;  4CYQ A;  3MGD A;  5AG7 A;  4CYP A;  2HWG A;  4EWT A;  4ZY2 A;  1WK4 A;  3PP9 A;  4MI1 A;  2AFS A;  3B7I A;  3HLP A;  4X5K A;  4F0X A;  5BY0 A;  4UFW A;  3MN8 A;  5JM6 A;  4INJ A;  2PRB A;  1VI4 A;  1YSJ A;  3TT2 A;  3R9F A;  2G3A A;  1XEB A;  1Z9U A;  3PB7 X;  3FYN A;  2NYQ A;  4NSQ A;  3NE7 A;  4HNW B;  5LYI A;  4CAF A;  4CAE A;  1NXJ A;  2AUN A;  4FD6 A;  4OC3 A;  4F8Z A;  3FJU A;  3D66 A;  4BMH A;  1WJT A;  1Q5X A;  4R7M A;  3W91 A;  1M1D A;  2Z3O A;  1S7F A;  3OP0 A;  3QAY A;  2Z11 A;  4H6U A;  4U5Y A;  3T05 A;  3RNZ A;  4PXE A;  3D7H A;  2G3T A;  3KQZ A;  4HNY B;  3TLZ A;  3T5M A;  4RS2 A;  2RC4 A;  4A33 A;  4LUA A;  2QIR A;  2HI6 A;  2CIJ A;  4L8A A;  4UCN A;  2B4D A;  2WSA A;  1IOI A;  2Z3N A;  4ZX9 A;  1P4N A;  1C30 B;  2OOT A;  3T8W A;  4RUH A;  4CZ1 A;  2C27 A;  2ABZ A;  4NGT A;  4NGQ A;  4ZI6 A;  4B14 A;  3FED A;  1ELM P;  2VZZ A;  2ZXV A;  5DWM A;  3SR3 A;  1KEE B;  3TE4 A;  1HDU A;  3CDX A;  3JTK A;  2B3U A;  3K9U A;  4UCM A;  4P4B A;  4XPK A;  3KZW A;  3D2P A;  1RO5 A;  3VRO A;  3RO0 A;  3PT1 A;  2ZEN A;  5KTC A;  4CO9 A;  4LQG A;  4KUA A;  4QVT A;  2AFO A;  4ZBG A;  1H8L A;  1IID A;  2R8V A;  3H8G A;  4KSI A;  4K30 A;  3I3G A;  4DUK A;  4MHZ A;  1LRZ A;  2AFM A;  3PBE A;  4MHY A;  2FIW A;  3KL9 A;  4QUS A;  2EK9 A;  2PDO A;  3BLN A;  3TX8 A;  4CAX A;  1NSA A;  4A38 A;  2PSW A;  1QSN A;  2OU2 A;  4ZX8 A;  4KOV A;  1GYT A;  1MK4 A;  2D4P A;  4KVX A;  3R9G A;  3SI0 A;  3W6S A;  4A94 A;  4TJV A;  3FF3 A;  4AXV A;  4KS9 A;  3SHP A;  5AG4 A;  5HXD A;  2YJV A;  1M4L A;  1M4G A;  2AFW A;  4C2X A;  2P6F A;  3HUV A;  1M44 A;  3TLG A;  2I00 A;  2PJB A;  3LWU A;  1S3Z A;  1YME A;  2PJC A;  4HNX B;  5IR2 A;  3TLY A;  3PRT A;  4E5S A;  2B0A A;  2JBJ A;  2IMO A;  2PJ9 A;  4HKF A;  4C7H A;  4H2K A;  4NJR A;  4DJL A;  1KBL A;  3OAK A;  4CYN A;  5JVL A;  2Q4Z A;  3SXN A;  2FCK A;  1Y9K A;  2FSR A;  4KOW A;  4MBU A;  4X8I A;  1LCP A;  1ZG7 A;  1V0C A;  2DPT A;  4Q7A A;  4DNC A;  1VBG A;  1AUG A;  3GUX A;  4KSA A;  4KZT A;  2JDD A;  4PXB A;  4NGP A;  1Q2C A;  2WZN A;  5F48 A;  1DTD A;  5A28 A;  2FE7 A;  3EXN A;  1I12 A;  3TLE A;  3EC4 A;  5KTA A;  2XPN A;  1TKH A;  2PJ3 A;  3BUM B;  3FNC A;  3SJF A;  4YRH A;  1CX8 A;  2GAN A;  4RI1 A;  2V8G A;  3JUW A;  4CYO A;  3KHZ A;  3IWW A;  2Q04 A;  3EY5 A;  3PB6 X;  5JQ4 A;  4OID A;  3CXS A;  2CNM A;  3A9L A;  4CGN A;  1XF8 A;  5EBV A;  1ARM A;  3B2Y A;  4ZGY B;  1ZLI A;  2HQY A;  2Z10 A;  3FH4 A;  1VHS A;  1YW6 A;  5J3X A;  4R3L A;  4IUS A;  3IWG A;  1R61 A;  5K99 A;  4P4I A;  1S7L A;  5I4M A;  2I3C A;  5HKZ A;  1YVK A;  1F2P A;  2V8D A;  4AVB A;  3FRM A;  1YK3 A;  3BI1 A;  1YLO A;  1CPS A;  2UV8 G;  1K4J A;  1FBV A;  2Q7S A;  4MY0 A;  1XRY A;  1XIX A;  3K9T A;  5LRG A;  2F8H A;  1ZO0 A;  2Y0M A;  4U9Y A;  5HVF A;  2YJT A;  3K4I A;  1Z9E A;  2Y1M A;  1TF8 A;  3F8K A;  2N3A B;  1IIC A;  2CF4 A;  1QQ9 A;  1FNO A;  1KUY A;  1LAM A;  1YRE A;  3FEC A;  3B35 A;  1KZF A;  2XEJ A;  2QEC A;  4MFK A;  2B5G B;  4Y49 C;  4FBE A;  4ZY0 A;  2CY2 A;  1T36 B;  5G22 A;  3EZA A;  4IIY A;  5F1Y A;  2JLM A;  2IJZ A;  4KOU A;  3P2H A;  2QVP A;  4PQA A;  5JH9 A;  3DGV A;  1FY7 A;  2XPL A;  4C68 A;  2A4N A;  2O53 A;  2OB0 A;  4KVO E;  4AG7 A;  4X3R A;  4YWY A;  3BUN B;  3S6F A;  3EZE A;  1Y7R A;  3VGO A;  3ZJ0 A;  1JDB C;  4MJ8 A;  1YLE A;  2GE3 A;  1MJB A;  5CNP A;  2ZW7 A;  4QBJ A;  4C84 A;  2ZEO A;  4P10 A;  4MHP A;  4KOX A;  4F9U A;  4EYS A;  2V77 A;  4UEE A;  4EVY A;  3IEH A;  3DLJ A;  1LAN A;  2XPP A;  2PJ5 A;  4ORF A;  3BUX B;  4KNG E;  4UCP A;  2YND A;  2PC1 A;  3CT9 A;  2VEZ A;  3NA6 A;  4YGO A;  4JXR A;  1XE4 A;  4DYO A;  4BPU B;  3S9N A;  4KOT A;  5AG6 A;  2PJ6 A;  4OC4 A;  2CXA A;  4R8F A;  5THW A;  3D67 A;  3WC7 A;  2HRO A;  3OB1 B;  3FX6 A;  3DNS A;  4JWP A;  4H1H A;  2Y1N A;  4IAV A;  4Q36 A;  4B10 A;  3R9E A;  2C5Q A;  4JZ0 A;  1HEE A;  2XEI A;  1S60 A;  2FXF A;  2WUU A;  4M6I A;  4M6H A;  2PJ8 A;  4ONU A;  4AVC A;  5IB0 A;  2CBL A;  5LYL A;  4E2A A;  1YGH A;  4PXD A;  3PLF B;  5K8P A;  2X0S A;  1OZP A;  1ZG8 A;  3S6G A;  3KQX A;  3KHX A;  1P0H A;  1Y7E A;  2K5T A;  3GY9 A;  2CTC A;  1YR0 A;  3T90 A;  4KSF A;  3JVN A;  5HVH A;  4II9 A;  4B13 A;  1Z8X A;  4UFX A;  4UA3 A;  3TO9 A;  4C99 A;  3RBU A;  3EZB A;  1KWM A;  1VBH A;  1EZB A;  4UEZ A;  4R3K A;  2JEV A;  4MFL A;  1ZLH A;  1IYL A;  4LQ6 A;  4BIN A;  1QSM A;  2BSW A;  2PR8 A;  1Q2D A;  3EO4 A;  3I1U A;  2B4D B;  3QAH A;  4XPL A;  3SI2 A;  4C2Y A;  3WT4 A;  2ARH A;  4R87 A;  4NGN A;  1JDE A;  4J0N A;  4P4J A;  2ZPA A;  5F5X A;  1EZA A;  4MFZ A;  2AJ6 A;  3BXM A;  4MCR A;  4PSW A;  2J8M A;  1KUX A;  4OC2 A;  3H5Z A;  1IU8 A;  3S6H A;  3W6X A;  4CAV A;  3D3S A;  3NH4 A;  2AE6 A;  2EZA A;  3PFV A;  4NJQ A;  3FVL A;  3WAB A;  2EZB A;  3N7Z A;  4TWE A;  4M6G A;  1YQE A;  3NH5 A;  3D68 A;  5J8F A;  3VAR A;  1GHE A;  1NE9 A;  2JBK A;  2HB6 A;  2P0W A;  4H6Z A;  4MHN A;  1YVO A;  2BL1 A;  3B3T A;  4PSX A;  4R76 A;  5K8N A;  1UWY A;  1Y0R A;  2QML A;  2ZEE A;  4KLW A;  1TIQ A;  5F49 A;  2R82 A;  4RR2 B;  2AFZ A;  2VZY A;  2PJ2 A;  2Q4Y A;  4C86 A;  1WWZ A;  3SJG A;  1YW4 A;  3D7D A;  1YX0 A;  2DF5 A;  1Y0Y A;  3VRR A;  4R9M A;  4A95 A;  1DE4 C;  2O28 A;  3WR7 A;  4JJX A;  5I0C A;  2PJ7 A;  5ELY A;  2REE A;  5E96 A;  4C7I A;  1YVH A;  1LFW A;  5CBM A;  2DIK A;  3GYA A;  2Q43 A;  1HDQ A;  3TLG B;  4KLV A;  2FT0 A;  2ZED A;  1CJW A;  2JEW A;  2RFH A;  4TNU A;  1JWQ A;  3SXO A;  3S6K A;  1XFO A;  2B58 A;  1CP7 A;  2P6G A;  3LAC A;  3UY5 A;  4NGS A;  1KUV A;  1RXT A;  4B12 A;  5JGF A;  4M8D A;  4OLL A;  3BJ8 A;  4B5P A;  5HKW A;  2OZH A;  4MI4 A;  2ZW6 A;  4CDJ A;  4P4F A;  3PZJ A;  2BOA A;  2H5M A;  4U9Z A;  4WWV A;  2FM4 A;  2OZG A;  2VL1 A;  2YNC A;  4UWJ A;  4C8T A;  1XBU A;  8CPA A;  2ODF A;  3KR4 A;  3B3W A;  5F47 A;  3TOA A;  5JPH A;  5BWA B;  4XNH C;  2YNE A;  1TKF A;  3CPX A;  2BO9 A;  1J4J A;  4A4C A;  1BXR B;  2OH1 A;  1B87 A;  4C85 A;  3ISZ A;  2G0B A;  4W9Y A;  2WPW A;  1S7K A;  2Z3K A;  3H4Q A;  4Y49 B;  2XEF A;  3F5B A;  3H8E A;  3V38 A;  5ISV A;  4CPA A;  3FIX A;  3I74 A;  4C8U A;  4F0Y A;  2GP4 A;  4P44 A;  1LAP A;  2ZOG A;  1C3O B;  5F13 A;  6CPA A;  1TXR A;  3GB0 A;  2XEG A;  2PQ8 A;  2D0O A;  2DPS A;  2EBJ A;  3QB8 A;  2Q7B A;  1CP6 A;  4NGR A;  5AG5 A;  4A30 A;  5LYF A;  5D29 A;  5KTD A;  2B3V A;  2D0P A;  1XJO A;  2YNC C;  4BD9 A;  2PJ4 A;  4ONW A;  2ZEF A;  4OIW A;  3KR5 A;  4A4B A;  2X7B A;  2GU2 A;  2PJ1 A;  3EFA A;  3BUO B;  2EVN A;  4PXC A;  1AMP A;  4A37 A;  2BUE A;  1Q7L A;  4BBH A;  3QNV A;  5J8C A;  3IJ3 A;  2NSM A;  2VBQ A;  4GM5 A;  4WJB A;  3NOJ A;  3GIU A;  3S9M A;  4F9V A;  2DXQ A;  4P45 A;  3NFQ A;  3H8F A;  3BI0 A;  2ATR A;  1QST A;  3LD2 A;  3VH9 A;  4OAE A;  3I9S A;  3ZZI A;  1Y9Z A;  1QMU A;  1Z8T A;  1KC7 A;  3TYX A;  4UIA A;  3D4U A;  5G1Z A;  3VRN A;  4NGM A;  3NFZ A;  2HV2 A;  2FIA A;  4JXQ A;  4UWI A;  3C8O A;  1ELL P;  3PEI A;  2ANP A;  3CXQ A;  3MRU A;  4MCP A;  1I1D A;  2PIZ A;  4NEX A;  1VIX A;  4GXH A;  3F0A A;  3BJ7 A;  1CM0 A;  4OC5 A;  1B47 A;  4CS0 B;  3C26 A;  5C88 A;  4E94 A;  3F9K C;  3TFY A;  3I6S A;  1BO4 A;  1F2O A;  2B4J C;  1XOV A;  2J8N A;  2VQY A;  3OWC A;  4FD5 A;  4CGL A;  2Z0Z A;  1Y9W A;  1A9X B;  3EIF A;  4C9E A;  4XPD B;  3V7Z A;  2EZC A;  1N71 A;  1RTQ A;  4MFP A;  5K8M A;  4A31 A;  1L0C A;  1Z8L A; 
#chains in the Genus database with same CATH homology
 3BHX A;  4MXU A;  3SJX A;  3PB9 X;  4C8A A;  5LRK A;  3IFE A;  1TKJ A;  2HC9 A;  4K3N A;  1ZG9 A;  3B3V A;  4YN3 A;  3LMS A;  1PYT B;  4C8P A;  3D7F A;  1VHO A;  4MCQ A;  2PJ0 A;  3ICU A;  1Z5R A;  4B6Z A;  4OKO A;  1BPM A;  2C6C A;  2PVW A;  3RZA A;  2AFU A;  5CPA A;  3IO1 A;  4FAI A;  3IC1 A;  2O4H A;  2POK A;  4C9V A;  1XMB A;  3B3S A;  3SJE A;  1V6C A;  1VHE A;  4Z65 A;  1CPX A;  2PIY A;  4UEF A;  1F57 A;  2QYV A;  2V8H A;  1IGB A;  4EME A;  3RAM A;  4TJX A;  3KI9 A;  4YU9 A;  1TF9 A;  3K2K A;  1EE3 P;  4ZYQ A;  2C6P A;  2GLJ A;  4IK2 A;  1R43 A;  2ZEM A;  1AYE A;  5J1Q A;  4C9R A;  1Z2L A;  2C6G A;  3D7G A;  2OR4 A;  3KAS A;  4NFR A;  2ZOF A;  1VGY A;  5HVG A;  4C9A A;  2EK8 A;  3L2N A;  2RB7 A;  5F09 A;  1OBR A;  3GLJ A;  2IQ6 A;  1BPN A;  2DEA A;  3S9L A;  1ARL A;  4P4D A;  2PVV A;  4EFD A;  1FT7 A;  3WC6 A;  3CPA A;  3KGQ A;  4FWU A;  2Q51 A;  2ZEG A;  2PJA A;  5D8N A;  4IHM A;  7CPA A;  4C8F A;  4R6T A;  3B3C A;  4P4E A;  5K8O A;  2BCO A;  4A39 A;  3PBB A;  4MCS A;  3NH8 A;  2C1C A;  5LYD A;  5I4M A;  2G9D A;  3ISX A;  3N5F A;  2GRE A;  3SI1 A;  4C9U A;  4X2T A;  4P6Y A;  2ZEP A;  1WVM A;  2PCU A;  3TC8 A;  1CBX A;  2PE3 A;  4C8C A;  4PPZ A;  4MMO A;  1IY7 A;  1PCA A;  5IB9 A;  5LRJ A;  3VTA A;  1XF1 A;  3PB8 X;  2WYR A;  3FEE A;  1JQG A;  3JRU A;  3PB4 X;  2AFX A;  4ZY1 A;  3FMC A;  1CG2 A;  2F7V A;  4UIB A;  2PRQ A;  4OME A;  1R3N A;  4OC0 A;  1BAV A;  2FVG A;  4G1P A;  4OP4 A;  4JYW A;  3PFE A;  2ZEH A;  5DS0 A;  4O23 A;  2J9A A;  3WC5 A;  2ZEL A;  2GLF A;  3PFO A;  4UF4 A;  2EWB A;  4OC1 A;  4CDK A;  3VAT A;  2QJ8 A;  2CTB A;  1BLL E;  4MRI A;  2V8V A;  3IIB A;  4FUU A;  1LOK A;  4EWT A;  4ZY2 A;  2AFS A;  3B7I A;  3HLP A;  3MN8 A;  5JM6 A;  1YSJ A;  3PB7 X;  2NYQ A;  5LYI A;  4OC3 A;  4F8Z A;  3FJU A;  3D66 A;  4R7M A;  4PXE A;  3D7H A;  3KQZ A;  2CIJ A;  4ZX9 A;  2OOT A;  3T8W A;  4RUH A;  2ABZ A;  4NGT A;  4NGQ A;  4ZI6 A;  3FED A;  1ELM P;  1HDU A;  3CDX A;  4P4B A;  3KZW A;  2ZEN A;  4LQG A;  2AFO A;  1H8L A;  3H8G A;  4KSI A;  4DUK A;  4MHZ A;  2AFM A;  3PBE A;  4MHY A;  3KL9 A;  2EK9 A;  3TX8 A;  1NSA A;  4A38 A;  4ZX8 A;  1GYT A;  3SI0 A;  4TJV A;  4A94 A;  3FF3 A;  4AXV A;  5HXD A;  1M4L A;  2AFW A;  3HUV A;  2PJB A;  3LWU A;  1YME A;  2PJC A;  5IR2 A;  3PRT A;  2JBJ A;  2IMO A;  2PJ9 A;  4H2K A;  4NJR A;  4DJL A;  2Q4Z A;  4X8I A;  1LCP A;  1ZG7 A;  4Q7A A;  3GUX A;  4PXB A;  4NGP A;  2WZN A;  1DTD A;  1TKH A;  2PJ3 A;  3SJF A;  1CX8 A;  2V8G A;  3KHZ A;  3IWW A;  3PB6 X;  4OID A;  1ARM A;  3B2Y A;  1ZLI A;  3FH4 A;  1YW6 A;  4P4I A;  2I3C A;  1F2P A;  2V8D A;  3BI1 A;  1YLO A;  1CPS A;  1XRY A;  3K9T A;  5LRG A;  2F8H A;  5HVF A;  1TF8 A;  2CF4 A;  1QQ9 A;  1FNO A;  1LAM A;  3FEC A;  3B35 A;  4FBE A;  2XEJ A;  4ZY0 A;  2IJZ A;  2QVP A;  4PQA A;  5JH9 A;  3DGV A;  2O53 A;  4X3R A;  4YWY A;  4C84 A;  2ZEO A;  4P10 A;  4MHP A;  4F9U A;  2V77 A;  4UEE A;  3IEH A;  3DLJ A;  1LAN A;  2PJ5 A;  4KNG E;  3CT9 A;  3NA6 A;  4DYO A;  3S9N A;  2PJ6 A;  4OC4 A;  4R8F A;  5THW A;  3D67 A;  3WC7 A;  3FX6 A;  4IAV A;  2C5Q A;  4JZ0 A;  1HEE A;  2XEI A;  2PJ8 A;  5LYL A;  4PXD A;  5K8P A;  1ZG8 A;  3KQX A;  3KHX A;  1Y7E A;  2CTC A;  5HVH A;  4C99 A;  3RBU A;  1KWM A;  4UEZ A;  1ZLH A;  3I1U A;  3SI2 A;  3WT4 A;  4NGN A;  4P4J A;  3BXM A;  4MCR A;  4OC2 A;  3NH4 A;  4NJQ A;  3FVL A;  3WAB A;  4TWE A;  3NH5 A;  3D68 A;  3VAR A;  2JBK A;  2HB6 A;  4MHN A;  3B3T A;  4R76 A;  5K8N A;  1UWY A;  1Y0R A;  2ZEE A;  2AFZ A;  2PJ2 A;  4C86 A;  1YW4 A;  3SJG A;  3D7D A;  1Y0Y A;  1DE4 C;  2PJ7 A;  5ELY A;  1LFW A;  5CBM A;  2Q43 A;  1HDQ A;  2ZED A;  2JEW A;  2RFH A;  4TNU A;  1XFO A;  1CP7 A;  4NGS A;  5JGF A;  4CDJ A;  4P4F A;  2BOA A;  4WWV A;  2VL1 A;  4C8T A;  1XBU A;  8CPA A;  3KR4 A;  3B3W A;  1TKF A;  3CPX A;  2BO9 A;  4C85 A;  3ISZ A;  4W9Y A;  2XEF A;  3H8E A;  3V38 A;  4C8U A;  4CPA A;  3I74 A;  2GP4 A;  4P44 A;  1LAP A;  2ZOG A;  6CPA A;  1TXR A;  3GB0 A;  2XEG A;  1CP6 A;  4NGR A;  5LYF A;  5D29 A;  1XJO A;  4BD9 A;  2PJ4 A;  4ONW A;  2ZEF A;  4OIW A;  3KR5 A;  2GU2 A;  2PJ1 A;  4PXC A;  1AMP A;  4A37 A;  1Q7L A;  3QNV A;  3IJ3 A;  2NSM A;  4GM5 A;  4WJB A;  3S9M A;  4F9V A;  4P45 A;  3H8F A;  3BI0 A;  3VH9 A;  1Y9Z A;  1QMU A;  4UIA A;  3D4U A;  4NGM A;  3NFZ A;  1ELL P;  3PEI A;  2ANP A;  3MRU A;  4MCP A;  2PIZ A;  1VIX A;  4OC5 A;  3I6S A;  1F2O A;  4C9E A;  3EIF A;  3V7Z A;  5K8M A;  1RTQ A;  1Z8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...