3HPHE

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
89
Chain Sequence
MDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVSVLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
molecule tags Transferase
total genus 28
structure length 89
sequence length 93
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3hphE00
2XPOA 2XPPA 2XPLA 2XPNA 1Z9EA 3HPGG 2N3AB 1EO0A 3F9KC 3OAKA 1WJTA 2B4JC 3U88C 3NFQA 3HPHE 3O8ZA
chains in the Genus database with same CATH superfamily
1FBVA 3BXMA 3HPGG 4NGTA 3OAKA 3VRNA 3IWWA 4OC0A 1EO0A 3PLFB 4P4EA 2JBJA 4BTFA 3D7FA 4JYWA 3FEEA 3D7HA 2XPLA 4P4DA 2XEGA 1B47A 3OP0A 3PT1A 4BPUB 4BPXB 4MCPA 2PVWA 3BHXA 5AXIA 4P4IA 2Y1MA 3NFQA 4P4FA 2C6GA 4P45A 4BPWB 3F9KC 1WJTA 2OOTA 4A4CA 2PVVA 2CBLA 4X3RA 5J3XA 5ELYA 3SJGA 1CX8A 4NGNA 5HKZA 3D7DA 3VGOA 3BUXB 3FECA 3S9MA 3VRQA 2C6CA 4MCRA 3VRRA 3U88C 3BI0A 5HKYA 3SJXA 3BI1A 3BUNB 4A4BA 2XEJA 2B4JC 1YVHA 3HMJG 3FEDA 3BUOB 2XEFA 4OMEA 3S9LA 5HKWA 5F09A 4NGSA 4MCQA 4OC2A 3RBUA 5F13A 4JZ0A 4OC4A 4OC1A 2VKZG 3SJFA 4NGMA 4GPLB 2XPOA 2XPPA 4P4BA 4W9YA 4P44A 1Z9EA 3OB1B 4NGQA 5BY0A 3ZNIA 4P4JA 1DE4C 2JBKA 3VRPA 2DLAA 4OC3A 3PFVA 3S9NA 3D7GA 2N3AB 3KASA 5D29A 2Y1NA 3BUWB 3HPHE 4MCSA 4RR2B 2C6PA 2XPNA 4NGRA 4NGPA 3FF3A 3BUMB 4LQGA 2CIJA 2XEIA 3VROA 2OR4A 3O8ZA 2UV8G 3SJEA 3OB2B 1Z8LA 4OC5A
chains in the Genus database with same CATH topology
2XPOA 2XPPA 2XPLA 2XPNA 1Z9EA 3HPGG 2N3AB 1EO0A 3F9KC 3OAKA 1WJTA 2B4JC 3U88C 3NFQA 3HPHE 3O8ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPO A;  2XPP A;  2XPL A;  2XPN A;  1Z9E A;  3HPG G;  2N3A B;  1EO0 A;  3F9K C;  3OAK A;  1WJT A;  2B4J C;  3U88 C;  3NFQ A;  3HPH E;  3O8Z A; 
#chains in the Genus database with same CATH topology
 1FBV A;  3BXM A;  3HPG G;  4NGT A;  3OAK A;  3VRN A;  3IWW A;  4OC0 A;  1EO0 A;  3PLF B;  4P4E A;  2JBJ A;  4BTF A;  3D7F A;  4JYW A;  3FEE A;  3D7H A;  2XPL A;  4P4D A;  2XEG A;  1B47 A;  3OP0 A;  3PT1 A;  4BPU B;  4BPX B;  4MCP A;  2PVW A;  3BHX A;  5AXI A;  4P4I A;  2Y1M A;  3NFQ A;  4P4F A;  2C6G A;  4P45 A;  4BPW B;  3F9K C;  1WJT A;  2OOT A;  4A4C A;  2PVV A;  2CBL A;  4X3R A;  5J3X A;  5ELY A;  3SJG A;  1CX8 A;  4NGN A;  5HKZ A;  3D7D A;  3VGO A;  3BUX B;  3FEC A;  3S9M A;  3VRQ A;  2C6C A;  4MCR A;  3VRR A;  3U88 C;  3BI0 A;  5HKY A;  3SJX A;  3BI1 A;  3BUN B;  4A4B A;  2XEJ A;  2B4J C;  1YVH A;  3HMJ G;  3FED A;  3BUO B;  2XEF A;  4OME A;  3S9L A;  5HKW A;  5F09 A;  4NGS A;  4MCQ A;  4OC2 A;  3RBU A;  5F13 A;  4JZ0 A;  4OC4 A;  4OC1 A;  2VKZ G;  3SJF A;  4NGM A;  4GPL B;  2XPO A;  2XPP A;  4P4B A;  4W9Y A;  4P44 A;  1Z9E A;  3OB1 B;  4NGQ A;  5BY0 A;  3ZNI A;  4P4J A;  1DE4 C;  2JBK A;  3VRP A;  2DLA A;  4OC3 A;  3PFV A;  3S9N A;  3D7G A;  2N3A B;  3KAS A;  5D29 A;  2Y1N A;  3BUW B;  3HPH E;  4MCS A;  4RR2 B;  2C6P A;  2XPN A;  4NGR A;  4NGP A;  3FF3 A;  3BUM B;  4LQG A;  2CIJ A;  2XEI A;  3VRO A;  2OR4 A;  3O8Z A;  2UV8 G;  3SJE A;  3OB2 B;  1Z8L A;  4OC5 A; 
#chains in the Genus database with same CATH homology
 2XPO A;  2XPP A;  2XPL A;  2XPN A;  1Z9E A;  3HPG G;  2N3A B;  1EO0 A;  3F9K C;  3OAK A;  1WJT A;  2B4J C;  3U88 C;  3NFQ A;  3HPH E;  3O8Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...