3HPHE

Closed tetramer of visna virus integrase (residues 1-219) in complex with ledgf ibd
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
93
structure length
89
Chain Sequence
MDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVSVLEVLF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Integrase
publication title Structural basis for functional tetramerization of lentiviral integrase
pubmed doi rcsb
source organism Maedi visna virus
total genus 28
structure length 89
sequence length 93
chains with identical sequence F, G, H
ec nomenclature
pdb deposition date 2009-06-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3hphE00
3F9KC 3U88C 1WJTA 3HPGG 3OAKA 3HPHE 3NFQA 1EO0A 2B4JC 2N3AB 1Z9EA 3O8ZA 2XPNA 2XPLA 2XPOA 2XPPA
chains in the Genus database with same CATH superfamily
3IWWA 4NGMA 3VRPA 4W9YA 3PLFB 4P4BA 3BUWB 3D7FA 2XPPA 3FECA 3U88C 3RBUA 4X3RA 2Y1MA 3FEEA 3S9MA 2XEFA 3OP0A 4P45A 2C6GA 1CX8A 2N3AB 4NGSA 3BHXA 4OC2A 4RR2B 3OAKA 5AXIA 2C6CA 3NFQA 3HMJG 4P44A 4NGNA 3VGOA 4OC4A 4BPUB 2Y1NA 3VROA 4A4BA 4MCPA 3HPHE 5HKZA 3VRRA 5BY0A 4OC3A 3BUMB 2VKZG 4MCSA 5D29A 1DE4C 2OOTA 3VRNA 3D7DA 4BPWB 1WJTA 4A4CA 3KASA 4NGTA 4P4JA 4OC1A 3S9LA 2XPNA 4MCQA 4BTFA 5HKWA 4JZ0A 2CBLA 3SJEA 3FF3A 4OC5A 4OC0A 2XEIA 3S9NA 2C6PA 4P4EA 2B4JC 5ELYA 1B47A 4P4FA 3SJXA 3PFVA 4NGRA 4GPLB 5HKYA 3F9KC 3HPGG 3SJGA 2JBKA 3VRQA 3BI0A 4LQGA 4P4DA 2XPOA 3D7HA 2XPLA 3D7GA 2CIJA 3BUXB 1FBVA 3PT1A 2XEGA 4OMEA 3SJFA 2PVWA 3ZNIA 3BUNB 2PVVA 3BUOB 4BPXB 2OR4A 5F13A 3OB1B 2JBJA 3BI1A 1EO0A 3O8ZA 3FEDA 4JYWA 5F09A 4MCRA 1Z8LA 2DLAA 3BXMA 5J3XA 4NGPA 1YVHA 4NGQA 1Z9EA 3OB2B 4P4IA 2XEJA 2UV8G
chains in the Genus database with same CATH topology
3F9KC 3U88C 1WJTA 3HPGG 3OAKA 3HPHE 3NFQA 1EO0A 2B4JC 2N3AB 1Z9EA 3O8ZA 2XPNA 2XPLA 2XPOA 2XPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F9K C;  3U88 C;  1WJT A;  3HPG G;  3OAK A;  3HPH E;  3NFQ A;  1EO0 A;  2B4J C;  2N3A B;  1Z9E A;  3O8Z A;  2XPN A;  2XPL A;  2XPO A;  2XPP A; 
#chains in the Genus database with same CATH topology
 3IWW A;  4NGM A;  3VRP A;  4W9Y A;  3PLF B;  4P4B A;  3BUW B;  3D7F A;  2XPP A;  3FEC A;  3U88 C;  3RBU A;  4X3R A;  2Y1M A;  3FEE A;  3S9M A;  2XEF A;  3OP0 A;  4P45 A;  2C6G A;  1CX8 A;  2N3A B;  4NGS A;  3BHX A;  4OC2 A;  4RR2 B;  3OAK A;  5AXI A;  2C6C A;  3NFQ A;  3HMJ G;  4P44 A;  4NGN A;  3VGO A;  4OC4 A;  4BPU B;  2Y1N A;  3VRO A;  4A4B A;  4MCP A;  3HPH E;  5HKZ A;  3VRR A;  5BY0 A;  4OC3 A;  3BUM B;  2VKZ G;  4MCS A;  5D29 A;  1DE4 C;  2OOT A;  3VRN A;  3D7D A;  4BPW B;  1WJT A;  4A4C A;  3KAS A;  4NGT A;  4P4J A;  4OC1 A;  3S9L A;  2XPN A;  4MCQ A;  4BTF A;  5HKW A;  4JZ0 A;  2CBL A;  3SJE A;  3FF3 A;  4OC5 A;  4OC0 A;  2XEI A;  3S9N A;  2C6P A;  4P4E A;  2B4J C;  5ELY A;  1B47 A;  4P4F A;  3SJX A;  3PFV A;  4NGR A;  4GPL B;  5HKY A;  3F9K C;  3HPG G;  3SJG A;  2JBK A;  3VRQ A;  3BI0 A;  4LQG A;  4P4D A;  2XPO A;  3D7H A;  2XPL A;  3D7G A;  2CIJ A;  3BUX B;  1FBV A;  3PT1 A;  2XEG A;  4OME A;  3SJF A;  2PVW A;  3ZNI A;  3BUN B;  2PVV A;  3BUO B;  4BPX B;  2OR4 A;  5F13 A;  3OB1 B;  2JBJ A;  3BI1 A;  1EO0 A;  3O8Z A;  3FED A;  4JYW A;  5F09 A;  4MCR A;  1Z8L A;  2DLA A;  3BXM A;  5J3X A;  4NGP A;  1YVH A;  4NGQ A;  1Z9E A;  3OB2 B;  4P4I A;  2XEJ A;  2UV8 G; 
#chains in the Genus database with same CATH homology
 3F9K C;  3U88 C;  1WJT A;  3HPG G;  3OAK A;  3HPH E;  3NFQ A;  1EO0 A;  2B4J C;  2N3A B;  1Z9E A;  3O8Z A;  2XPN A;  2XPL A;  2XPO A;  2XPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...