3NFQA

Crystal structure of the conserved central domain of yeast spn1/iws1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcription factor IWS1
publication title The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nfqA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3nfqA02
1X8YA 2E43A 2R5DA 1HJBA 5AVZB 1MFZA 1HUCA 2Q7CA 4JYBA 2IPPA 5APVA 2N3AB 5AVQB 1JUNA 4HYTB 2WWWA 3M9HA 3HPHE 4AUWA 3M9BA 5AW1B 5AVWB 3VMXA 5AW7B 3P8MC 1Z9EA 1WJTA 3A7OA 2Q3IA 3IR9A 2XPNA 2JJLA 5APWA 3U88C 1T2KD 5AVVB 4I2LC 5CMZA 2P67A 2W6AA 2WPRA 5AVUB 2Z5HA 2VRSA 1SLQA 2XV5A 1T2KC 2XPPA 3M06A 2YO2A 1NWQA 5AW2B 3A5TA 5AVYB 3P7KA 1YYCA 4GT1A 1GK4A 5AVXB 1CZQA 3HE4B 1S9KE 2QM7A 2WPSA 3HE4A 5AW4B 1GZLA 5AVRB 2W27A 5AW9B 1GD2E 3KQGA 3M0AA 2Z5IA 2C9NY 2R5BA 4M3LA 3TYYA 5AVTB 1OXZA 2KP8A 4B86A 3M91A 4C46A 4AQRD 1OWAA 1NAFA 4I6MC 5APSA 3TK1A 5APTA 3VYIA 4XE5B 3MGNA 5AW5B 4GKGA 2E42A 2P7JA 3P32A 1A02F 1MUUA 2P2UA 1HWTC 3VTPC 3VN0A 5APYA 3NXSA 3HPGG 1FAVA 2XU6A 1FOSF 1MV8A 2YNYA 2R3CA 1A02J 4DZOA 1KQLA 1SP4A 5AVSB 3V4QA 5APQA 2WT7B 2Q5UA 3VMYA 1FOSE 2C9LY 2WT7A 4RESB 3L36A 3SWFA 2ZXEB 3LIEA 1H89A 1CSBA 1GK6A 2YO3A 5AW8B 2BASA 3V4WA 3T97A 3A3YB 3L35A 1GTWA 1J2JB 4LC1A 3MD0A 3HTKA 5AW3B 2WPQA 3L37A 3NMDA 1IO4A 3KDPB 3VMZA 2R32A 3O8ZA 3NTNA 4EOTA 3B8EB 3OAKA 4AYCA 2H7HA 1H8AA 4KHXA 5AW0B 4C7NB 5APUA 2QM8A 1GU4A 3A2AA 1GU5A 2ZFCA 4C7NA 3HE5B 3M0DA 3UIAA 3TNUB 2XPOA 3HE5A 5APXA 2XZRA 3V5BA 3TNUA 5AW6B 1JNMA 3F9KC 1S9KD 3LIDA 3NFQA 1H88A 1HBWA 1CI6B 4JYCA 2XPLA 1DH3A 2WTYA 1EO0A 1CI6A 1G2CB 2B4JC 2N9BA 3I5CA
chains in the Genus database with same CATH superfamily
2OYIC 4OC5A 1R8EA 1AVOA 4WY4C 2KSJA 1PL5A 3HUSB 1IK9A 1M1JB 2PFXA 3K5BA 2N1TC 1FJPA 1NO4A 1FZCA 2JEEA 3G3ZA 2JWAA 2M5AA 2YKQA 4U3FJ 1NWQA 5KLVK 3R2PA 2Z5IA 3CXHI 5KLVG 3E7KA 3CXHE 3F89A 4ZMDA 2A45G 1JY2N 5B5EH 1SQXE 3CX5D 1W2BO 1U7MA 3G6EP 2Y9YA 2XU6A 2WSFH 1SQVD 3AE1C 3HMJG 2H43A 2D2CB 1VQPP 4JQ0D 2XEJA 3T97B 1U57A 4UB8H 3B5NB 1KB9E 2ZAEB 4LC1A 3RK3C 3KYQA 4N3YB 4MCPA 3SJGA 1YVHA 2IYPA 2OQQA 5APUA 1DEBA 1KILB 1ZLLA 2K88A 2ZT9B 2Y0EA 3EWKA 1ZXGA 2E5YA 3LIDA 4WB4A 4A4CA 1NTZK 1CI6B 1NTZG 1YJNP 3BHXA 4U7JA 2OYIB 1K73Q 4WY4B 5KLVD 1BCCE 4OC4A 1L4AB 1Y9BA 2N1TB 1PPJE 5HKWA 3ITKA 1S2EA 5APWA 1YJWP 2XV5A 1JCCA 2OYHC 3BASA 3P7KA 1FZGA 3IWWA 1CZQA 3WU2E 5AW4B 1VQ5P 3Q5RA 1KN7A 1KYOD 1LWUC 1FBVA 2KP8A 5CCGD 5HKZA 4AQRD 1SFCD 5GTHH 1L0LK 4H0LD 1L0LG 1FDOA 1Z56A 5KAIE 3L74E 3HPGG 3BCCJ 1NTME 1K8AQ 1EXIA 3CCEP 3VROA 2GM4A 2AEMA 1NTZD 4MCSA 1Q2NA 3HTKB 3MD0A 3S1KA 1VQ9P 3RK3B 5TJHA 3L4FA 2C6PA 2OTLP 1VQ6P 2GUSA 3M0DA 2C0WA 3AEBC 3L70E 3NFQA 3MUDA 4U3FG 2B88A 1HJBA 4PD4D 2Q7CA 1FDIA 1PIXA 1FZCC 1RE4A 3CC4P 1OVUA 1FS0E 1NH4A 1DX7A 1WJTA 3CD6P 1L0LD 3P8CD 1OMIA 2W6AA 2Z5HA 1E5WA 1HGZA 3M06A 2OYHB 2FKWB 3VP8A 3WUVA 1GL2D 5HKYA 4OMEA 1LWUB 1QEXA 2C6CA 3D71A 1JY2P 2K3RA 2YKPA 1PGJA 1IFIA 4NPFX 4DZOA 1RQUA 2JWDA 1S1CX 2B87A 5K5GB 2E5TA 2WZ7A 1VQ7P 1CSBA 2BASA 1NJIQ 3S9MA 4U3FD 3FXDA 3AE9C 3V4WA 2HPCA 1R5SA 1SQPJ 2CPSA 3L73E 3SWYA 1KQSO 1YTZT 3CXHH 3H1JE 3N7NA 2H7HA 2YIUC 3RL0C 1OFCX 3TNUB 2XPOA 3CWBJ 1NTKE 5AW6B 4P4IA 2IBZI 2XPLA 3EQ2A 4PV1D 3GHGC 1A02J 1SQQJ 5AVZB 1QVGO 3CCRP 3SJEA 1L0NJ 5KTBA 4HYTB 3IN6A 2I1KA 5B66E 1FZCB 3D7FA 2J59M 3PT1A 1KB9H 1T2KD 4EDFA 2M5AB 1RHZB 3CCJP 5B5EE 1NU1J 3HRNA 2LXCB 3AE3C 1YYCA 4IOIH 3V2QA 1JB0J 2WSFJ 4JPZB 2WPSA 4N78E 3BCCG 2YMKA 2DLAA 2VKZG 2JDIH 4M3LA 1GL2C 3TYYA 4I6MC 1E79H 1HGVA 2YXQB 3B71A 2M3BA 4GIFA 2E42A 3P32A 3H1IE 3MZWB 2O1KA 1DIPA 2BCCE 3H6PA 3CX5I 3PJSK 3AEEC 3BUMB 5TISH 1H89A 3CMAP 1PP9J 1OZHA 3PHLA 3V6IA 2QEXP 4A7PA 3GW6A 3WU2H 3WUTA 5KAFE 3Q5PA 1OIPA 1NYHA 4BWNA 4XA4A 3M0DC 2D2CD 2C0XA 1GU4A 1KD1Q 4H44C 3VMAA 3I56P 2QA4P 1KC8Q 3RL0B 5BU8B 1RH5B 3B5ND 3D6ZA 2WMMA 3L72E 1OVVA 3I5CA 3BCCD 3GHGB 1LJ2A 1RE4C 2IPPA 3FXEA 2ZT9D 4P45A 3OB1B 3I55P 5AVVB 5CMZA 2P67A 2WPRA 1EQ7A 2FYUE 1T2KC 3AEDC 1URQA 1T6AA 2K9YA 2QM7A 3CCLP 1QL2A 2C9NY 1L4AD 1GL2B 3O6QA 3FF3A 4C46A 1AV1A 1SQPK 1KYOI 2PP6A 1ZV8A 1SQPG 1EZVE 2FY8A 3VTPC 3CCQP 3H1LJ 2YNYA 2B89A 3QWOC 1VQNP 2CPBA 2PRRA 1U7JA 3SWFA 2HYNA 2LR2A 2W6BA 3CWBG 2O01N 2PVWA 1NHLA 1SQQK 2FXPA 4YTPC 1L0NK 1SQQG 3M9QA 2J58A 3D70A 1L0NG 3NMDA 4LQGA 3O8ZA 1USEA 3TGUJ 2QM8A 1WT6A 2D2CC 1YI2P 3Q1MA 4P4DA 4H44B 1NU1K 3F9KC 3H32A 1NU1G 3VRQA 1X8YA 3AEAC 1BE3J 2W6JH 1WMKA 4LLHA 3BI1A 4AUWA 4D6TJ 1YJ9P 4PD4I 2YXRB 2QE7H 4GOFA 4KJMA 1LNQA 1SQPD 1RF0C 3H1KE 2VRSA 5GTIE 4OC0A 1S4XA 1JY3N 1BSHA 3CWBD 1L4AC 1FBMA 4DJGA 1PP9G 3CCMP 1NAFA 1SQQD 3MGNA 1Q81Q 1L0ND 2O3JA 5B66H 2R3CA 5KJ7A 4NPEA 5AVSB 3SFDC 3V4QA 1SQXJ 2JKVA 4RESB 4QMAA 5J3XA 1XTGB 1NU1D 2HPCB 4JZ0A 3L35A 2XNXA 1FZBA 2ZVNB 2NRGA 5AW3B 2WPQA 1VQ4P 3MTUE 1NKZB 4DOJA 3BUOB 1OX3A 4MCQA 2Z4EA 1WRGA 4R4MA 4ZKPA 3BRTB 3CLQA 1S9KD 3PLNA 3S9OA 2JR8A 1LTGC 3GMAA 1EO0A 2B4JC 4BTFA 1N7SA 3LW5J 3AEFC 3V2RA 4JYBA 1PP9D 3VOPA 2YMYA 3H1HE 2QVAA 2I8DA 1ZMEC 2KI7B 3S9LA 5L8RJ 5KAFH 3U1CA 3AECC 1X22A 1URQC 1BCCJ 2OTKE 1RQVA 2AEJA 4XFJA 1GK4A 4RJTA 2Y1MA 3H1LG 1N86A 1PGOA 2H88C 1PZQA 3OB2B 3TDKA 3FEDA 1OWAA 2QG4A 5TISE 2WSEH 4XE5B 2HODB 2XEGA 3V2PA 5CCHA 1UIIA 1BGYE 3HD7A 1MV8A 3TGUG 1GDTA 3CPWO 1FOSE 2IX7C 3CCUP 3VGOA 2WT7A 1OVRA 1L2PA 1EDIA 1KORA 1BSNA 4EI2A 3L74J 1X9VA 2XDJA 5CJ4A 1YHQP 1BE3G 1NTMJ 5BU5A 4GODA 3C9IA 4NGSA 2WSCH 2A06G 1QLED 2HLOA 2KSEA 1FZFA 4D6TG 2AEFA 1YQ3C 2K9JA 3V5BA 2OR4A 1KYOH 1N7SD 1R5LA 1Y8AA 1JNMA 1Q82Q 1Q7YQ 3EFGA 2N9BA 3H1LD 3JCUE 4NGNA 2QJPC 2Y9ZA 1HUCA 1SQBE 2KZIA 1NOHA 2ZJSE 3RL0D 1PGPA 3L70J 3L75E 2WSSH 2Q3IA 2O01H 5H2FE 2JJLA 4RO0A 3AE7C 3TGUD 3A5TA 2POHA 3MP7B 1URQB 1GW4A 1SQXK 2W8ZA 1SQXG 2BEQD 2QIWA 4OC1A 1JY3P 1T3UA 4MN4C 4NGTA 3KASA 2KLUA 1BE3D 3H25A 2FYZA 2IFNA 2MJZA 1KTMA 1ZRTE 3VN0A 5KJ7C 2A06D 4D6TD 3KZIH 3WMM0 1KQLA 2DW3A 3V2NA 4PD4H 4N6JA 4WBAA 1AQ5A 3RK2B 4RR2B 2PVVA 3BUXB 5GTIH 2Q3EA 1DD3A 4W9YA 1N7LA 1VQKP 1FZAA 1RY3A 3HUSA 3AE8C 3NTNA 3SWKA 4C7RA 2JP3A 3H32B 4OC2A 1N7SC 4Y99C 3L73J 1N73A 1IFDA 3CXHD 3H1JJ 1BCCG 2PAJA 2E43A 3MHVA 1SQXD 2QJPB 2W83C 3BUNB 1PPJG 2N3AB 1RE3A 1P84I 4NGRA 1P84E 1NTKJ 1IFMA 4H44D 2B9BA 3CC7P 2RKLA 1EC5A 4L74A 2KZJA 1BDCA 2XPNA 4LGDE 2AXCA 1S5LH 1M57D 2IBZE 3F5HA 2FFDA 1SLQA 2HFED 1IK7A 4GT1A 1GW3A 2OYOA 5AVXB 2NPSA 3TF5A 1PFIA 3HE4A 1GZLA 1GD2E 3M0AA 1KB9D 1OW7A 2KLVA 3ABVC 5APSA 5APTA 3L74G 1NTMK 5CCHC 1NAYA 3PP5A 3CMEP 1NTMG 3HD7C 5APYA 3L71J 1FE6A 3VMYA 4BXLA 3L71E 3B4SA 4A4BA 3H1IJ 3CC2P 3KHUA 2KIKA 1BCCD 3C1LA 2BCCJ 2OTJP 1LTBC 1PPJD 3VRNA 4WY4A 3G4SP 3CX5E 3B8EB 3OAKA 4AYCA 3L70G 3A2AA 3UIAA 1IC2A 2M0BA 4TT3H 2QRXA 1SQVE 4JYCA 2N9YB 1N7SB 1JMBA 2KS1A 4Y99B 2UWJE 4DCKA 2E75C 3IAOA 4YPCA 5M1BA 3HPHE 3A0BH 5AW1B 3VMXA 3L74D 1VF5D 3PFVA 3L72J 1G1IA 2WSEJ 3MUDC 4P4FA 4UB6E 1NTMD 5E79H 2NPSD 2XPPA 4IFMA 4OWFA 2K1AA 3D7GA 1EXJA 1HTLC 1LT9A 1K05A 3OW2O 3KPEA 2W27A 3MIWA 1FC2C 1FU1A 2FYUJ 1TU3F 5KLVE 4P4JA 3JCUH 3D6YA 2A45I 2CBLA 4W7YA 3ZDMA 1LTSC 1IFPA 3L75D 2P2UA 1HWTC 1ZOYC 3HD7B 2IYOA 1IFJA 3G9RA 3L70D 2WSCJ 2L91A 2WT7B 3U59A 2Q5UA 5H2FH 1AFOA 2XNDH 3FWLA 2QJYC 2KYVA 3L73G 3IFMA 3H1JG 2WITA 1KYOE 2J5UA 5CBNA 1KMIZ 1NTKK 4IL6H 1IO4A 1HVVA 1NTKG 1JY2O 3G71P 3OA7A 2K9JB 2NZ2A 4ASVA 2O01J 1N73C 2WPVB 3U1AA 5C39A 2YKOA 2WTYA 3QH9A 1G1JA 5D29A 3SJXA 2CK3H 4PJ0E 3EFFK 2E75B 1NTZE 5AVQB 1AVYA 1RF1A 1JUNA 3M9HA 1ZN5A 3D7DA 2KXPB 1GMJA 1LT1A 3BRVB 2FFDC 1VF5C 2C6GA 4BPUB 1JCDA 3RBXA 1J1EC 4WWIA 2NPSC 3RBUA 1JM0A 1YTZI 3L71G 3FX0A 4JBZA 2XKMA 5AVRB 5AW9B 2KB7P 1OXZA 3KZIE 4O9BA 1PV3A 3FGAD 3H1KJ 3H1IG 3L73D 2JBKA 4PD4E 3H1JD 1MKMA 2BCCG 2OOTA 1URQD 3FECA 2LKMA 1CX8A 1NTKD 3NXSA 1P84H 1FAVA 1L0LE 5CBOA 3P8CE 5F13A 1X0TA 2FYNC 3CL3D 2ZXEB 3Q2YA 2BEZF 2M3EA 3PH0A 2QJYB 1DEEG 1LTAC 1S72P 1USDA 2B87B 2P1JA 1VQOP 2E74D 4H13D 1QVFO 2E76B 3RK2D 3E1IA 3L72G 3HE5A 2IZ0A 4N78D 4OGQC 1KQFB 1N73B 3L71D 2R5DA 1S5LE 5EFWB 1MFZA 1LTJA 3GF7A 3AEGC 1IJDB 1H0TA 4U3FE 2PGDA 2KOGA 2WWWA 2FYUK 3H1ID 2Y0DA 2V7QH 5ELYA 3M9BA 2BCCD 2FYUG 3A7OA 2W90A 3IR9A 5CCGA 3U88C 2FFDB 1VF5B 3CCVP 3IF4A 2OARA 3SFEC 1SFCA 1J1EB 1LT9C 3CX5H 3CCSP 2NPSB 4DT0A 3HE4B 3H1HJ 2UV8G 2R5BA 1N2DC 5AVTB 3OP0A 1Y47A 5KLIC 1M90Q 1EZVG 1VDFA 2LXBA 2RMZA 1KB9I 1FJKA 2WVRA 2ZYAA 3WUUA 4EYYQ 1MUUA 3GG2A 1Q86Q 2HR3A 2RN0A 2RH0A 1PGQA 2KNCA 1SP4A 3L72D 4ASWA 2FYNB 3RBZA 4UB6H 4ZKUA 3A3YB 1HJ0A 1GTWA 2G8YA 1EDKA 2FBWC 1BGYJ 1ZR2A 5KJ7D 1KZUB 3GHGA 1JTHA 1DD4A 3KDPB 1M56D 2L5GB 5AW0B 2XEFA 2I1JA 1JEKA 2FYUD 4C7NA 2E74C 4H13C 3RK2C 1OW6A 2A45H 4W80A 3A0BE 4BRYA 2KS1B 4OGQB 1KQGB 5E79E 3W68A 1RF1C 1UIXA 4L75A 4BPWB 1EZVD 3H1KG 5AVWB 1MFTA 1GL2A 2IDBA 1ZP0C 4OC3A 3A0HE 3BXMA 4P4BA 1SQBJ 5F09A 4P4EA 5CHXA 1LT9B 2AXTE 3L75J 2ZXXA 4NGMA 3JC22 1M1KQ 3M91A 3BCCE 1AA0A 3GF3A 4OH8B 1FZEA 5KLIB 1KILE 2JO1A 3D7HA 2P7JA 1SVFA 4PJ0H 2QSIA 3Q5SA 4IL6E 4GDOA 2C9LY 3BATA 3O6QB 2YO3A 1NKNA 5CCHD 1LGHB 3HD7D 3USSA 1X79B 3VMZA 4L73A 3H1KD 1HF9A 1LP1A 2XZRA 2E74B 4H13B 1MZ9A 1H88A 3VRRA 2Q9IA 1LTJC 1G2CA 1B47A 1ZW0A 4L76A 5BVZA 2P58A 1RF1B 3H1HG 1W2EA 1YITP 1D7MA 1M1JA 4I7ZC 4KT0J 2ZYDA 5AW7B 3P8MC 5CCGC 1YBKA 2JBJA 2WQYC 1SFCC 2XEIA 3S9NA 4I2LC 3SJFA 1Q90D 4H0LC 2YO2A 5AW2B 5AVYB 2E75D 3W67A 1VQLP 2HG5D 2OGUA 4YXWH 4IFFA 3RK3E 1W5CE 2KUBA 4HH2A 4K35A 1BGYG 4GOEA 1T8ZA 4GPLB 3FWNA 4P44A 1FOSF 2ZVOB 1JO5A 1SQPE 2ITAA 4TLFA 3L36A 3T97A 1J1DC 2FXMA 3CWBE 3B5NA 3FEEA 3H1HD 3E1RA 4Z1MH 3PLFB 2R32A 1KFNA 1SQQE 4EOTA 5BY0A 4HKZH 1S5LX 2V7QJ 1L0NE 2ZFCA 3AE4C 3HE5B 1KILA 1SQBK 4JYWA 3AE5C 1SQBG 3CI9A 1VQ8P 1CI6A 1DE4C 1RF0A 3LW5H 2GA1A 1LTJB 2K37A 2Y0CA 1H0TB 1NU1E 3N4XA 4MCRA 2OYIA 1XTCC 3L75G 3PTZA 4YXDC 2E76D 1OW8A 1SQVJ 4I7ZB 1L4AA 1Z9EA 2N1TA 1M7LA 1LTTC 1BGYD 1KV4A 1SFCB 2QJKC 2HODA 5DJUB 4H0LB 1QX8A 4UB8E 5CJ0A 1S9KE 1EDLA 3KQGA 4NPDA 1FDMA 5DJTB 1LTIC 3TK1A 5AW5B 4GKGA 1PP9E 1QGKB 3RL0g 4HJGH 2KNCB 3AE2C 1KFMA 2MKVA 2YIUB 3A0HH 5KLVJ 1NGMB 1SQBD 5KKZC 1YQ4C 5KAIH 1M8OB 1JY3O 2SPZA 1J1DB 4R4LA 4PV1C 1JTHB 1S3JA 3HTKA 2AXTH 3L37A 3Q3DA 3BUWB 5AXIA 1KILD 2Y1NA 4RKUJ 1H8AA 4C7NB 2ZYGA 1VPCA 1IFNA 4NGPA 1VL2A 5APXA 2O1JA 1JOCA 3VRPA 4BRYB 1HBWA 2IFMA 2FXOA 5GTHE 2Q6QA 4WY4D 4EIJA 2GUVA 2H8PD 1VQMP 1SS1A 3VP9A 4BPXB 3HUSC 1M1JC 5APVA 2N1TD 1IZNB 1EDJA 2E76C 1K04A 2G3AA 1AQTA 2IBZG 2KK7A 1ZRTD 3BI0A 4W7ZA 2CIJA 1N8RQ 2H89C 4OGQD 4OVNF 5AVUB 1EZVI 2R44A 2QJKB 1NTZJ 4I1LA 1K9MQ 1T3JA 1RE3C 2OYHA 3II6A 3KXDA 3H1LE 4B86A 3OJAB 3S4RA 1LWUA 4IL6X 4ZNCA 3RGUA 3VYIA 3GLMA 1ZR4A 3R4YA 3SSUA 4JF7A 2IZ1A 4X3RA 1A02F 3C8VA 1Z8LA 2Q1KA 1AJYA 5APQA 3PRJA 4HB1A 3LIEA 3TGUE 2R3SA 1GK6A 5AW8B 3B5NC 5KKZB 4CPGA 1QL1A 3AE6C 1P84D 2V4HA 3RK3D 2P10A 1J2JB 1L0LJ 1BDDA 3BVHA 4Y28J 1NVOA 4PV1B 4K3AA 1SQVK 1YIJP 2M8RA 3JSVC 1KILC 1BE3E 1HH0A 2IBZD 4KHXA 1GU5A 2ZT9C 1SQVG 1LP1B 4IFDK 3ZNIA 3TNUA 2A06E 4D6TE 3TSIA 4WVZA 1CW5A 1DH3A 1G2CB 4NGQA 1JMMA
chains in the Genus database with same CATH topology
2E43A 2OYIC 3GHGB 4WY4C 2KSJA 1RF1C 3HUSB 1RE4C 2N3AB 2IPPA 1IK9A 1RE3A 1M1JB 1IFMA 2N1TC 1FJPA 5AVWB 1GL2A 1NO4A 1FZCA 2JEEA 2XPNA 3G3ZA 4LGDE 5AVVB 5CMZA 2P67A 2WPRA 1EQ7A 2FFDA 2YKQA 1T2KC 1SLQA 1NWQA 5CHXA 2HFED 4GT1A 1GW3A 1LT9B 1URQA 5AVXB 2NPSA 5KLVK 1PFIA 2QM7A 3HE4A 1QL2A 3R2PA 1GZLA 1GD2E 2C9NY 1L4AD 3M0AA 2Z5IA 2KLVA 1GL2B 3M91A 2A45G 4C46A 1JY2N 4OH8B 5APSA 1FZEA 1SQPK 5APTA 1NTMK 5CCHC 2PP6A 1ZV8A 2P7JA 1SVFA 3PP5A 3HD7C 3VTPC 5APYA 2XU6A 2WSFH 2YNYA 2CPBA 3VMYA 2C9LY 3BATA 2H43A 3SWFA 2HYNA 2W6BA 2YO3A 1NKNA 5CCHD 1NHLA 1SQQK 3B5NB 1LGHB 1L0NK 3HD7D 4LC1A 3M9QA 1LTBC 3RK3C 2J58A 3KYQA 4N3YB 3NMDA 1X79B 3VMZA 4WY4A 3O8ZA 3B8EB 3OAKA 4AYCA 5APUA 2QM8A 3A2AA 1DEBA 1KILB 1WT6A 1ZLLA 3UIAA 1IC2A 2XZRA 1NU1K 3F9KC 3LIDA 4WB4A 1MZ9A 1H88A 1NTZK 1CI6B 4JYCA 2Q9IA 3H32A 1N7SB 4Y99B 1LTJC 1X8YA 1G2CA 5BVZA 2OYIB 4WY4B 1RF1B 1W2EA 4LLHA 3HPHE 1M1JA 4AUWA 5AW1B 1L4AB 3VMXA 2N1TB 3P8MC 5AW7B 5CCGC 1G1IA 1SFCC 5APWA 1RF0C 4I2LC 2NPSD 2VRSA 2XV5A 1JCCA 2XPPA 2YO2A 4IFMA 2OYHC 3BASA 5AW2B 5AVYB 3P7KA 1FZGA 1JY3N 1CZQA 1HTLC 2HG5D 1LT9A 5AW4B 3KPEA 2W27A 3MIWA 1LWUC 1L4AC 4IFFA 1FBMA 2KP8A 5CCGD 4AQRD 1FU1A 1NAFA 1SFCD 1L0LK 4HH2A 3MGNA 2A45I 4W7YA 1T8ZA 1LTSC 1Z56A 2P2UA 1HWTC 3HPGG 3HD7B 1FOSF 1IFJA 1JO5A 2R3CA 5KJ7A 5AVSB 3V4QA 2WT7B 3U59A 2Q5UA 3I5CA 4RESB 1AFOA 3L36A 1XTGB 2GM4A 2KYVA 2HPCB 3T97A 3L35A 2XNXA 3IFMA 1J1DC 2FXMA 2WITA 1FZBA 3B5NA 3HTKB 3MD0A 5AW3B 2WPQA 1NTKK 3RK3B 3MTUE 1IO4A 1NKZB 2R32A 4DOJA 1KFNA 1HVVA 4EOTA 1JY2O 3L4FA 2Z4EA 3OA7A 2ZFCA 2GUSA 3HE5B 1KILA 1WRGA 3M0DA 1SQBK 4ZKPA 3BRTB 3CLQA 1S9KD 1N73C 2C0WA 3NFQA 3U1AA 1LTGC 2YKOA 3CI9A 2WTYA 3MUDA 1CI6A 1EO0A 1RF0A 2B4JC 1HJBA 1N7SA 1G1JA 3LW5H 1LTJB 2Q7CA 3N4XA 2OYIA 1XTCC 3V2RA 4JYBA 5AVQB 1RF1A 1JUNA 3M9HA 1FZCC 1RE4A 1ZN5A 3VOPA 2YMYA 1NH4A 1L4AA 1DX7A 1WJTA 1Z9EA 2N1TA 1M7LA 1LTTC 3BRVB 2FFDC 3P8CD 1JCDA 2W6AA 1SFCB 2HODA 3U1CA 2Z5HA 1J1EC 1HGZA 1E5WA 1URQC 3M06A 2NPSC 2OYHB 2FKWB 1YTZI 1GK4A 3VP8A 5CJ0A 1S9KE 1GL2D 2XKMA 5AVRB 5AW9B 1N86A 3KQGA 2KB7P 1OXZA 4O9BA 1LWUB 1FDMA 1OWAA 1LTIC 3TK1A 2WSEH 4XE5B 2HODB 4GKGA 5AW5B 1URQD 2LKMA 1JY2P 2YKPA 3V2PA 5CCHA 1IFIA 3NXSA 1FAVA 3HD7A 1MV8A 1GDTA 4DZOA 3P8CE 1KFMA 1FOSE 2IX7C 2WT7A 2WZ7A 3CL3D 2ZXEB 1CSBA 2BASA 3V4WA 2HPCA 1X9VA 1LTAC 2XDJA 5CJ4A 1JY3O 1J1DB 1JTHB 3HTKA 5BU5A 3L37A 2CPSA 3SWYA 1KILD 1YTZT 3C9IA 3N7NA 2WSCH 2H7HA 1H8AA 2HLOA 2P1JA 4C7NB 1FZFA 1VPCA 3RL0C 1IFNA 3E1IA 3RK2D 3TNUB 2XPOA 3HE5A 5APXA 2O1JA 3V5BA 1N7SD 5AW6B 1JNMA 4N78D 1JOCA 1HBWA 1N73B 2IFMA 3EQ2A 2XPLA 3EFGA 4WY4D 3GHGC 2N9BA 2GUVA 2H8PD 4EIJA 1A02J 2R5DA 3VP9A 5AVZB 3HUSC 1MFZA 1HUCA 1LTJA 5KTBA 1IJDB 1M1JC 5APVA 1NOHA 2N1TD 4HYTB 2KOGA 2WWWA 2FYUK 3RL0D 2I1KA 3M9BA 1FZCB 2J59M 3A7OA 4W7ZA 2Q3IA 2O01H 3IR9A 2JJLA 5CCGA 3U88C 1T2KD 2FFDB 5AVUB 2OARA 1SFCA 3HRNA 1J1EB 1LT9C 2POHA 4I1LA 3A5TA 1URQB 1T3JA 1YYCA 2NPSB 1GW4A 1SQXK 3V2QA 1RE3C 3HE4B 2OYHA 2WPSA 3II6A 4N78E 2R5BA 4M3LA 1N2DC 1GL2C 3TYYA 5AVTB 1JY3P 1T3UA 4B86A 3OJAB 1LWUA 4I6MC 1VDFA 1HGVA 2M3BA 3VYIA 1FJKA 4GIFA 1ZR4A 2E42A 4JF7A 3P32A 2FYZA 1A02F 1MUUA 2IFNA 2O1KA 2MJZA 3VN0A 5KJ7C 3H6PA 3WMM0 1KQLA 1SP4A 3V2NA 5APQA 4N6JA 3LIEA 1H89A 1GK6A 4WBAA 5AW8B 4ZKUA 1AQ5A 3RK2B 3B5NC 1QL1A 3A3YB 1GTWA 3RK3D 1J2JB 1N7LA 3BVHA 1ZR2A 5KJ7D 1KZUB 3GHGA 1JTHA 1FZAA 1RY3A 3KDPB 3HUSA 1SQVK 4XA4A 2M8RA 3NTNA 2L5GB 1KILC 3M0DC 1HH0A 4KHXA 5AW0B 2I1JA 4C7RA 2C0XA 1GU4A 1GU5A 4C7NA 4IFDK 3RL0B 5BU8B 3TNUA 3RK2C 3B5ND 2A45H 4W80A 3H32B 3TSIA 1N7SC 1CW5A 4Y99C 1DH3A 1N73A 1IFDA 1G2CB 1JMMA 2PAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Y A;  2E43 A;  2R5D A;  1HJB A;  5AVZ B;  1MFZ A;  1HUC A;  2Q7C A;  4JYB A;  2IPP A;  5APV A;  2N3A B;  5AVQ B;  1JUN A;  4HYT B;  2WWW A;  3M9H A;  3HPH E;  4AUW A;  3M9B A;  5AW1 B;  5AVW B;  3VMX A;  5AW7 B;  3P8M C;  1Z9E A;  1WJT A;  3A7O A;  2Q3I A;  3IR9 A;  2XPN A;  2JJL A;  5APW A;  3U88 C;  1T2K D;  5AVV B;  4I2L C;  5CMZ A;  2P67 A;  2W6A A;  2WPR A;  5AVU B;  2Z5H A;  2VRS A;  1SLQ A;  2XV5 A;  1T2K C;  2XPP A;  3M06 A;  2YO2 A;  1NWQ A;  5AW2 B;  3A5T A;  5AVY B;  3P7K A;  1YYC A;  4GT1 A;  1GK4 A;  5AVX B;  1CZQ A;  3HE4 B;  1S9K E;  2QM7 A;  2WPS A;  3HE4 A;  5AW4 B;  1GZL A;  5AVR B;  2W27 A;  5AW9 B;  1GD2 E;  3KQG A;  3M0A A;  2Z5I A;  2C9N Y;  2R5B A;  4M3L A;  3TYY A;  5AVT B;  1OXZ A;  2KP8 A;  4B86 A;  3M91 A;  4C46 A;  4AQR D;  1OWA A;  1NAF A;  4I6M C;  5APS A;  3TK1 A;  5APT A;  3VYI A;  4XE5 B;  3MGN A;  5AW5 B;  4GKG A;  2E42 A;  2P7J A;  3P32 A;  1A02 F;  1MUU A;  2P2U A;  1HWT C;  3VTP C;  3VN0 A;  5APY A;  3NXS A;  3HPG G;  1FAV A;  2XU6 A;  1FOS F;  1MV8 A;  2YNY A;  2R3C A;  1A02 J;  4DZO A;  1KQL A;  1SP4 A;  5AVS B;  3V4Q A;  5APQ A;  2WT7 B;  2Q5U A;  3VMY A;  1FOS E;  2C9L Y;  2WT7 A;  4RES B;  3L36 A;  3SWF A;  2ZXE B;  3LIE A;  1H89 A;  1CSB A;  1GK6 A;  2YO3 A;  5AW8 B;  2BAS A;  3V4W A;  3T97 A;  3A3Y B;  3L35 A;  1GTW A;  1J2J B;  4LC1 A;  3MD0 A;  3HTK A;  5AW3 B;  2WPQ A;  3L37 A;  3NMD A;  1IO4 A;  3KDP B;  3VMZ A;  2R32 A;  3O8Z A;  3NTN A;  4EOT A;  3B8E B;  3OAK A;  4AYC A;  2H7H A;  1H8A A;  4KHX A;  5AW0 B;  4C7N B;  5APU A;  2QM8 A;  1GU4 A;  3A2A A;  1GU5 A;  2ZFC A;  4C7N A;  3HE5 B;  3M0D A;  3UIA A;  3TNU B;  2XPO A;  3HE5 A;  5APX A;  2XZR A;  3V5B A;  3TNU A;  5AW6 B;  1JNM A;  3F9K C;  1S9K D;  3LID A;  3NFQ A;  1H88 A;  1HBW A;  1CI6 B;  4JYC A;  2XPL A;  1DH3 A;  2WTY A;  1EO0 A;  1CI6 A;  1G2C B;  2B4J C;  2N9B A;  3I5C A; 
#chains in the Genus database with same CATH topology
 2OYI C;  4OC5 A;  1R8E A;  1AVO A;  4WY4 C;  2KSJ A;  1PL5 A;  3HUS B;  1IK9 A;  1M1J B;  2PFX A;  3K5B A;  2N1T C;  1FJP A;  1NO4 A;  1FZC A;  2JEE A;  3G3Z A;  2JWA A;  2M5A A;  2YKQ A;  4U3F J;  1NWQ A;  5KLV K;  3R2P A;  2Z5I A;  3CXH I;  5KLV G;  3E7K A;  3CXH E;  3F89 A;  4ZMD A;  2A45 G;  1JY2 N;  5B5E H;  1SQX E;  3CX5 D;  1W2B O;  1U7M A;  3G6E P;  2Y9Y A;  2XU6 A;  2WSF H;  1SQV D;  3AE1 C;  3HMJ G;  2H43 A;  2D2C B;  1VQP P;  4JQ0 D;  2XEJ A;  3T97 B;  1U57 A;  4UB8 H;  3B5N B;  1KB9 E;  2ZAE B;  4LC1 A;  3RK3 C;  3KYQ A;  4N3Y B;  4MCP A;  3SJG A;  1YVH A;  2IYP A;  2OQQ A;  5APU A;  1DEB A;  1KIL B;  1ZLL A;  2K88 A;  2ZT9 B;  2Y0E A;  3EWK A;  1ZXG A;  2E5Y A;  3LID A;  4WB4 A;  4A4C A;  1NTZ K;  1CI6 B;  1NTZ G;  1YJN P;  3BHX A;  4U7J A;  2OYI B;  1K73 Q;  4WY4 B;  5KLV D;  1BCC E;  4OC4 A;  1L4A B;  1Y9B A;  2N1T B;  1PPJ E;  5HKW A;  3ITK A;  1S2E A;  5APW A;  1YJW P;  2XV5 A;  1JCC A;  2OYH C;  3BAS A;  3P7K A;  1FZG A;  3IWW A;  1CZQ A;  3WU2 E;  5AW4 B;  1VQ5 P;  3Q5R A;  1KN7 A;  1KYO D;  1LWU C;  1FBV A;  2KP8 A;  5CCG D;  5HKZ A;  4AQR D;  1SFC D;  5GTH H;  1L0L K;  4H0L D;  1L0L G;  1FDO A;  1Z56 A;  5KAI E;  3L74 E;  3HPG G;  3BCC J;  1NTM E;  1K8A Q;  1EXI A;  3CCE P;  3VRO A;  2GM4 A;  2AEM A;  1NTZ D;  4MCS A;  1Q2N A;  3HTK B;  3MD0 A;  3S1K A;  1VQ9 P;  3RK3 B;  5TJH A;  3L4F A;  2C6P A;  2OTL P;  1VQ6 P;  2GUS A;  3M0D A;  2C0W A;  3AEB C;  3L70 E;  3NFQ A;  3MUD A;  4U3F G;  2B88 A;  1HJB A;  4PD4 D;  2Q7C A;  1FDI A;  1PIX A;  1FZC C;  1RE4 A;  3CC4 P;  1OVU A;  1FS0 E;  1NH4 A;  1DX7 A;  1WJT A;  3CD6 P;  1L0L D;  3P8C D;  1OMI A;  2W6A A;  2Z5H A;  1E5W A;  1HGZ A;  3M06 A;  2OYH B;  2FKW B;  3VP8 A;  3WUV A;  1GL2 D;  5HKY A;  4OME A;  1LWU B;  1QEX A;  2C6C A;  3D71 A;  1JY2 P;  2K3R A;  2YKP A;  1PGJ A;  1IFI A;  4NPF X;  4DZO A;  1RQU A;  2JWD A;  1S1C X;  2B87 A;  5K5G B;  2E5T A;  2WZ7 A;  1VQ7 P;  1CSB A;  2BAS A;  1NJI Q;  3S9M A;  4U3F D;  3FXD A;  3AE9 C;  3V4W A;  2HPC A;  1R5S A;  1SQP J;  2CPS A;  3L73 E;  3SWY A;  1KQS O;  1YTZ T;  3CXH H;  3H1J E;  3N7N A;  2H7H A;  2YIU C;  3RL0 C;  1OFC X;  3TNU B;  2XPO A;  3CWB J;  1NTK E;  5AW6 B;  4P4I A;  2IBZ I;  2XPL A;  3EQ2 A;  4PV1 D;  3GHG C;  1A02 J;  1SQQ J;  5AVZ B;  1QVG O;  3CCR P;  3SJE A;  1L0N J;  5KTB A;  4HYT B;  3IN6 A;  2I1K A;  5B66 E;  1FZC B;  3D7F A;  2J59 M;  3PT1 A;  1KB9 H;  1T2K D;  4EDF A;  2M5A B;  1RHZ B;  3CCJ P;  5B5E E;  1NU1 J;  3HRN A;  2LXC B;  3AE3 C;  1YYC A;  4IOI H;  3V2Q A;  1JB0 J;  2WSF J;  4JPZ B;  2WPS A;  4N78 E;  3BCC G;  2YMK A;  2DLA A;  2VKZ G;  2JDI H;  4M3L A;  1GL2 C;  3TYY A;  4I6M C;  1E79 H;  1HGV A;  2YXQ B;  3B71 A;  2M3B A;  4GIF A;  2E42 A;  3P32 A;  3H1I E;  3MZW B;  2O1K A;  1DIP A;  2BCC E;  3H6P A;  3CX5 I;  3PJS K;  3AEE C;  3BUM B;  5TIS H;  1H89 A;  3CMA P;  1PP9 J;  1OZH A;  3PHL A;  3V6I A;  2QEX P;  4A7P A;  3GW6 A;  3WU2 H;  3WUT A;  5KAF E;  3Q5P A;  1OIP A;  1NYH A;  4BWN A;  4XA4 A;  3M0D C;  2D2C D;  2C0X A;  1GU4 A;  1KD1 Q;  4H44 C;  3VMA A;  3I56 P;  2QA4 P;  1KC8 Q;  3RL0 B;  5BU8 B;  1RH5 B;  3B5N D;  3D6Z A;  2WMM A;  3L72 E;  1OVV A;  3I5C A;  3BCC D;  3GHG B;  1LJ2 A;  1RE4 C;  2IPP A;  3FXE A;  2ZT9 D;  4P45 A;  3OB1 B;  3I55 P;  5AVV B;  5CMZ A;  2P67 A;  2WPR A;  1EQ7 A;  2FYU E;  1T2K C;  3AED C;  1URQ A;  1T6A A;  2K9Y A;  2QM7 A;  3CCL P;  1QL2 A;  2C9N Y;  1L4A D;  1GL2 B;  3O6Q A;  3FF3 A;  4C46 A;  1AV1 A;  1SQP K;  1KYO I;  2PP6 A;  1ZV8 A;  1SQP G;  1EZV E;  2FY8 A;  3VTP C;  3CCQ P;  3H1L J;  2YNY A;  2B89 A;  3QWO C;  1VQN P;  2CPB A;  2PRR A;  1U7J A;  3SWF A;  2HYN A;  2LR2 A;  2W6B A;  3CWB G;  2O01 N;  2PVW A;  1NHL A;  1SQQ K;  2FXP A;  4YTP C;  1L0N K;  1SQQ G;  3M9Q A;  2J58 A;  3D70 A;  1L0N G;  3NMD A;  4LQG A;  3O8Z A;  1USE A;  3TGU J;  2QM8 A;  1WT6 A;  2D2C C;  1YI2 P;  3Q1M A;  4P4D A;  4H44 B;  1NU1 K;  3F9K C;  3H32 A;  1NU1 G;  3VRQ A;  1X8Y A;  3AEA C;  1BE3 J;  2W6J H;  1WMK A;  4LLH A;  3BI1 A;  4AUW A;  4D6T J;  1YJ9 P;  4PD4 I;  2YXR B;  2QE7 H;  4GOF A;  4KJM A;  1LNQ A;  1SQP D;  1RF0 C;  3H1K E;  2VRS A;  5GTI E;  4OC0 A;  1S4X A;  1JY3 N;  1BSH A;  3CWB D;  1L4A C;  1FBM A;  4DJG A;  1PP9 G;  3CCM P;  1NAF A;  1SQQ D;  3MGN A;  1Q81 Q;  1L0N D;  2O3J A;  5B66 H;  2R3C A;  5KJ7 A;  4NPE A;  5AVS B;  3SFD C;  3V4Q A;  1SQX J;  2JKV A;  4RES B;  4QMA A;  5J3X A;  1XTG B;  1NU1 D;  2HPC B;  4JZ0 A;  3L35 A;  2XNX A;  1FZB A;  2ZVN B;  2NRG A;  5AW3 B;  2WPQ A;  1VQ4 P;  3MTU E;  1NKZ B;  4DOJ A;  3BUO B;  1OX3 A;  4MCQ A;  2Z4E A;  1WRG A;  4R4M A;  4ZKP A;  3BRT B;  3CLQ A;  1S9K D;  3PLN A;  3S9O A;  2JR8 A;  1LTG C;  3GMA A;  1EO0 A;  2B4J C;  4BTF A;  1N7S A;  3LW5 J;  3AEF C;  3V2R A;  4JYB A;  1PP9 D;  3VOP A;  2YMY A;  3H1H E;  2QVA A;  2I8D A;  1ZME C;  2KI7 B;  3S9L A;  5L8R J;  5KAF H;  3U1C A;  3AEC C;  1X22 A;  1URQ C;  1BCC J;  2OTK E;  1RQV A;  2AEJ A;  4XFJ A;  1GK4 A;  4RJT A;  2Y1M A;  3H1L G;  1N86 A;  1PGO A;  2H88 C;  1PZQ A;  3OB2 B;  3TDK A;  3FED A;  1OWA A;  2QG4 A;  5TIS E;  2WSE H;  4XE5 B;  2HOD B;  2XEG A;  3V2P A;  5CCH A;  1UII A;  1BGY E;  3HD7 A;  1MV8 A;  3TGU G;  1GDT A;  3CPW O;  1FOS E;  2IX7 C;  3CCU P;  3VGO A;  2WT7 A;  1OVR A;  1L2P A;  1EDI A;  1KOR A;  1BSN A;  4EI2 A;  3L74 J;  1X9V A;  2XDJ A;  5CJ4 A;  1YHQ P;  1BE3 G;  1NTM J;  5BU5 A;  4GOD A;  3C9I A;  4NGS A;  2WSC H;  2A06 G;  1QLE D;  2HLO A;  2KSE A;  1FZF A;  4D6T G;  2AEF A;  1YQ3 C;  2K9J A;  3V5B A;  2OR4 A;  1KYO H;  1N7S D;  1R5L A;  1Y8A A;  1JNM A;  1Q82 Q;  1Q7Y Q;  3EFG A;  2N9B A;  3H1L D;  3JCU E;  4NGN A;  2QJP C;  2Y9Z A;  1HUC A;  1SQB E;  2KZI A;  1NOH A;  2ZJS E;  3RL0 D;  1PGP A;  3L70 J;  3L75 E;  2WSS H;  2Q3I A;  2O01 H;  5H2F E;  2JJL A;  4RO0 A;  3AE7 C;  3TGU D;  3A5T A;  2POH A;  3MP7 B;  1URQ B;  1GW4 A;  1SQX K;  2W8Z A;  1SQX G;  2BEQ D;  2QIW A;  4OC1 A;  1JY3 P;  1T3U A;  4MN4 C;  4NGT A;  3KAS A;  2KLU A;  1BE3 D;  3H25 A;  2FYZ A;  2IFN A;  2MJZ A;  1KTM A;  1ZRT E;  3VN0 A;  5KJ7 C;  2A06 D;  4D6T D;  3KZI H;  3WMM 0;  1KQL A;  2DW3 A;  3V2N A;  4PD4 H;  4N6J A;  4WBA A;  1AQ5 A;  3RK2 B;  4RR2 B;  2PVV A;  3BUX B;  5GTI H;  2Q3E A;  1DD3 A;  4W9Y A;  1N7L A;  1VQK P;  1FZA A;  1RY3 A;  3HUS A;  3AE8 C;  3NTN A;  3SWK A;  4C7R A;  2JP3 A;  3H32 B;  4OC2 A;  1N7S C;  4Y99 C;  3L73 J;  1N73 A;  1IFD A;  3CXH D;  3H1J J;  1BCC G;  2PAJ A;  2E43 A;  3MHV A;  1SQX D;  2QJP B;  2W83 C;  3BUN B;  1PPJ G;  2N3A B;  1RE3 A;  1P84 I;  4NGR A;  1P84 E;  1NTK J;  1IFM A;  4H44 D;  2B9B A;  3CC7 P;  2RKL A;  1EC5 A;  4L74 A;  2KZJ A;  1BDC A;  2XPN A;  4LGD E;  2AXC A;  1S5L H;  1M57 D;  2IBZ E;  3F5H A;  2FFD A;  1SLQ A;  2HFE D;  1IK7 A;  4GT1 A;  1GW3 A;  2OYO A;  5AVX B;  2NPS A;  3TF5 A;  1PFI A;  3HE4 A;  1GZL A;  1GD2 E;  3M0A A;  1KB9 D;  1OW7 A;  2KLV A;  3ABV C;  5APS A;  5APT A;  3L74 G;  1NTM K;  5CCH C;  1NAY A;  3PP5 A;  3CME P;  1NTM G;  3HD7 C;  5APY A;  3L71 J;  1FE6 A;  3VMY A;  4BXL A;  3L71 E;  3B4S A;  4A4B A;  3H1I J;  3CC2 P;  3KHU A;  2KIK A;  1BCC D;  3C1L A;  2BCC J;  2OTJ P;  1LTB C;  1PPJ D;  3VRN A;  4WY4 A;  3G4S P;  3CX5 E;  3B8E B;  3OAK A;  4AYC A;  3L70 G;  3A2A A;  3UIA A;  1IC2 A;  2M0B A;  4TT3 H;  2QRX A;  1SQV E;  4JYC A;  2N9Y B;  1N7S B;  1JMB A;  2KS1 A;  4Y99 B;  2UWJ E;  4DCK A;  2E75 C;  3IAO A;  4YPC A;  5M1B A;  3HPH E;  3A0B H;  5AW1 B;  3VMX A;  3L74 D;  1VF5 D;  3PFV A;  3L72 J;  1G1I A;  2WSE J;  3MUD C;  4P4F A;  4UB6 E;  1NTM D;  5E79 H;  2NPS D;  2XPP A;  4IFM A;  4OWF A;  2K1A A;  3D7G A;  1EXJ A;  1HTL C;  1LT9 A;  1K05 A;  3OW2 O;  3KPE A;  2W27 A;  3MIW A;  1FC2 C;  1FU1 A;  2FYU J;  1TU3 F;  5KLV E;  4P4J A;  3JCU H;  3D6Y A;  2A45 I;  2CBL A;  4W7Y A;  3ZDM A;  1LTS C;  1IFP A;  3L75 D;  2P2U A;  1HWT C;  1ZOY C;  3HD7 B;  2IYO A;  1IFJ A;  3G9R A;  3L70 D;  2WSC J;  2L91 A;  2WT7 B;  3U59 A;  2Q5U A;  5H2F H;  1AFO A;  2XND H;  3FWL A;  2QJY C;  2KYV A;  3L73 G;  3IFM A;  3H1J G;  2WIT A;  1KYO E;  2J5U A;  5CBN A;  1KMI Z;  1NTK K;  4IL6 H;  1IO4 A;  1HVV A;  1NTK G;  1JY2 O;  3G71 P;  3OA7 A;  2K9J B;  2NZ2 A;  4ASV A;  2O01 J;  1N73 C;  2WPV B;  3U1A A;  5C39 A;  2YKO A;  2WTY A;  3QH9 A;  1G1J A;  5D29 A;  3SJX A;  2CK3 H;  4PJ0 E;  3EFF K;  2E75 B;  1NTZ E;  5AVQ B;  1AVY A;  1RF1 A;  1JUN A;  3M9H A;  1ZN5 A;  3D7D A;  2KXP B;  1GMJ A;  1LT1 A;  3BRV B;  2FFD C;  1VF5 C;  2C6G A;  4BPU B;  1JCD A;  3RBX A;  1J1E C;  4WWI A;  2NPS C;  3RBU A;  1JM0 A;  1YTZ I;  3L71 G;  3FX0 A;  4JBZ A;  2XKM A;  5AVR B;  5AW9 B;  2KB7 P;  1OXZ A;  3KZI E;  4O9B A;  1PV3 A;  3FGA D;  3H1K J;  3H1I G;  3L73 D;  2JBK A;  4PD4 E;  3H1J D;  1MKM A;  2BCC G;  2OOT A;  1URQ D;  3FEC A;  2LKM A;  1CX8 A;  1NTK D;  3NXS A;  1P84 H;  1FAV A;  1L0L E;  5CBO A;  3P8C E;  5F13 A;  1X0T A;  2FYN C;  3CL3 D;  2ZXE B;  3Q2Y A;  2BEZ F;  2M3E A;  3PH0 A;  2QJY B;  1DEE G;  1LTA C;  1S72 P;  1USD A;  2B87 B;  2P1J A;  1VQO P;  2E74 D;  4H13 D;  1QVF O;  2E76 B;  3RK2 D;  3E1I A;  3L72 G;  3HE5 A;  2IZ0 A;  4N78 D;  4OGQ C;  1KQF B;  1N73 B;  3L71 D;  2R5D A;  1S5L E;  5EFW B;  1MFZ A;  1LTJ A;  3GF7 A;  3AEG C;  1IJD B;  1H0T A;  4U3F E;  2PGD A;  2KOG A;  2WWW A;  2FYU K;  3H1I D;  2Y0D A;  2V7Q H;  5ELY A;  3M9B A;  2BCC D;  2FYU G;  3A7O A;  2W90 A;  3IR9 A;  5CCG A;  3U88 C;  2FFD B;  1VF5 B;  3CCV P;  3IF4 A;  2OAR A;  3SFE C;  1SFC A;  1J1E B;  1LT9 C;  3CX5 H;  3CCS P;  2NPS B;  4DT0 A;  3HE4 B;  3H1H J;  2UV8 G;  2R5B A;  1N2D C;  5AVT B;  3OP0 A;  1Y47 A;  5KLI C;  1M90 Q;  1EZV G;  1VDF A;  2LXB A;  2RMZ A;  1KB9 I;  1FJK A;  2WVR A;  2ZYA A;  3WUU A;  4EYY Q;  1MUU A;  3GG2 A;  1Q86 Q;  2HR3 A;  2RN0 A;  2RH0 A;  1PGQ A;  2KNC A;  1SP4 A;  3L72 D;  4ASW A;  2FYN B;  3RBZ A;  4UB6 H;  4ZKU A;  3A3Y B;  1HJ0 A;  1GTW A;  2G8Y A;  1EDK A;  2FBW C;  1BGY J;  1ZR2 A;  5KJ7 D;  1KZU B;  3GHG A;  1JTH A;  1DD4 A;  3KDP B;  1M56 D;  2L5G B;  5AW0 B;  2XEF A;  2I1J A;  1JEK A;  2FYU D;  4C7N A;  2E74 C;  4H13 C;  3RK2 C;  1OW6 A;  2A45 H;  4W80 A;  3A0B E;  4BRY A;  2KS1 B;  4OGQ B;  1KQG B;  5E79 E;  3W68 A;  1RF1 C;  1UIX A;  4L75 A;  4BPW B;  1EZV D;  3H1K G;  5AVW B;  1MFT A;  1GL2 A;  2IDB A;  1ZP0 C;  4OC3 A;  3A0H E;  3BXM A;  4P4B A;  1SQB J;  5F09 A;  4P4E A;  5CHX A;  1LT9 B;  2AXT E;  3L75 J;  2ZXX A;  4NGM A;  3JC2 2;  1M1K Q;  3M91 A;  3BCC E;  1AA0 A;  3GF3 A;  4OH8 B;  1FZE A;  5KLI B;  1KIL E;  2JO1 A;  3D7H A;  2P7J A;  1SVF A;  4PJ0 H;  2QSI A;  3Q5S A;  4IL6 E;  4GDO A;  2C9L Y;  3BAT A;  3O6Q B;  2YO3 A;  1NKN A;  5CCH D;  1LGH B;  3HD7 D;  3USS A;  1X79 B;  3VMZ A;  4L73 A;  3H1K D;  1HF9 A;  1LP1 A;  2XZR A;  2E74 B;  4H13 B;  1MZ9 A;  1H88 A;  3VRR A;  2Q9I A;  1LTJ C;  1G2C A;  1B47 A;  1ZW0 A;  4L76 A;  5BVZ A;  2P58 A;  1RF1 B;  3H1H G;  1W2E A;  1YIT P;  1D7M A;  1M1J A;  4I7Z C;  4KT0 J;  2ZYD A;  5AW7 B;  3P8M C;  5CCG C;  1YBK A;  2JBJ A;  2WQY C;  1SFC C;  2XEI A;  3S9N A;  4I2L C;  3SJF A;  1Q90 D;  4H0L C;  2YO2 A;  5AW2 B;  5AVY B;  2E75 D;  3W67 A;  1VQL P;  2HG5 D;  2OGU A;  4YXW H;  4IFF A;  3RK3 E;  1W5C E;  2KUB A;  4HH2 A;  4K35 A;  1BGY G;  4GOE A;  1T8Z A;  4GPL B;  3FWN A;  4P44 A;  1FOS F;  2ZVO B;  1JO5 A;  1SQP E;  2ITA A;  4TLF A;  3L36 A;  3T97 A;  1J1D C;  2FXM A;  3CWB E;  3B5N A;  3FEE A;  3H1H D;  3E1R A;  4Z1M H;  3PLF B;  2R32 A;  1KFN A;  1SQQ E;  4EOT A;  5BY0 A;  4HKZ H;  1S5L X;  2V7Q J;  1L0N E;  2ZFC A;  3AE4 C;  3HE5 B;  1KIL A;  1SQB K;  4JYW A;  3AE5 C;  1SQB G;  3CI9 A;  1VQ8 P;  1CI6 A;  1DE4 C;  1RF0 A;  3LW5 H;  2GA1 A;  1LTJ B;  2K37 A;  2Y0C A;  1H0T B;  1NU1 E;  3N4X A;  4MCR A;  2OYI A;  1XTC C;  3L75 G;  3PTZ A;  4YXD C;  2E76 D;  1OW8 A;  1SQV J;  4I7Z B;  1L4A A;  1Z9E A;  2N1T A;  1M7L A;  1LTT C;  1BGY D;  1KV4 A;  1SFC B;  2QJK C;  2HOD A;  5DJU B;  4H0L B;  1QX8 A;  4UB8 E;  5CJ0 A;  1S9K E;  1EDL A;  3KQG A;  4NPD A;  1FDM A;  5DJT B;  1LTI C;  3TK1 A;  5AW5 B;  4GKG A;  1PP9 E;  1QGK B;  3RL0 g;  4HJG H;  2KNC B;  3AE2 C;  1KFM A;  2MKV A;  2YIU B;  3A0H H;  5KLV J;  1NGM B;  1SQB D;  5KKZ C;  1YQ4 C;  5KAI H;  1M8O B;  1JY3 O;  2SPZ A;  1J1D B;  4R4L A;  4PV1 C;  1JTH B;  1S3J A;  3HTK A;  2AXT H;  3L37 A;  3Q3D A;  3BUW B;  5AXI A;  1KIL D;  2Y1N A;  4RKU J;  1H8A A;  4C7N B;  2ZYG A;  1VPC A;  1IFN A;  4NGP A;  1VL2 A;  5APX A;  2O1J A;  1JOC A;  3VRP A;  4BRY B;  1HBW A;  2IFM A;  2FXO A;  5GTH E;  2Q6Q A;  4WY4 D;  4EIJ A;  2GUV A;  2H8P D;  1VQM P;  1SS1 A;  3VP9 A;  4BPX B;  3HUS C;  1M1J C;  5APV A;  2N1T D;  1IZN B;  1EDJ A;  2E76 C;  1K04 A;  2G3A A;  1AQT A;  2IBZ G;  2KK7 A;  1ZRT D;  3BI0 A;  4W7Z A;  2CIJ A;  1N8R Q;  2H89 C;  4OGQ D;  4OVN F;  5AVU B;  1EZV I;  2R44 A;  2QJK B;  1NTZ J;  4I1L A;  1K9M Q;  1T3J A;  1RE3 C;  2OYH A;  3II6 A;  3KXD A;  3H1L E;  4B86 A;  3OJA B;  3S4R A;  1LWU A;  4IL6 X;  4ZNC A;  3RGU A;  3VYI A;  3GLM A;  1ZR4 A;  3R4Y A;  3SSU A;  4JF7 A;  2IZ1 A;  4X3R A;  1A02 F;  3C8V A;  1Z8L A;  2Q1K A;  1AJY A;  5APQ A;  3PRJ A;  4HB1 A;  3LIE A;  3TGU E;  2R3S A;  1GK6 A;  5AW8 B;  3B5N C;  5KKZ B;  4CPG A;  1QL1 A;  3AE6 C;  1P84 D;  2V4H A;  3RK3 D;  2P10 A;  1J2J B;  1L0L J;  1BDD A;  3BVH A;  4Y28 J;  1NVO A;  4PV1 B;  4K3A A;  1SQV K;  1YIJ P;  2M8R A;  3JSV C;  1KIL C;  1BE3 E;  1HH0 A;  2IBZ D;  4KHX A;  1GU5 A;  2ZT9 C;  1SQV G;  1LP1 B;  4IFD K;  3ZNI A;  3TNU A;  2A06 E;  4D6T E;  3TSI A;  4WVZ A;  1CW5 A;  1DH3 A;  1G2C B;  4NGQ A;  1JMM A; 
#chains in the Genus database with same CATH homology
 2E43 A;  2OYI C;  3GHG B;  4WY4 C;  2KSJ A;  1RF1 C;  3HUS B;  1RE4 C;  2N3A B;  2IPP A;  1IK9 A;  1RE3 A;  1M1J B;  1IFM A;  2N1T C;  1FJP A;  5AVW B;  1GL2 A;  1NO4 A;  1FZC A;  2JEE A;  2XPN A;  3G3Z A;  4LGD E;  5AVV B;  5CMZ A;  2P67 A;  2WPR A;  1EQ7 A;  2FFD A;  2YKQ A;  1T2K C;  1SLQ A;  1NWQ A;  5CHX A;  2HFE D;  4GT1 A;  1GW3 A;  1LT9 B;  1URQ A;  5AVX B;  2NPS A;  5KLV K;  1PFI A;  2QM7 A;  3HE4 A;  1QL2 A;  3R2P A;  1GZL A;  1GD2 E;  2C9N Y;  1L4A D;  3M0A A;  2Z5I A;  2KLV A;  1GL2 B;  3M91 A;  2A45 G;  4C46 A;  1JY2 N;  4OH8 B;  5APS A;  1FZE A;  1SQP K;  5APT A;  1NTM K;  5CCH C;  2PP6 A;  1ZV8 A;  2P7J A;  1SVF A;  3PP5 A;  3HD7 C;  3VTP C;  5APY A;  2XU6 A;  2WSF H;  2YNY A;  2CPB A;  3VMY A;  2C9L Y;  3BAT A;  2H43 A;  3SWF A;  2HYN A;  2W6B A;  2YO3 A;  1NKN A;  5CCH D;  1NHL A;  1SQQ K;  3B5N B;  1LGH B;  1L0N K;  3HD7 D;  4LC1 A;  3M9Q A;  1LTB C;  3RK3 C;  2J58 A;  3KYQ A;  4N3Y B;  3NMD A;  1X79 B;  3VMZ A;  4WY4 A;  3O8Z A;  3B8E B;  3OAK A;  4AYC A;  5APU A;  2QM8 A;  3A2A A;  1DEB A;  1KIL B;  1WT6 A;  1ZLL A;  3UIA A;  1IC2 A;  2XZR A;  1NU1 K;  3F9K C;  3LID A;  4WB4 A;  1MZ9 A;  1H88 A;  1NTZ K;  1CI6 B;  4JYC A;  2Q9I A;  3H32 A;  1N7S B;  4Y99 B;  1LTJ C;  1X8Y A;  1G2C A;  5BVZ A;  2OYI B;  4WY4 B;  1RF1 B;  1W2E A;  4LLH A;  3HPH E;  1M1J A;  4AUW A;  5AW1 B;  1L4A B;  3VMX A;  2N1T B;  3P8M C;  5AW7 B;  5CCG C;  1G1I A;  1SFC C;  5APW A;  1RF0 C;  4I2L C;  2NPS D;  2VRS A;  2XV5 A;  1JCC A;  2XPP A;  2YO2 A;  4IFM A;  2OYH C;  3BAS A;  5AW2 B;  5AVY B;  3P7K A;  1FZG A;  1JY3 N;  1CZQ A;  1HTL C;  2HG5 D;  1LT9 A;  5AW4 B;  3KPE A;  2W27 A;  3MIW A;  1LWU C;  1L4A C;  4IFF A;  1FBM A;  2KP8 A;  5CCG D;  4AQR D;  1FU1 A;  1NAF A;  1SFC D;  1L0L K;  4HH2 A;  3MGN A;  2A45 I;  4W7Y A;  1T8Z A;  1LTS C;  1Z56 A;  2P2U A;  1HWT C;  3HPG G;  3HD7 B;  1FOS F;  1IFJ A;  1JO5 A;  2R3C A;  5KJ7 A;  5AVS B;  3V4Q A;  2WT7 B;  3U59 A;  2Q5U A;  3I5C A;  4RES B;  1AFO A;  3L36 A;  1XTG B;  2GM4 A;  2KYV A;  2HPC B;  3T97 A;  3L35 A;  2XNX A;  3IFM A;  1J1D C;  2FXM A;  2WIT A;  1FZB A;  3B5N A;  3HTK B;  3MD0 A;  5AW3 B;  2WPQ A;  1NTK K;  3RK3 B;  3MTU E;  1IO4 A;  1NKZ B;  2R32 A;  4DOJ A;  1KFN A;  1HVV A;  4EOT A;  1JY2 O;  3L4F A;  2Z4E A;  3OA7 A;  2ZFC A;  2GUS A;  3HE5 B;  1KIL A;  1WRG A;  3M0D A;  1SQB K;  4ZKP A;  3BRT B;  3CLQ A;  1S9K D;  1N73 C;  2C0W A;  3NFQ A;  3U1A A;  1LTG C;  2YKO A;  3CI9 A;  2WTY A;  3MUD A;  1CI6 A;  1EO0 A;  1RF0 A;  2B4J C;  1HJB A;  1N7S A;  1G1J A;  3LW5 H;  1LTJ B;  2Q7C A;  3N4X A;  2OYI A;  1XTC C;  3V2R A;  4JYB A;  5AVQ B;  1RF1 A;  1JUN A;  3M9H A;  1FZC C;  1RE4 A;  1ZN5 A;  3VOP A;  2YMY A;  1NH4 A;  1L4A A;  1DX7 A;  1WJT A;  1Z9E A;  2N1T A;  1M7L A;  1LTT C;  3BRV B;  2FFD C;  3P8C D;  1JCD A;  2W6A A;  1SFC B;  2HOD A;  3U1C A;  2Z5H A;  1J1E C;  1HGZ A;  1E5W A;  1URQ C;  3M06 A;  2NPS C;  2OYH B;  2FKW B;  1YTZ I;  1GK4 A;  3VP8 A;  5CJ0 A;  1S9K E;  1GL2 D;  2XKM A;  5AVR B;  5AW9 B;  1N86 A;  3KQG A;  2KB7 P;  1OXZ A;  4O9B A;  1LWU B;  1FDM A;  1OWA A;  1LTI C;  3TK1 A;  2WSE H;  4XE5 B;  2HOD B;  4GKG A;  5AW5 B;  1URQ D;  2LKM A;  1JY2 P;  2YKP A;  3V2P A;  5CCH A;  1IFI A;  3NXS A;  1FAV A;  3HD7 A;  1MV8 A;  1GDT A;  4DZO A;  3P8C E;  1KFM A;  1FOS E;  2IX7 C;  2WT7 A;  2WZ7 A;  3CL3 D;  2ZXE B;  1CSB A;  2BAS A;  3V4W A;  2HPC A;  1X9V A;  1LTA C;  2XDJ A;  5CJ4 A;  1JY3 O;  1J1D B;  1JTH B;  3HTK A;  5BU5 A;  3L37 A;  2CPS A;  3SWY A;  1KIL D;  1YTZ T;  3C9I A;  3N7N A;  2WSC H;  2H7H A;  1H8A A;  2HLO A;  2P1J A;  4C7N B;  1FZF A;  1VPC A;  3RL0 C;  1IFN A;  3E1I A;  3RK2 D;  3TNU B;  2XPO A;  3HE5 A;  5APX A;  2O1J A;  3V5B A;  1N7S D;  5AW6 B;  1JNM A;  4N78 D;  1JOC A;  1HBW A;  1N73 B;  2IFM A;  3EQ2 A;  2XPL A;  3EFG A;  4WY4 D;  3GHG C;  2N9B A;  2GUV A;  2H8P D;  4EIJ A;  1A02 J;  2R5D A;  3VP9 A;  5AVZ B;  3HUS C;  1MFZ A;  1HUC A;  1LTJ A;  5KTB A;  1IJD B;  1M1J C;  5APV A;  1NOH A;  2N1T D;  4HYT B;  2KOG A;  2WWW A;  2FYU K;  3RL0 D;  2I1K A;  3M9B A;  1FZC B;  2J59 M;  3A7O A;  4W7Z A;  2Q3I A;  2O01 H;  3IR9 A;  2JJL A;  5CCG A;  3U88 C;  1T2K D;  2FFD B;  5AVU B;  2OAR A;  1SFC A;  3HRN A;  1J1E B;  1LT9 C;  2POH A;  4I1L A;  3A5T A;  1URQ B;  1T3J A;  1YYC A;  2NPS B;  1GW4 A;  1SQX K;  3V2Q A;  1RE3 C;  3HE4 B;  2OYH A;  2WPS A;  3II6 A;  4N78 E;  2R5B A;  4M3L A;  1N2D C;  1GL2 C;  3TYY A;  5AVT B;  1JY3 P;  1T3U A;  4B86 A;  3OJA B;  1LWU A;  4I6M C;  1VDF A;  1HGV A;  2M3B A;  3VYI A;  1FJK A;  4GIF A;  1ZR4 A;  2E42 A;  4JF7 A;  3P32 A;  2FYZ A;  1A02 F;  1MUU A;  2IFN A;  2O1K A;  2MJZ A;  3VN0 A;  5KJ7 C;  3H6P A;  3WMM 0;  1KQL A;  1SP4 A;  3V2N A;  5APQ A;  4N6J A;  3LIE A;  1H89 A;  1GK6 A;  4WBA A;  5AW8 B;  4ZKU A;  1AQ5 A;  3RK2 B;  3B5N C;  1QL1 A;  3A3Y B;  1GTW A;  3RK3 D;  1J2J B;  1N7L A;  3BVH A;  1ZR2 A;  5KJ7 D;  1KZU B;  3GHG A;  1JTH A;  1FZA A;  1RY3 A;  3KDP B;  3HUS A;  1SQV K;  4XA4 A;  2M8R A;  3NTN A;  2L5G B;  1KIL C;  3M0D C;  1HH0 A;  4KHX A;  5AW0 B;  2I1J A;  4C7R A;  2C0X A;  1GU4 A;  1GU5 A;  4C7N A;  4IFD K;  3RL0 B;  5BU8 B;  3TNU A;  3RK2 C;  3B5N D;  2A45 H;  4W80 A;  3H32 B;  3TSI A;  1N7S C;  1CW5 A;  4Y99 C;  1DH3 A;  1N73 A;  1IFD A;  1G2C B;  1JMM A;  2PAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...