3NFQA

Crystal structure of the conserved central domain of yeast spn1/iws1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
b'DDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IWS1
publication title The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nfqA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3nfqA02
3V5BA 2WPSA 1H89A 1S9KD 2B4JC 4C7NB 5AVXB 3NTNA 5AW8B 1FOSF 5APSA 4RESB 3TNUA 3P8MC 2R5DA 5AW5B 5AW7B 3V4WA 3F9KC 3U88C 3HE4A 2Q3IA 3VN0A 1S9KE 2C9NY 2P7JA 1H8AA 3L36A 3P32A 5AW9B 2IPPA 2QM7A 5APYA 1Z9EA 1WJTA 5AVWB 2XPPA 4B86A 3LIEA 1T2KC 1HBWA 1CI6A 5AVUB 1SP4A 4KHXA 5APTA 2WT7A 3HPGG 3NMDA 3VYIA 3TYYA 4AYCA 4I2LC 3UIAA 1FAVA 2YNYA 4JYCA 1H88A 3NXSA 2Q5UA 1CZQA 1JUNA 2ZXEB 1JNMA 4AQRD 2JJLA 1MFZA 3A7OA 3VMZA 2BASA 3M0AA 1HUCA 3M06A 5AVTB 1SLQA 2XPNA 3A2AA 3M9HA 1FOSE 3HPHE 3M9BA 2N9BA 5AW0B 2VRSA 3VTPC 2WWWA 2R32A 5AW2B 5CMZA 4JYBA 1GK4A 1NAFA 4I6MC 1J2JB 4C7NA 1GZLA 1KQLA 1DH3A 1GU4A 2XU6A 5AVZB 5AW1B 3B8EB 1YYCA 5AVQB 2KP8A 2WTYA 1A02J 2XPLA 3HE5B 3T97A 1T2KD 1HJBA 3LIDA 3NFQA 4LC1A 4GT1A 5APXA 5AVSB 1GU5A 5AVYB 1X8YA 4GKGA 3KQGA 2R5BA 3M91A 3O8ZA 5APQA 1GTWA 2Q7CA 3L37A 5AW4B 2XPOA 3TNUB 1MV8A 2C9LY 2XV5A 3OAKA 2P2UA 2P67A 2R3CA 3A5TA 1GD2E 3HTKA 3HE4B 3IR9A 5APVA 4C46A 4EOTA 2Z5HA 2H7HA 2XZRA 3VMXA 3SWFA 2W27A 1IO4A 4XE5B 5AW6B 1MUUA 4HYTB 1OWAA 3L35A 4DZOA 2QM8A 1CI6B 2WPRA 2N3AB 2WPQA 3MD0A 3M0DA 3MGNA 2WT7B 3V4QA 3VMYA 2ZFCA 3KDPB 2Z5IA 3A3YB 5APWA 3TK1A 1CSBA 3HE5A 3I5CA 1NWQA 1HWTC 2YO2A 2W6AA 2E43A 4M3LA 2YO3A 3P7KA 2E42A 5AW3B 1A02F 1EO0A 1GK6A 5AVVB 5AVRB 4AUWA 1OXZA 1G2CB 5APUA
chains in the Genus database with same CATH superfamily
4H0LD 4WB4A 1NU1D 3AE9C 1SQQD 4U3FG 5AW5B 3L75E 1VQ6P 1QLED 2JKVA 4WY4C 1FC2C 3MZWB 1YI2P 1BE3J 3L72J 2QM7A 1NTMG 1PGQA 1YJ9P 3BATA 1KB9E 1BCCE 1OFCX 1LT1A 3BI1A 1L0ND 1RE4C 3GF3A 2WSFJ 5KLVG 2HR3A 3B5ND 1SQVK 4JYWA 1P84E 4JQ0D 4A7PA 2XKMA 3U1CA 3PLNA 4WY4D 4P4BA 1GU4A 5AVQB 2KP8A 1Z8LA 5BY0A 2WZ7A 1KD1Q 3PRJA 3SJFA 4LC1A 3CX5H 5APXA 1ZXGA 4GKGA 1M56D 5APQA 3L37A 1JY3N 4BPUB 4YTPC 4K35A 3SWFA 1IO4A 4NGRA 2M3BA 1KORA 4UB6H 2POHA 3GHGC 3SWKA 1YQ4C 3VRQA 3I5CA 1SQXK 3L71E 1A02F 1LTJC 2YKPA 1PPJE 2FYNB 4L76A 4OH8B 2IZ1A 5KLIC 2WPSA 3CCVP 2JP3A 1PP9J 3CXHE 4XA4A 3FWLA 3H1HD 1SQBG 3F9KC 3CD6P 3VRPA 1JO5A 2P7JA 1PIXA 3U1AA 2IPPA 4GODA 2LXCB 1U57A 1H88A 3AEBC 2YNYA 3S9OA 3BCCD 1HUCA 1JCCA 3M06A 1S5LH 1KTMA 5TISE 3MUDA 2BCCD 1BE3G 1AQ5A 5E79E 5AVZB 5AW1B 2WITA 3W68A 2IFNA 3RBXA 2ZAEB 1M57D 2AEMA 1NTKK 5AVSB 1NTME 3BVHA 2R5BA 2RKLA 4W9YA 3O8ZA 4JZ0A 1QX8A 3ABVC 1LTJB 3W67A 3VGOA 2GUSA 2QG4A 4DZOA 1RE3A 2WPRA 2E74B 2QJPC 3V2NA 1Q2NA 3TK1A 3TGUG 5H2FE 2MJZA 2L5GB 5AVVB 3G6EP 3HRNA 1OX3A 2YMKA 1J1EC 4OC5A 3CL3D 4OWFA 3H1IE 2JWAA 1LTTC 4OGQC 1Z56A 2C9NY 1J1DC 3QWOC 1ZOYC 2Y9YA 3I56P 1DEBA 4EI2A 5AVWB 3VRRA 3LIEA 1CI6A 4AYCA 1EXJA 1ZW0A 1LJ2A 3H1JJ 1ZRTD 5CCHC 3D7DA 4AQRD 1PP9G 2M8RA 2QSIA 4P4IA 2M0BA 2ZYAA 2Y0DA 1NU1K 1NHLA 2E5TA 1BGYJ 2FFDC 1SQQK 1J2JB 4OGQD 2GA1A 2O01N 2KI7B 4MCQA 2PVWA 1SQBE 5CCGC 4PJ0E 2FFDA 2RH0A 3D70A 5KAFE 5CCHD 2W8ZA 1L0NK 3D7FA 1NTKJ 1X8YA 3SFDC 3M91A 1L4AA 2FYUE 1KYOI 5CCGA 1MV8A 2E75C 2KLUA 3A5TA 3PT1A 3IR9A 3WUTA 4D6TD 2JDIH 1M8OB 1KN7A 1CI6B 2K3RA 4YPCA 2Z5IA 4OGQB 3L72E 1J1DB 2YIUB 3WMM0 2H43A 2A45I 5AVRB 2FY8A 3FEDA 3D6ZA 4U7JA 1NTZJ 3BRTB 5KTBA 3NTNA 4BPWB 4N3YB 2QEXP 2AEFA 4A4CA 4H44C 3CCMP 1FU1A 2YKQA 2FFDB 3G71P 2XPPA 4TLFA 3MHVA 4L73A 4P4JA 1FZBA 4CPGA 1RF1A 1IC2A 4BRYA 4IFMA 1JY2O 1M7LA 1AFOA 1NU1J 3ZDMA 2P1JA 4C7NA 3I55P 3L73D 1EDLA 4C7RA 4H44D 2E75B 3L71J 2BEQD 3T97A 1ZMEC 3GG2A 2QJKC 3QH9A 3H1JG 1M90Q 3CX5E 2QRXA 4YXWH 4W80A 3WUVA 4ASWA 3PHLA 3CWBD 3ITKA 1BGYG 2DLAA 2VKZG 2XV5A 1S5LX 1PP9E 1N73C 2XZRA 2ZYGA 4UB6E 3L35A 1L0LD 2RN0A 4H13C 4KT0J 2N3AB 1NYHA 2HYNA 3VMYA 4H44B 1LTGC 3L75G 4P4FA 5AW3B 2M3EA 2IDBA 2HLOA 3C9IA 4BRYB 4AUWA 1M1KQ 4MCRA 3BRVB 1BCCG 2OYIC 1JTHA 1SQVE 4C7NB 1N7SC 4RESB 3P8MC 3KZIH 4DCKA 1W5CE 3T97B 4H13D 3FEEA 1RF0C 1AJYA 1OVRA 2OYIA 5APYA 2ITAA 1N7SA 2K37A 3EWKA 5AVUB 4X3RA 3UIAA 2Q5UA 3G3ZA 2J59M 2HG5D 3SSUA 3H1KD 3VMZA 2QJKB 1S5LE 1NTZG 1RF0A 2OR4A 3VP9A 2WSCH 3RK3C 5KKZC 2Q3EA 4PD4H 1N7SD 5AW2B 1VF5C 2M5AB 3BUXB 2R44A 4IOIH 1VQOP 1A02J 1Q86Q 2OYOA 1N73B 2ZYDA 1URQC 1VQ9P 3H25A 3BUOB 4H13B 5AVYB 2WSCJ 3KQGA 5CBNA 3H1IJ 1JTHB 4W7YA 2V4HA 1MFTA 4WWIA 1LT9C 1VF5D 2Q1KA 3HTKA 3B4SA 3KHUA 3L71G 1EDIA 2K1AA 2W6JH 4HYTB 1EZVD 1PPJG 2OYIB 1NJIQ 1N7SB 4GOEA 3U59A 1URQD 3A3YB 5APWA 2Y0EA 1HWTC 4OC2A 4DOJA 2CIJA 2KNCA 3H1JE 5CHXA 3H32A 3AEDC 3D7HA 3E1IA 3L70D 2OYHC 1FDOA 3HD7C 3V4WA 3RK3B 5KKZB 1BGYE 3VOPA 1VF5B 2K9JA 2OYHA 1HBWA 4KHXA 3NMDA 2FYUJ 2V7QJ 3G9RA 1KB9I 3B5NC 1GL2C 1ZN5A 3VRNA 1URQB 1AVYA 1NTKE 2JBKA 1FS0E 1FZAA 1FJPA 4OMEA 3HTKB 3Q5SA 3P8CE 3B5NA 1BSNA 3HD7D 2JEEA 3CCJP 2HODB 2KLVA 1PZQA 1X9VA 2IBZE 2BEZF 1SQPD 4WY4A 5BVZA 4HH2A 1LP1B 3NFQA 1GL2D 2KNCB 1KV4A 2KYVA 3H32B 4EIJA 3PJSK 1K73Q 1RE4A 3SJGA 3Q3DA 2ZVNB 2A45H 1Q90D 3CXHD 1VQ8P 3KXDA 1KILC 2N1TC 4H0LB 3O6QA 1NTZE 3OA7A 2GUVA 2H7HA 4PV1C 2W27A 2A06D 2K9JB 3AEEC 2L91A 5M1BA 3WUUA 2OYHB 3HD7B 1X22A 1LNQA 3KDPB 1CSBA 2W6AA 3H1IG 2PVVA 2YKOA 1VL2A 1LTSC 1MKMA 3P7KA 1Y47A 4Y28J 2XNXA 3B5NB 1GL2B 1M1JC 1S9KD 1KILD 1RQVA 1S1CX 2B4JC 2N1TD 1AVOA 3CXHI 4PV1D 1ZLLA 3EFGA 3N4XA 3D7GA 1NU1E 4D6TJ 3P32A 2O01H 4U3FD 1SQQE 4WY4B 1S3JA 1S4XA 1L0LK 1M1JA 3PH0A 1WJTA 4IL6H 4JPZB 1IZNB 1W2BO 3GHGA 1NGMB 4JYCA 1NTMD 3FGAD 2ZXEB 3CCSP 1HH0A 2Q6QA 5F09A 2WMMA 1LTJA 5KLVD 3O6QB 5AW0B 1NKZB 4BXLA 1IK9A 2O01J 3RL0C 1S72P 2KOGA 1HVVA 2N1TB 2WTYA 2FYUG 4NGQA 4BWNA 1IJDB 1SQVJ 1X79B 1EXIA 5HKWA 4EDFA 4OC1A 3L72G 2P67A 4L74A 1T3UA 2W6BA 3MIWA 1YQ3C 1T6AA 3RL0D 3OB2B 2XEIA 1M1JB 2H8PD 4IFFA 1YJNP 3L73J 2NPSC 3MD0A 1VQ5P 3V4QA 3GHGB 3GF7A 3FWNA 1JY3P 2HFED 1NVOA 2IYOA 4Y99C 3ZNIA 2IYPA 2PFXA 1USDA 1IFMA 1HTLC 3CWBJ 1YIJP 5KLIB 1WRGA 5AW8B 1FOSF 3KZIE 1GMJA 5CJ0A 2NPSD 4LGDE 1SQBD 1Z9EA 1L0LJ 3RGUA 3RL0B 3VMAA 1SQXJ 3VYIA 3Q1MA 1JY2N 3RK2D 2JWDA 4XFJA 4P44A 1QVFO 4PD4E 4WBAA 1JOCA 1USEA 4OC0A 2N9BA 4NPDA 2VRSA 4D6TG 1OW8A 4I6MC 3EFFK 4I1LA 3CCEP 3Q5PA 3CCRP 1YYCA 2BCCE 2G8YA 5BU8B 1BE3D 3L74D 1FE6A 3VP8A 4N78E 1KYOD 2LR2A 3CMEP 3G4SP 1QVGO 1KZUB 1G1JA 1HGZA 3PTZA 1MZ9A 3A0HH 3V2RA 2C0XA 3H1KJ 5CCHA 4RKUJ 3A0BH 4Y99B 3Q2YA 1PV3A 3R2PA 3GMAA 1IFIA 1HGVA 2WPQA 2QJPB 3C1LA 2WPVB 5L8RJ 1SQVG 4ZMDA 1SQPK 5CBOA 3AE5C 1JB0J 1VQ7P 2YO3A 2E42A 4UB8H 3TGUD 3IFMA 1G2CB 3F5HA 1J1EB 2KB7P 5AW7B 3L73G 5B66H 2Q3IA 3VN0A 2D2CC 2DW3A 3CX5D 3TYYA 1U7JA 1FZFA 1JNMA 2XPNA 3HPHE 1ZRTE 2WWWA 1PP9D 3AEGC 3L70J 4ZKPA 1YITP 1DH3A 2H89C 2E5YA 1SQXG 2D2CD 2MKVA 1SFCC 5ELYA 1PGJA 1RY3A 4A4BA 1H0TA 1NTMK 3CX5I 1YTZI 4IFDK 4IL6X 3H1LD 1GTWA 1K04A 2RMZA 2B89A 1SQQJ 5KLVK 3VROA 4W7ZA 3AECC 1GD2E 1QEXA 2OTLP 1ZR2A 1X0TA 3AE7C 3MGNA 4D6TE 1SFCD 2QE7H 2JO1A 1YBKA 2J5UA 4NGSA 3JCUH 1LWUC 1L0NJ 1SQPJ 3H1KG 1GK6A 2K9YA 2SPZA 2FKWB 1LWUA 2M5AA 3TNUA 1HJ0A 3IF4A 3GLMA 1AQTA 4NGPA 3HE4A 3C8VA 3AE6C 1H8AA 1NTKG 4GDOA 1N73A 4EYYQ 4R4LA 2QIWA 4IL6E 4BTFA 1SP4A 3B71A 1QL2A 1FZCC 2ZVOB 1H0TB 1FAVA 2O1JA 2C6CA 3A7OA 2I1KA 1SLQA 1BDDA 3A2AA 2IBZG 4HB1A 1FZCA 3OW2O 3L4FA 1NAFA 3FXEA 1OVVA 3BI0A 2YXQB 3S1KA 1SQBK 2IFMA 3L73E 4U3FJ 1OW6A 1U7MA 2NZ2A 2PAJA 3H1JD 2ZT9C 1LWUB 1E5WA 2FBWC 3TNUB 3L70G 2XEFA 3H1HJ 3CWBE 3HE4B 2E76C 4JBZA 3USSA 1BGYD 1PGPA 2Z5HA 1OWAA 5J3XA 1HF9A 5KAIH 3R4YA 3V2PA 1L0LE 2R3SA 4KJMA 1SQXE 1URQA 1NU1G 3BCCJ 2ZT9D 2W90A 1SQQG 1FZCB 3L75D 2G3AA 1FDMA 3FXDA 1H89A 2BCCJ 3BXMA 5TJHA 2E76D 2HODA 1N8RQ 5DJTB 1KB9D 1BCCD 1LT9A 2KSJA 1L0NG 1VQLP 1LP1A 5B5EH 3JC22 1VQNP 3HPGG 2O3JA 1EDKA 1P84D 1CZQA 4LLHA 3AEAC 3AEFC 2JJLA 1KFNA 3CMAP 3M9HA 1FZGA 3SFEC 3H1KE 1NTZD 2R32A 2ZT9B 3GW6A 5GTIH 5CMZA 4NGTA 4OC3A 3AE2C 2K88A 3HD7A 4OVNF 4MCPA 2E76B 1KQSO 2IBZI 3CLQA 3PFVA 1G1IA 2KIKA 3A0HE 1RHZB 1XTGB 1KYOH 1P84I 5KJ7C 1GL2A 3CC2P 3A0BE 3KASA 2ZXXA 1K9MQ 2C6PA 2OOTA 2P2UA 1LT9B 2I8DA 3AE4C 4RJTA 4C46A 3RK3E 3CCLP 3F89A 1YVHA 3TDKA 5AW6B 1QL1A 5KJ7A 2KK7A 3II6A 1VQ4P 3E7KA 3OP0A 1K05A 1GW3A 1N86A 3L71D 1PPJD 1WMKA 1EZVE 3L74J 4UB8E 2FYNC 1VQPP 4P4EA 1OIPA 3PP5A 3H1HG 5KJ7D 4NPEA 1OXZA 4ZNCA 1PL5A 1NKNA 4O9BA 5B66E 3CCQP 2YMYA 1KILA 2XEGA 1PFIA 2N1TA 2KUBA 3L70E 3HMJG 1KC8Q 4MCSA 2O1KA 3S9MA 1Y8AA 5K5GB 5HKZA 3BCCG 4TT3H 1VQMP 1JUNA 2Z4EA 1N7LA 1MFZA 4Z1MH 2BASA 5GTHH 1DX7A 2BCCG 4LQGA 2P58A 3TGUJ 2Y1NA 1FJKA 3D71A 3HUSC 1IFJA 1GK4A 1VQKP 2XU6A 1DD4A 1YHQP 3SJEA 3HUSA 1FDIA 4HKZH 4GT1A 1L0NE 1SQPE 3IN6A 1WT6A 5AW4B 3SJXA 1JMBA 1L2PA 1KILB 3H6PA 1MUUA 1TU3F 4PV1B 2E74C 3JCUE 2A06E 2FXPA 2E43A 1YTZT 2IX7C 2XNDH 1AA0A 1NAYA 3MUDC 1EQ7A 3LW5H 4PD4D 3H1ID 5F13A 4BPXB 1PGOA 3H1LJ 3V5BA 1Q7YQ 4QMAA 5APSA 2KZIA 1S9KE 1KILE 2E74D 4GIFA 3HUSB 2CPBA 1UIXA 3M9QA 3RK2C 3L74G 4N78D 2YXRB 1R8EA 2NPSA 4OC4A 1LTAC 4I2LC 4U3FE 2B88A 3K5BA 3LW5J 2CK3H 3FECA 1KQFB 3SWYA 4P4DA 1Q82Q 1KFMA 3E1RA 4DJGA 1DE4C 4PD4I 1JCDA 1BDCA 2QA4P 3H1HE 1RE3C 2W83C 1GZLA 5KLVE 1DD3A 3V6IA 3V2QA 2A45G 1HJBA 2PGDA 4GOFA 2FYUD 4R4MA 3S9LA 1JMMA 1DIPA 2Y0CA 5D29A 1G2CA 1OZHA 2AXTH 3BCCE 3S9NA 2FYZA 2H88C 2R3CA 2NRGA 1FBMA 1NTZK 1SS1A 4NPFX 3L72D 3BUWB 2Y9ZA 2QM8A 1XTCC 2FXMA 1JY3O 3CI9A 1S2EA 1RQUA 2NPSB 4N6JA 5EFWB 5KAIE 2ZFCA 1FZEA 2YIUC 5DJUB 3Q5RA 1LGHB 3RK2B 3CCUP 3WU2H 1R5LA 4YXDC 3BUNB 3U88C 2OARA 1T8ZA 1LTIC 2C6GA 1EC5A 3TSIA 3RBUA 1NO4A 1KB9H 5B5EE 2WT7A 1D7MA 2JBJA 4ASVA 2LXBA 2C0WA 1VPCA 1L4AC 3H1LG 1FOSE 1P84H 2QJYC 2CPSA 2KXPB 3L75J 5GTIE 2AEJA 2B87A 1JY2P 1ZV8A 1KQLA 3B8EB 1BCCJ 3OB1B 1BSHA 3LIDA 2PRRA 2I1JA 3CWBG 2OTJP 1BE3E 1L4AD 5CCGD 3L74E 5CJ4A 1KYOE 5HKYA 1E79H 2Q7CA 3M0DC 2C9LY 3N7NA 2HPCA 1FBVA 1L0LG 3AE3C 4EOTA 3VMXA 2E75D 4XE5B 1OMIA 4I7ZC 1UIIA 1K8AQ 1W2EA 2WVRA 4L75A 3M0DA 2WT7B 3RL0g 3CPWO 4NGNA 1GW4A 2YO2A 5C39A 1SFCA 1RF1C 1SQVD 3EQ2A 1EO0A 4NGMA 1NOHA 3BASA 1ZR4A 1L4AB 5AXIA 5AVXB 2B87B 3TGUE 3CXHH 3OJAB 3FF3A 2QJYB 3JSVC 1EDJA 4RO0A 2WSSH 3PLFB 5AW9B 2D2CB 2B9BA 4B86A 1T2KC 3BHXA 5APTA 1SVFA 1RH5B 3NXSA 3IWWA 5GTHE 3M0AA 1N2DC 2QVAA 2HPCB 3M9BA 1KQGB 5TISH 3VTPC 4JYBA 3AE1C 5E79H 2OQQA 3KYQA 1OVUA 4JF7A 1T2KD 2FXOA 4I7ZB 1JM0A 1KMIZ 1SFCB 2KS1A 1QGKB 4P45A 1SQXD 2OTKE 1GU5A 3MP7B 1LTBC 2XPOA 1RF1B 2KSEA 1EZVG 2WSEH 2UWJE 3H1LE 3CC4P 5APVA 2KZJA 2XDJA 2XEJA 1YJWP 2IZ0A 5BU5A 1DEEG 4RR2B 1IK7A 3TF5A 3HE5A 1NTMJ 1R5SA 4M3LA 2Y1MA 5H2FH 2FYUK 1AV1A 2P10A 2WSEJ 5KLVJ 1Q81Q 2GM4A 3KPEA 3BUMB 2R5DA 1IFNA 3D6YA 2AXCA 2JR8A 3L36A 1IFDA 2KS1B 4ZKUA 3S4RA 1NTKD 4GPLB 3P8CD 1T3JA 3AE8C 1Y9BA 5AVTB 2J58A 2LKMA 2PP6A 3RBZA 1CW5A 1B47A 3RK3D 2IBZD 2Q9IA 3IAOA 1SQPG 2ZJSE 1NH4A 2XPLA 3HE5B 2UV8G 4PJ0H 4DT0A 5KAFH 1OW7A 2OGUA 4WVZA 1JEKA 2AXTE 1GDTA 1ZP0C 2V7QH 4H0LC 2A06G 3OAKA 4HJGH 3CC7P 2N9YB 2WQYC 1SQBJ 3MTUE 3FX0A 4MN4C 1CX8A 1IFPA 1NWQA 1EZVI 2CBLA 1VDFA 4K3AA 3WU2E 2WSFH 5APUA
chains in the Genus database with same CATH topology
3BRVB 3V5BA 4WB4A 2OYIC 1JTHA 1J1EB 4C7NB 2KB7P 1N7SC 5APSA 4RESB 3P8MC 5AW5B 5AW7B 4WY4C 2Q3IA 3VN0A 1S9KE 4GIFA 3HUSB 2CPBA 3M9QA 1RF0C 3RK2C 2OYIA 2QM7A 5APYA 4N78D 3BATA 1N7SA 5AVUB 1G2CB 2NPSA 1LTAC 3TYYA 4I2LC 3UIAA 2Q5UA 3G3ZA 1RE4C 1FZFA 2J59M 1JNMA 2HG5D 3VMZA 3SWYA 3B5ND 1SQVK 1RF0A 2XPNA 3HPHE 3VP9A 2WSCH 3RK3C 1KFMA 2XKMA 2WWWA 1JCDA 1N7SD 5AW2B 3U1CA 1RE3C 1GZLA 4ZKPA 4WY4D 1DH3A 1GU4A 5AVQB 2KP8A 3V2QA 2A45G 1A02J 1N73B 1SFCC 2WZ7A 1URQC 1HJBA 4LC1A 1RY3A 5APXA 5AVYB 1NTMK 4GKGA 1JMMA 1YTZI 3KQGA 4IFDK 1G2CA 5APQA 1JTHB 4W7YA 1GTWA 3L37A 1JY3N 2FYZA 1LT9C 5KLVK 4W7ZA 2R3CA 1GD2E 3HTKA 1FBMA 1NTZK 3SWFA 1IO4A 4HYTB 2M3BA 1ZR2A 2OYIB 2POHA 1N7SB 2QM8A 1XTCC 2FXMA 1JY3O 3GHGC 3CI9A 3MGNA 1SFCD 2NPSB 4N6JA 1URQD 3U59A 2ZFCA 1FZEA 3A3YB 5APWA 1LWUC 1HWTC 3I5CA 1SQXK 4DOJA 1LGHB 3RK2B 1A02F 1LTJC 2YKPA 1GK6A 5CHXA 3H32A 4OH8B 2FKWB 3E1IA 1LWUA 2WPSA 4XA4A 2OYHC 3HD7C 3TNUA 3V4WA 3F9KC 3RK3B 3U88C 2OARA 1T8ZA 1LTIC 3HE4A 1JO5A 2P7JA 3VOPA 1H8AA 3TSIA 1N73A 3U1AA 2IPPA 1NO4A 2OYHA 1HBWA 1SP4A 4KHXA 2WT7A 1QL2A 1FZCC 3NMDA 1H88A 1FAVA 2YNYA 3B5NC 2C0WA 2O1JA 1VPCA 1GL2C 1ZN5A 1L4AC 1URQB 3A7OA 2I1KA 1HUCA 1JCCA 3M06A 1SLQA 3A2AA 1FOSE 1FZAA 1FJPA 3HTKB 1FZCA 2CPSA 3P8CE 3MUDA 3B5NA 3HD7D 2JEEA 3L4FA 1NAFA 1JY2P 1AQ5A 1ZV8A 2HODB 2KLVA 1X9VA 1KQLA 5AVZB 5AW1B 2WITA 2IFNA 3B8EB 1SQBK 2IFMA 4WY4A 3LIDA 2I1JA 5BVZA 4HH2A 3NFQA 1GL2D 1NTKK 1L4AD 5AVSB 2PAJA 5CCGD 2KYVA 3H32B 5CJ4A 3BVHA 2R5BA 4EIJA 1LWUB 3O8ZA 1RE4A 1E5WA 2Q7CA 2A45H 3TNUB 3M0DC 2C9LY 3N7NA 1KILC 1LTJB 2N1TC 2HPCA 2GUSA 3OA7A 3HE4B 2GUVA 4EOTA 2Z5HA 2H7HA 3VMXA 2W27A 4XE5B 1OWAA 4DZOA 1W2EA 1RE3A 2OYHB 3HD7B 2WPRA 3V2NA 3M0DA 2WT7B 3KDPB 3TK1A 1CSBA 3V2PA 1GW4A 2YO2A 2W6AA 2YKOA 1LTSC 1SFCA 2MJZA 3P7KA 1URQA 1RF1C 3EQ2A 2L5GB 1EO0A 5AVVB 1FZCB 3HRNA 1NOHA 2XNXA 1FDMA 3B5NB 3BASA 1GL2B 1J1EC 1M1JC 1ZR4A 1L4AB 3CL3D 1KILD 1S9KD 1H89A 2B4JC 2N1TD 5AVXB 3OJAB 2HODA 1ZLLA 3EFGA 1LTTC 1LT9A 3N4XA 1Z56A 2C9NY 1J1DC 3P32A 2O01H 4WY4B 2KSJA 5AW9B 1L0LK 1M1JA 1DEBA 1WJTA 5AVWB 4B86A 3LIEA 1T2KC 1CI6A 5APTA 3HPGG 1SVFA 3GHGA 4AYCA 4JYCA 3NXSA 1CZQA 2ZXEB 4LLHA 5CCHC 4AQRD 2JJLA 1KFNA 1HH0A 3M0AA 2M8RA 3M9HA 1N2DC 2HPCB 1LTJA 3M9BA 1FZGA 5AW0B 3VTPC 1NKZB 1NU1K 2R32A 1NHLA 1IK9A 5CMZA 4JYBA 2FFDC 1SQQK 1J2JB 3RL0C 3KYQA 2KOGA 3HD7A 1HVVA 2N1TB 2WTYA 4JF7A 1T2KD 5CCGC 1SFCB 3CLQA 2FFDA 1G1IA 1IJDB 5CCHD 1X79B 1L0NK 1GU5A 1X8YA 3M91A 1XTGB 5KJ7C 1GL2A 1L4AA 5CCGA 1LTBC 2XPOA 1RF1B 1MV8A 2WSEH 2P2UA 2P67A 1T3UA 2W6BA 1LT9B 3MIWA 3A5TA 5APVA 3IR9A 4C46A 2XDJA 3RL0D 5AW6B 1QL1A 5KJ7A 3II6A 1M1JB 2H8PD 4IFFA 5BU5A 2NPSC 1CI6B 3MD0A 1GW3A 1N86A 3V4QA 3GHGB 2Z5IA 1JY3P 3HE5A 1J1DB 2HFED 4M3LA 4Y99C 2FYUK 3WMM0 2H43A 3PP5A 5KJ7D 2A45I 5AVRB 1OXZA 1IFMA 2GM4A 1HTLC 3KPEA 3BRTB 1NKNA 5KTBA 1WRGA 4O9BA 3NTNA 5AW8B 1FOSF 4N3YB 2R5DA 1IFNA 2YMYA 1KILA 1PFIA 2N1TA 1FU1A 2YKQA 3L36A 5CJ0A 2NPSD 1IFDA 4LGDE 2O1KA 2FFDB 1Z9EA 2XPPA 4ZKUA 3RL0B 3VYIA 1JY2N 3RK2D 1JUNA 2Z4EA 1FZBA 1N7LA 3P8CD 1T3JA 1MFZA 2BASA 1DX7A 5AVTB 2J58A 2LKMA 1RF1A 4WBAA 1JOCA 1IC2A 2N9BA 1FJKA 2PP6A 2VRSA 4IFMA 1CW5A 3HUSC 1JY2O 1M7LA 3RK3D 1IFJA 1AFOA 1GK4A 4I6MC 2P1JA 2Q9IA 4C7NA 4I1LA 4C7RA 2XU6A 1YYCA 1NH4A 5BU8B 2XPLA 3HE5B 3HUSA 3T97A 3VP8A 4N78E 4GT1A 1KZUB 1G1JA 1HGZA 4W80A 1MZ9A 1GDTA 3V2RA 1WT6A 2C0XA 5CCHA 5AW4B 4Y99B 2XV5A 3OAKA 1KILB 3R2PA 3H6PA 1N73C 2XZRA 1MUUA 3L35A 1IFIA 3MTUE 1HGVA 2N3AB 2WPQA 2HYNA 3VMYA 1SQPK 1NWQA 1LTGC 2E43A 1YTZT 2IX7C 2YO3A 2E42A 5AW3B 2HLOA 3C9IA 1EQ7A 3LW5H 1VDFA 2WSFH 4AUWA 3IFMA 5APUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V5B A;  2WPS A;  1H89 A;  1S9K D;  2B4J C;  4C7N B;  5AVX B;  3NTN A;  5AW8 B;  1FOS F;  5APS A;  4RES B;  3TNU A;  3P8M C;  2R5D A;  5AW5 B;  5AW7 B;  3V4W A;  3F9K C;  3U88 C;  3HE4 A;  2Q3I A;  3VN0 A;  1S9K E;  2C9N Y;  2P7J A;  1H8A A;  3L36 A;  3P32 A;  5AW9 B;  2IPP A;  2QM7 A;  5APY A;  1Z9E A;  1WJT A;  5AVW B;  2XPP A;  4B86 A;  3LIE A;  1T2K C;  1HBW A;  1CI6 A;  5AVU B;  1SP4 A;  4KHX A;  5APT A;  2WT7 A;  3HPG G;  3NMD A;  3VYI A;  3TYY A;  4AYC A;  4I2L C;  3UIA A;  1FAV A;  2YNY A;  4JYC A;  1H88 A;  3NXS A;  2Q5U A;  1CZQ A;  1JUN A;  2ZXE B;  1JNM A;  4AQR D;  2JJL A;  1MFZ A;  3A7O A;  3VMZ A;  2BAS A;  3M0A A;  1HUC A;  3M06 A;  5AVT B;  1SLQ A;  2XPN A;  3A2A A;  3M9H A;  1FOS E;  3HPH E;  3M9B A;  2N9B A;  5AW0 B;  2VRS A;  3VTP C;  2WWW A;  2R32 A;  5AW2 B;  5CMZ A;  4JYB A;  1GK4 A;  1NAF A;  4I6M C;  1J2J B;  4C7N A;  1GZL A;  1KQL A;  1DH3 A;  1GU4 A;  2XU6 A;  5AVZ B;  5AW1 B;  3B8E B;  1YYC A;  5AVQ B;  2KP8 A;  2WTY A;  1A02 J;  2XPL A;  3HE5 B;  3T97 A;  1T2K D;  1HJB A;  3LID A;  3NFQ A;  4LC1 A;  4GT1 A;  5APX A;  5AVS B;  1GU5 A;  5AVY B;  1X8Y A;  4GKG A;  3KQG A;  2R5B A;  3M91 A;  3O8Z A;  5APQ A;  1GTW A;  2Q7C A;  3L37 A;  5AW4 B;  2XPO A;  3TNU B;  1MV8 A;  2C9L Y;  2XV5 A;  3OAK A;  2P2U A;  2P67 A;  2R3C A;  3A5T A;  1GD2 E;  3HTK A;  3HE4 B;  3IR9 A;  5APV A;  4C46 A;  4EOT A;  2Z5H A;  2H7H A;  2XZR A;  3VMX A;  3SWF A;  2W27 A;  1IO4 A;  4XE5 B;  5AW6 B;  1MUU A;  4HYT B;  1OWA A;  3L35 A;  4DZO A;  2QM8 A;  1CI6 B;  2WPR A;  2N3A B;  2WPQ A;  3MD0 A;  3M0D A;  3MGN A;  2WT7 B;  3V4Q A;  3VMY A;  2ZFC A;  3KDP B;  2Z5I A;  3A3Y B;  5APW A;  3TK1 A;  1CSB A;  3HE5 A;  3I5C A;  1NWQ A;  1HWT C;  2YO2 A;  2W6A A;  2E43 A;  4M3L A;  2YO3 A;  3P7K A;  2E42 A;  5AW3 B;  1A02 F;  1EO0 A;  1GK6 A;  5AVV B;  5AVR B;  4AUW A;  1OXZ A;  1G2C B;  5APU A; 
#chains in the Genus database with same CATH topology
 4H0L D;  4WB4 A;  1NU1 D;  3AE9 C;  1SQQ D;  4U3F G;  5AW5 B;  3L75 E;  1VQ6 P;  1QLE D;  2JKV A;  4WY4 C;  1FC2 C;  3MZW B;  1YI2 P;  1BE3 J;  3L72 J;  2QM7 A;  1NTM G;  1PGQ A;  1YJ9 P;  3BAT A;  1KB9 E;  1BCC E;  1OFC X;  1LT1 A;  3BI1 A;  1L0N D;  1RE4 C;  3GF3 A;  2WSF J;  5KLV G;  2HR3 A;  3B5N D;  1SQV K;  4JYW A;  1P84 E;  4JQ0 D;  4A7P A;  2XKM A;  3U1C A;  3PLN A;  4WY4 D;  4P4B A;  1GU4 A;  5AVQ B;  2KP8 A;  1Z8L A;  5BY0 A;  2WZ7 A;  1KD1 Q;  3PRJ A;  3SJF A;  4LC1 A;  3CX5 H;  5APX A;  1ZXG A;  4GKG A;  1M56 D;  5APQ A;  3L37 A;  1JY3 N;  4BPU B;  4YTP C;  4K35 A;  3SWF A;  1IO4 A;  4NGR A;  2M3B A;  1KOR A;  4UB6 H;  2POH A;  3GHG C;  3SWK A;  1YQ4 C;  3VRQ A;  3I5C A;  1SQX K;  3L71 E;  1A02 F;  1LTJ C;  2YKP A;  1PPJ E;  2FYN B;  4L76 A;  4OH8 B;  2IZ1 A;  5KLI C;  2WPS A;  3CCV P;  2JP3 A;  1PP9 J;  3CXH E;  4XA4 A;  3FWL A;  3H1H D;  1SQB G;  3F9K C;  3CD6 P;  3VRP A;  1JO5 A;  2P7J A;  1PIX A;  3U1A A;  2IPP A;  4GOD A;  2LXC B;  1U57 A;  1H88 A;  3AEB C;  2YNY A;  3S9O A;  3BCC D;  1HUC A;  1JCC A;  3M06 A;  1S5L H;  1KTM A;  5TIS E;  3MUD A;  2BCC D;  1BE3 G;  1AQ5 A;  5E79 E;  5AVZ B;  5AW1 B;  2WIT A;  3W68 A;  2IFN A;  3RBX A;  2ZAE B;  1M57 D;  2AEM A;  1NTK K;  5AVS B;  1NTM E;  3BVH A;  2R5B A;  2RKL A;  4W9Y A;  3O8Z A;  4JZ0 A;  1QX8 A;  3ABV C;  1LTJ B;  3W67 A;  3VGO A;  2GUS A;  2QG4 A;  4DZO A;  1RE3 A;  2WPR A;  2E74 B;  2QJP C;  3V2N A;  1Q2N A;  3TK1 A;  3TGU G;  5H2F E;  2MJZ A;  2L5G B;  5AVV B;  3G6E P;  3HRN A;  1OX3 A;  2YMK A;  1J1E C;  4OC5 A;  3CL3 D;  4OWF A;  3H1I E;  2JWA A;  1LTT C;  4OGQ C;  1Z56 A;  2C9N Y;  1J1D C;  3QWO C;  1ZOY C;  2Y9Y A;  3I56 P;  1DEB A;  4EI2 A;  5AVW B;  3VRR A;  3LIE A;  1CI6 A;  4AYC A;  1EXJ A;  1ZW0 A;  1LJ2 A;  3H1J J;  1ZRT D;  5CCH C;  3D7D A;  4AQR D;  1PP9 G;  2M8R A;  2QSI A;  4P4I A;  2M0B A;  2ZYA A;  2Y0D A;  1NU1 K;  1NHL A;  2E5T A;  1BGY J;  2FFD C;  1SQQ K;  1J2J B;  4OGQ D;  2GA1 A;  2O01 N;  2KI7 B;  4MCQ A;  2PVW A;  1SQB E;  5CCG C;  4PJ0 E;  2FFD A;  2RH0 A;  3D70 A;  5KAF E;  5CCH D;  2W8Z A;  1L0N K;  3D7F A;  1NTK J;  1X8Y A;  3SFD C;  3M91 A;  1L4A A;  2FYU E;  1KYO I;  5CCG A;  1MV8 A;  2E75 C;  2KLU A;  3A5T A;  3PT1 A;  3IR9 A;  3WUT A;  4D6T D;  2JDI H;  1M8O B;  1KN7 A;  1CI6 B;  2K3R A;  4YPC A;  2Z5I A;  4OGQ B;  3L72 E;  1J1D B;  2YIU B;  3WMM 0;  2H43 A;  2A45 I;  5AVR B;  2FY8 A;  3FED A;  3D6Z A;  4U7J A;  1NTZ J;  3BRT B;  5KTB A;  3NTN A;  4BPW B;  4N3Y B;  2QEX P;  2AEF A;  4A4C A;  4H44 C;  3CCM P;  1FU1 A;  2YKQ A;  2FFD B;  3G71 P;  2XPP A;  4TLF A;  3MHV A;  4L73 A;  4P4J A;  1FZB A;  4CPG A;  1RF1 A;  1IC2 A;  4BRY A;  4IFM A;  1JY2 O;  1M7L A;  1AFO A;  1NU1 J;  3ZDM A;  2P1J A;  4C7N A;  3I55 P;  3L73 D;  1EDL A;  4C7R A;  4H44 D;  2E75 B;  3L71 J;  2BEQ D;  3T97 A;  1ZME C;  3GG2 A;  2QJK C;  3QH9 A;  3H1J G;  1M90 Q;  3CX5 E;  2QRX A;  4YXW H;  4W80 A;  3WUV A;  4ASW A;  3PHL A;  3CWB D;  3ITK A;  1BGY G;  2DLA A;  2VKZ G;  2XV5 A;  1S5L X;  1PP9 E;  1N73 C;  2XZR A;  2ZYG A;  4UB6 E;  3L35 A;  1L0L D;  2RN0 A;  4H13 C;  4KT0 J;  2N3A B;  1NYH A;  2HYN A;  3VMY A;  4H44 B;  1LTG C;  3L75 G;  4P4F A;  5AW3 B;  2M3E A;  2IDB A;  2HLO A;  3C9I A;  4BRY B;  4AUW A;  1M1K Q;  4MCR A;  3BRV B;  1BCC G;  2OYI C;  1JTH A;  1SQV E;  4C7N B;  1N7S C;  4RES B;  3P8M C;  3KZI H;  4DCK A;  1W5C E;  3T97 B;  4H13 D;  3FEE A;  1RF0 C;  1AJY A;  1OVR A;  2OYI A;  5APY A;  2ITA A;  1N7S A;  2K37 A;  3EWK A;  5AVU B;  4X3R A;  3UIA A;  2Q5U A;  3G3Z A;  2J59 M;  2HG5 D;  3SSU A;  3H1K D;  3VMZ A;  2QJK B;  1S5L E;  1NTZ G;  1RF0 A;  2OR4 A;  3VP9 A;  2WSC H;  3RK3 C;  5KKZ C;  2Q3E A;  4PD4 H;  1N7S D;  5AW2 B;  1VF5 C;  2M5A B;  3BUX B;  2R44 A;  4IOI H;  1VQO P;  1A02 J;  1Q86 Q;  2OYO A;  1N73 B;  2ZYD A;  1URQ C;  1VQ9 P;  3H25 A;  3BUO B;  4H13 B;  5AVY B;  2WSC J;  3KQG A;  5CBN A;  3H1I J;  1JTH B;  4W7Y A;  2V4H A;  1MFT A;  4WWI A;  1LT9 C;  1VF5 D;  2Q1K A;  3HTK A;  3B4S A;  3KHU A;  3L71 G;  1EDI A;  2K1A A;  2W6J H;  4HYT B;  1EZV D;  1PPJ G;  2OYI B;  1NJI Q;  1N7S B;  4GOE A;  3U59 A;  1URQ D;  3A3Y B;  5APW A;  2Y0E A;  1HWT C;  4OC2 A;  4DOJ A;  2CIJ A;  2KNC A;  3H1J E;  5CHX A;  3H32 A;  3AED C;  3D7H A;  3E1I A;  3L70 D;  2OYH C;  1FDO A;  3HD7 C;  3V4W A;  3RK3 B;  5KKZ B;  1BGY E;  3VOP A;  1VF5 B;  2K9J A;  2OYH A;  1HBW A;  4KHX A;  3NMD A;  2FYU J;  2V7Q J;  3G9R A;  1KB9 I;  3B5N C;  1GL2 C;  1ZN5 A;  3VRN A;  1URQ B;  1AVY A;  1NTK E;  2JBK A;  1FS0 E;  1FZA A;  1FJP A;  4OME A;  3HTK B;  3Q5S A;  3P8C E;  3B5N A;  1BSN A;  3HD7 D;  2JEE A;  3CCJ P;  2HOD B;  2KLV A;  1PZQ A;  1X9V A;  2IBZ E;  2BEZ F;  1SQP D;  4WY4 A;  5BVZ A;  4HH2 A;  1LP1 B;  3NFQ A;  1GL2 D;  2KNC B;  1KV4 A;  2KYV A;  3H32 B;  4EIJ A;  3PJS K;  1K73 Q;  1RE4 A;  3SJG A;  3Q3D A;  2ZVN B;  2A45 H;  1Q90 D;  3CXH D;  1VQ8 P;  3KXD A;  1KIL C;  2N1T C;  4H0L B;  3O6Q A;  1NTZ E;  3OA7 A;  2GUV A;  2H7H A;  4PV1 C;  2W27 A;  2A06 D;  2K9J B;  3AEE C;  2L91 A;  5M1B A;  3WUU A;  2OYH B;  3HD7 B;  1X22 A;  1LNQ A;  3KDP B;  1CSB A;  2W6A A;  3H1I G;  2PVV A;  2YKO A;  1VL2 A;  1LTS C;  1MKM A;  3P7K A;  1Y47 A;  4Y28 J;  2XNX A;  3B5N B;  1GL2 B;  1M1J C;  1S9K D;  1KIL D;  1RQV A;  1S1C X;  2B4J C;  2N1T D;  1AVO A;  3CXH I;  4PV1 D;  1ZLL A;  3EFG A;  3N4X A;  3D7G A;  1NU1 E;  4D6T J;  3P32 A;  2O01 H;  4U3F D;  1SQQ E;  4WY4 B;  1S3J A;  1S4X A;  1L0L K;  1M1J A;  3PH0 A;  1WJT A;  4IL6 H;  4JPZ B;  1IZN B;  1W2B O;  3GHG A;  1NGM B;  4JYC A;  1NTM D;  3FGA D;  2ZXE B;  3CCS P;  1HH0 A;  2Q6Q A;  5F09 A;  2WMM A;  1LTJ A;  5KLV D;  3O6Q B;  5AW0 B;  1NKZ B;  4BXL A;  1IK9 A;  2O01 J;  3RL0 C;  1S72 P;  2KOG A;  1HVV A;  2N1T B;  2WTY A;  2FYU G;  4NGQ A;  4BWN A;  1IJD B;  1SQV J;  1X79 B;  1EXI A;  5HKW A;  4EDF A;  4OC1 A;  3L72 G;  2P67 A;  4L74 A;  1T3U A;  2W6B A;  3MIW A;  1YQ3 C;  1T6A A;  3RL0 D;  3OB2 B;  2XEI A;  1M1J B;  2H8P D;  4IFF A;  1YJN P;  3L73 J;  2NPS C;  3MD0 A;  1VQ5 P;  3V4Q A;  3GHG B;  3GF7 A;  3FWN A;  1JY3 P;  2HFE D;  1NVO A;  2IYO A;  4Y99 C;  3ZNI A;  2IYP A;  2PFX A;  1USD A;  1IFM A;  1HTL C;  3CWB J;  1YIJ P;  5KLI B;  1WRG A;  5AW8 B;  1FOS F;  3KZI E;  1GMJ A;  5CJ0 A;  2NPS D;  4LGD E;  1SQB D;  1Z9E A;  1L0L J;  3RGU A;  3RL0 B;  3VMA A;  1SQX J;  3VYI A;  3Q1M A;  1JY2 N;  3RK2 D;  2JWD A;  4XFJ A;  4P44 A;  1QVF O;  4PD4 E;  4WBA A;  1JOC A;  1USE A;  4OC0 A;  2N9B A;  4NPD A;  2VRS A;  4D6T G;  1OW8 A;  4I6M C;  3EFF K;  4I1L A;  3CCE P;  3Q5P A;  3CCR P;  1YYC A;  2BCC E;  2G8Y A;  5BU8 B;  1BE3 D;  3L74 D;  1FE6 A;  3VP8 A;  4N78 E;  1KYO D;  2LR2 A;  3CME P;  3G4S P;  1QVG O;  1KZU B;  1G1J A;  1HGZ A;  3PTZ A;  1MZ9 A;  3A0H H;  3V2R A;  2C0X A;  3H1K J;  5CCH A;  4RKU J;  3A0B H;  4Y99 B;  3Q2Y A;  1PV3 A;  3R2P A;  3GMA A;  1IFI A;  1HGV A;  2WPQ A;  2QJP B;  3C1L A;  2WPV B;  5L8R J;  1SQV G;  4ZMD A;  1SQP K;  5CBO A;  3AE5 C;  1JB0 J;  1VQ7 P;  2YO3 A;  2E42 A;  4UB8 H;  3TGU D;  3IFM A;  1G2C B;  3F5H A;  1J1E B;  2KB7 P;  5AW7 B;  3L73 G;  5B66 H;  2Q3I A;  3VN0 A;  2D2C C;  2DW3 A;  3CX5 D;  3TYY A;  1U7J A;  1FZF A;  1JNM A;  2XPN A;  3HPH E;  1ZRT E;  2WWW A;  1PP9 D;  3AEG C;  3L70 J;  4ZKP A;  1YIT P;  1DH3 A;  2H89 C;  2E5Y A;  1SQX G;  2D2C D;  2MKV A;  1SFC C;  5ELY A;  1PGJ A;  1RY3 A;  4A4B A;  1H0T A;  1NTM K;  3CX5 I;  1YTZ I;  4IFD K;  4IL6 X;  3H1L D;  1GTW A;  1K04 A;  2RMZ A;  2B89 A;  1SQQ J;  5KLV K;  3VRO A;  4W7Z A;  3AEC C;  1GD2 E;  1QEX A;  2OTL P;  1ZR2 A;  1X0T A;  3AE7 C;  3MGN A;  4D6T E;  1SFC D;  2QE7 H;  2JO1 A;  1YBK A;  2J5U A;  4NGS A;  3JCU H;  1LWU C;  1L0N J;  1SQP J;  3H1K G;  1GK6 A;  2K9Y A;  2SPZ A;  2FKW B;  1LWU A;  2M5A A;  3TNU A;  1HJ0 A;  3IF4 A;  3GLM A;  1AQT A;  4NGP A;  3HE4 A;  3C8V A;  3AE6 C;  1H8A A;  1NTK G;  4GDO A;  1N73 A;  4EYY Q;  4R4L A;  2QIW A;  4IL6 E;  4BTF A;  1SP4 A;  3B71 A;  1QL2 A;  1FZC C;  2ZVO B;  1H0T B;  1FAV A;  2O1J A;  2C6C A;  3A7O A;  2I1K A;  1SLQ A;  1BDD A;  3A2A A;  2IBZ G;  4HB1 A;  1FZC A;  3OW2 O;  3L4F A;  1NAF A;  3FXE A;  1OVV A;  3BI0 A;  2YXQ B;  3S1K A;  1SQB K;  2IFM A;  3L73 E;  4U3F J;  1OW6 A;  1U7M A;  2NZ2 A;  2PAJ A;  3H1J D;  2ZT9 C;  1LWU B;  1E5W A;  2FBW C;  3TNU B;  3L70 G;  2XEF A;  3H1H J;  3CWB E;  3HE4 B;  2E76 C;  4JBZ A;  3USS A;  1BGY D;  1PGP A;  2Z5H A;  1OWA A;  5J3X A;  1HF9 A;  5KAI H;  3R4Y A;  3V2P A;  1L0L E;  2R3S A;  4KJM A;  1SQX E;  1URQ A;  1NU1 G;  3BCC J;  2ZT9 D;  2W90 A;  1SQQ G;  1FZC B;  3L75 D;  2G3A A;  1FDM A;  3FXD A;  1H89 A;  2BCC J;  3BXM A;  5TJH A;  2E76 D;  2HOD A;  1N8R Q;  5DJT B;  1KB9 D;  1BCC D;  1LT9 A;  2KSJ A;  1L0N G;  1VQL P;  1LP1 A;  5B5E H;  3JC2 2;  1VQN P;  3HPG G;  2O3J A;  1EDK A;  1P84 D;  1CZQ A;  4LLH A;  3AEA C;  3AEF C;  2JJL A;  1KFN A;  3CMA P;  3M9H A;  1FZG A;  3SFE C;  3H1K E;  1NTZ D;  2R32 A;  2ZT9 B;  3GW6 A;  5GTI H;  5CMZ A;  4NGT A;  4OC3 A;  3AE2 C;  2K88 A;  3HD7 A;  4OVN F;  4MCP A;  2E76 B;  1KQS O;  2IBZ I;  3CLQ A;  3PFV A;  1G1I A;  2KIK A;  3A0H E;  1RHZ B;  1XTG B;  1KYO H;  1P84 I;  5KJ7 C;  1GL2 A;  3CC2 P;  3A0B E;  3KAS A;  2ZXX A;  1K9M Q;  2C6P A;  2OOT A;  2P2U A;  1LT9 B;  2I8D A;  3AE4 C;  4RJT A;  4C46 A;  3RK3 E;  3CCL P;  3F89 A;  1YVH A;  3TDK A;  5AW6 B;  1QL1 A;  5KJ7 A;  2KK7 A;  3II6 A;  1VQ4 P;  3E7K A;  3OP0 A;  1K05 A;  1GW3 A;  1N86 A;  3L71 D;  1PPJ D;  1WMK A;  1EZV E;  3L74 J;  4UB8 E;  2FYN C;  1VQP P;  4P4E A;  1OIP A;  3PP5 A;  3H1H G;  5KJ7 D;  4NPE A;  1OXZ A;  4ZNC A;  1PL5 A;  1NKN A;  4O9B A;  5B66 E;  3CCQ P;  2YMY A;  1KIL A;  2XEG A;  1PFI A;  2N1T A;  2KUB A;  3L70 E;  3HMJ G;  1KC8 Q;  4MCS A;  2O1K A;  3S9M A;  1Y8A A;  5K5G B;  5HKZ A;  3BCC G;  4TT3 H;  1VQM P;  1JUN A;  2Z4E A;  1N7L A;  1MFZ A;  4Z1M H;  2BAS A;  5GTH H;  1DX7 A;  2BCC G;  4LQG A;  2P58 A;  3TGU J;  2Y1N A;  1FJK A;  3D71 A;  3HUS C;  1IFJ A;  1GK4 A;  1VQK P;  2XU6 A;  1DD4 A;  1YHQ P;  3SJE A;  3HUS A;  1FDI A;  4HKZ H;  4GT1 A;  1L0N E;  1SQP E;  3IN6 A;  1WT6 A;  5AW4 B;  3SJX A;  1JMB A;  1L2P A;  1KIL B;  3H6P A;  1MUU A;  1TU3 F;  4PV1 B;  2E74 C;  3JCU E;  2A06 E;  2FXP A;  2E43 A;  1YTZ T;  2IX7 C;  2XND H;  1AA0 A;  1NAY A;  3MUD C;  1EQ7 A;  3LW5 H;  4PD4 D;  3H1I D;  5F13 A;  4BPX B;  1PGO A;  3H1L J;  3V5B A;  1Q7Y Q;  4QMA A;  5APS A;  2KZI A;  1S9K E;  1KIL E;  2E74 D;  4GIF A;  3HUS B;  2CPB A;  1UIX A;  3M9Q A;  3RK2 C;  3L74 G;  4N78 D;  2YXR B;  1R8E A;  2NPS A;  4OC4 A;  1LTA C;  4I2L C;  4U3F E;  2B88 A;  3K5B A;  3LW5 J;  2CK3 H;  3FEC A;  1KQF B;  3SWY A;  4P4D A;  1Q82 Q;  1KFM A;  3E1R A;  4DJG A;  1DE4 C;  4PD4 I;  1JCD A;  1BDC A;  2QA4 P;  3H1H E;  1RE3 C;  2W83 C;  1GZL A;  5KLV E;  1DD3 A;  3V6I A;  3V2Q A;  2A45 G;  1HJB A;  2PGD A;  4GOF A;  2FYU D;  4R4M A;  3S9L A;  1JMM A;  1DIP A;  2Y0C A;  5D29 A;  1G2C A;  1OZH A;  2AXT H;  3BCC E;  3S9N A;  2FYZ A;  2H88 C;  2R3C A;  2NRG A;  1FBM A;  1NTZ K;  1SS1 A;  4NPF X;  3L72 D;  3BUW B;  2Y9Z A;  2QM8 A;  1XTC C;  2FXM A;  1JY3 O;  3CI9 A;  1S2E A;  1RQU A;  2NPS B;  4N6J A;  5EFW B;  5KAI E;  2ZFC A;  1FZE A;  2YIU C;  5DJU B;  3Q5R A;  1LGH B;  3RK2 B;  3CCU P;  3WU2 H;  1R5L A;  4YXD C;  3BUN B;  3U88 C;  2OAR A;  1T8Z A;  1LTI C;  2C6G A;  1EC5 A;  3TSI A;  3RBU A;  1NO4 A;  1KB9 H;  5B5E E;  2WT7 A;  1D7M A;  2JBJ A;  4ASV A;  2LXB A;  2C0W A;  1VPC A;  1L4A C;  3H1L G;  1FOS E;  1P84 H;  2QJY C;  2CPS A;  2KXP B;  3L75 J;  5GTI E;  2AEJ A;  2B87 A;  1JY2 P;  1ZV8 A;  1KQL A;  3B8E B;  1BCC J;  3OB1 B;  1BSH A;  3LID A;  2PRR A;  2I1J A;  3CWB G;  2OTJ P;  1BE3 E;  1L4A D;  5CCG D;  3L74 E;  5CJ4 A;  1KYO E;  5HKY A;  1E79 H;  2Q7C A;  3M0D C;  2C9L Y;  3N7N A;  2HPC A;  1FBV A;  1L0L G;  3AE3 C;  4EOT A;  3VMX A;  2E75 D;  4XE5 B;  1OMI A;  4I7Z C;  1UII A;  1K8A Q;  1W2E A;  2WVR A;  4L75 A;  3M0D A;  2WT7 B;  3RL0 g;  3CPW O;  4NGN A;  1GW4 A;  2YO2 A;  5C39 A;  1SFC A;  1RF1 C;  1SQV D;  3EQ2 A;  1EO0 A;  4NGM A;  1NOH A;  3BAS A;  1ZR4 A;  1L4A B;  5AXI A;  5AVX B;  2B87 B;  3TGU E;  3CXH H;  3OJA B;  3FF3 A;  2QJY B;  3JSV C;  1EDJ A;  4RO0 A;  2WSS H;  3PLF B;  5AW9 B;  2D2C B;  2B9B A;  4B86 A;  1T2K C;  3BHX A;  5APT A;  1SVF A;  1RH5 B;  3NXS A;  3IWW A;  5GTH E;  3M0A A;  1N2D C;  2QVA A;  2HPC B;  3M9B A;  1KQG B;  5TIS H;  3VTP C;  4JYB A;  3AE1 C;  5E79 H;  2OQQ A;  3KYQ A;  1OVU A;  4JF7 A;  1T2K D;  2FXO A;  4I7Z B;  1JM0 A;  1KMI Z;  1SFC B;  2KS1 A;  1QGK B;  4P45 A;  1SQX D;  2OTK E;  1GU5 A;  3MP7 B;  1LTB C;  2XPO A;  1RF1 B;  2KSE A;  1EZV G;  2WSE H;  2UWJ E;  3H1L E;  3CC4 P;  5APV A;  2KZJ A;  2XDJ A;  2XEJ A;  1YJW P;  2IZ0 A;  5BU5 A;  1DEE G;  4RR2 B;  1IK7 A;  3TF5 A;  3HE5 A;  1NTM J;  1R5S A;  4M3L A;  2Y1M A;  5H2F H;  2FYU K;  1AV1 A;  2P10 A;  2WSE J;  5KLV J;  1Q81 Q;  2GM4 A;  3KPE A;  3BUM B;  2R5D A;  1IFN A;  3D6Y A;  2AXC A;  2JR8 A;  3L36 A;  1IFD A;  2KS1 B;  4ZKU A;  3S4R A;  1NTK D;  4GPL B;  3P8C D;  1T3J A;  3AE8 C;  1Y9B A;  5AVT B;  2J58 A;  2LKM A;  2PP6 A;  3RBZ A;  1CW5 A;  1B47 A;  3RK3 D;  2IBZ D;  2Q9I A;  3IAO A;  1SQP G;  2ZJS E;  1NH4 A;  2XPL A;  3HE5 B;  2UV8 G;  4PJ0 H;  4DT0 A;  5KAF H;  1OW7 A;  2OGU A;  4WVZ A;  1JEK A;  2AXT E;  1GDT A;  1ZP0 C;  2V7Q H;  4H0L C;  2A06 G;  3OAK A;  4HJG H;  3CC7 P;  2N9Y B;  2WQY C;  1SQB J;  3MTU E;  3FX0 A;  4MN4 C;  1CX8 A;  1IFP A;  1NWQ A;  1EZV I;  2CBL A;  1VDF A;  4K3A A;  3WU2 E;  2WSF H;  5APU A; 
#chains in the Genus database with same CATH homology
 3BRV B;  3V5B A;  4WB4 A;  2OYI C;  1JTH A;  1J1E B;  4C7N B;  2KB7 P;  1N7S C;  5APS A;  4RES B;  3P8M C;  5AW5 B;  5AW7 B;  4WY4 C;  2Q3I A;  3VN0 A;  1S9K E;  4GIF A;  3HUS B;  2CPB A;  3M9Q A;  1RF0 C;  3RK2 C;  2OYI A;  2QM7 A;  5APY A;  4N78 D;  3BAT A;  1N7S A;  5AVU B;  1G2C B;  2NPS A;  1LTA C;  3TYY A;  4I2L C;  3UIA A;  2Q5U A;  3G3Z A;  1RE4 C;  1FZF A;  2J59 M;  1JNM A;  2HG5 D;  3VMZ A;  3SWY A;  3B5N D;  1SQV K;  1RF0 A;  2XPN A;  3HPH E;  3VP9 A;  2WSC H;  3RK3 C;  1KFM A;  2XKM A;  2WWW A;  1JCD A;  1N7S D;  5AW2 B;  3U1C A;  1RE3 C;  1GZL A;  4ZKP A;  4WY4 D;  1DH3 A;  1GU4 A;  5AVQ B;  2KP8 A;  3V2Q A;  2A45 G;  1A02 J;  1N73 B;  1SFC C;  2WZ7 A;  1URQ C;  1HJB A;  4LC1 A;  1RY3 A;  5APX A;  5AVY B;  1NTM K;  4GKG A;  1JMM A;  1YTZ I;  3KQG A;  4IFD K;  1G2C A;  5APQ A;  1JTH B;  4W7Y A;  1GTW A;  3L37 A;  1JY3 N;  2FYZ A;  1LT9 C;  5KLV K;  4W7Z A;  2R3C A;  1GD2 E;  3HTK A;  1FBM A;  1NTZ K;  3SWF A;  1IO4 A;  4HYT B;  2M3B A;  1ZR2 A;  2OYI B;  2POH A;  1N7S B;  2QM8 A;  1XTC C;  2FXM A;  1JY3 O;  3GHG C;  3CI9 A;  3MGN A;  1SFC D;  2NPS B;  4N6J A;  1URQ D;  3U59 A;  2ZFC A;  1FZE A;  3A3Y B;  5APW A;  1LWU C;  1HWT C;  3I5C A;  1SQX K;  4DOJ A;  1LGH B;  3RK2 B;  1A02 F;  1LTJ C;  2YKP A;  1GK6 A;  5CHX A;  3H32 A;  4OH8 B;  2FKW B;  3E1I A;  1LWU A;  2WPS A;  4XA4 A;  2OYH C;  3HD7 C;  3TNU A;  3V4W A;  3F9K C;  3RK3 B;  3U88 C;  2OAR A;  1T8Z A;  1LTI C;  3HE4 A;  1JO5 A;  2P7J A;  3VOP A;  1H8A A;  3TSI A;  1N73 A;  3U1A A;  2IPP A;  1NO4 A;  2OYH A;  1HBW A;  1SP4 A;  4KHX A;  2WT7 A;  1QL2 A;  1FZC C;  3NMD A;  1H88 A;  1FAV A;  2YNY A;  3B5N C;  2C0W A;  2O1J A;  1VPC A;  1GL2 C;  1ZN5 A;  1L4A C;  1URQ B;  3A7O A;  2I1K A;  1HUC A;  1JCC A;  3M06 A;  1SLQ A;  3A2A A;  1FOS E;  1FZA A;  1FJP A;  3HTK B;  1FZC A;  2CPS A;  3P8C E;  3MUD A;  3B5N A;  3HD7 D;  2JEE A;  3L4F A;  1NAF A;  1JY2 P;  1AQ5 A;  1ZV8 A;  2HOD B;  2KLV A;  1X9V A;  1KQL A;  5AVZ B;  5AW1 B;  2WIT A;  2IFN A;  3B8E B;  1SQB K;  2IFM A;  4WY4 A;  3LID A;  2I1J A;  5BVZ A;  4HH2 A;  3NFQ A;  1GL2 D;  1NTK K;  1L4A D;  5AVS B;  2PAJ A;  5CCG D;  2KYV A;  3H32 B;  5CJ4 A;  3BVH A;  2R5B A;  4EIJ A;  1LWU B;  3O8Z A;  1RE4 A;  1E5W A;  2Q7C A;  2A45 H;  3TNU B;  3M0D C;  2C9L Y;  3N7N A;  1KIL C;  1LTJ B;  2N1T C;  2HPC A;  2GUS A;  3OA7 A;  3HE4 B;  2GUV A;  4EOT A;  2Z5H A;  2H7H A;  3VMX A;  2W27 A;  4XE5 B;  1OWA A;  4DZO A;  1W2E A;  1RE3 A;  2OYH B;  3HD7 B;  2WPR A;  3V2N A;  3M0D A;  2WT7 B;  3KDP B;  3TK1 A;  1CSB A;  3V2P A;  1GW4 A;  2YO2 A;  2W6A A;  2YKO A;  1LTS C;  1SFC A;  2MJZ A;  3P7K A;  1URQ A;  1RF1 C;  3EQ2 A;  2L5G B;  1EO0 A;  5AVV B;  1FZC B;  3HRN A;  1NOH A;  2XNX A;  1FDM A;  3B5N B;  3BAS A;  1GL2 B;  1J1E C;  1M1J C;  1ZR4 A;  1L4A B;  3CL3 D;  1KIL D;  1S9K D;  1H89 A;  2B4J C;  2N1T D;  5AVX B;  3OJA B;  2HOD A;  1ZLL A;  3EFG A;  1LTT C;  1LT9 A;  3N4X A;  1Z56 A;  2C9N Y;  1J1D C;  3P32 A;  2O01 H;  4WY4 B;  2KSJ A;  5AW9 B;  1L0L K;  1M1J A;  1DEB A;  1WJT A;  5AVW B;  4B86 A;  3LIE A;  1T2K C;  1CI6 A;  5APT A;  3HPG G;  1SVF A;  3GHG A;  4AYC A;  4JYC A;  3NXS A;  1CZQ A;  2ZXE B;  4LLH A;  5CCH C;  4AQR D;  2JJL A;  1KFN A;  1HH0 A;  3M0A A;  2M8R A;  3M9H A;  1N2D C;  2HPC B;  1LTJ A;  3M9B A;  1FZG A;  5AW0 B;  3VTP C;  1NKZ B;  1NU1 K;  2R32 A;  1NHL A;  1IK9 A;  5CMZ A;  4JYB A;  2FFD C;  1SQQ K;  1J2J B;  3RL0 C;  3KYQ A;  2KOG A;  3HD7 A;  1HVV A;  2N1T B;  2WTY A;  4JF7 A;  1T2K D;  5CCG C;  1SFC B;  3CLQ A;  2FFD A;  1G1I A;  1IJD B;  5CCH D;  1X79 B;  1L0N K;  1GU5 A;  1X8Y A;  3M91 A;  1XTG B;  5KJ7 C;  1GL2 A;  1L4A A;  5CCG A;  1LTB C;  2XPO A;  1RF1 B;  1MV8 A;  2WSE H;  2P2U A;  2P67 A;  1T3U A;  2W6B A;  1LT9 B;  3MIW A;  3A5T A;  5APV A;  3IR9 A;  4C46 A;  2XDJ A;  3RL0 D;  5AW6 B;  1QL1 A;  5KJ7 A;  3II6 A;  1M1J B;  2H8P D;  4IFF A;  5BU5 A;  2NPS C;  1CI6 B;  3MD0 A;  1GW3 A;  1N86 A;  3V4Q A;  3GHG B;  2Z5I A;  1JY3 P;  3HE5 A;  1J1D B;  2HFE D;  4M3L A;  4Y99 C;  2FYU K;  3WMM 0;  2H43 A;  3PP5 A;  5KJ7 D;  2A45 I;  5AVR B;  1OXZ A;  1IFM A;  2GM4 A;  1HTL C;  3KPE A;  3BRT B;  1NKN A;  5KTB A;  1WRG A;  4O9B A;  3NTN A;  5AW8 B;  1FOS F;  4N3Y B;  2R5D A;  1IFN A;  2YMY A;  1KIL A;  1PFI A;  2N1T A;  1FU1 A;  2YKQ A;  3L36 A;  5CJ0 A;  2NPS D;  1IFD A;  4LGD E;  2O1K A;  2FFD B;  1Z9E A;  2XPP A;  4ZKU A;  3RL0 B;  3VYI A;  1JY2 N;  3RK2 D;  1JUN A;  2Z4E A;  1FZB A;  1N7L A;  3P8C D;  1T3J A;  1MFZ A;  2BAS A;  1DX7 A;  5AVT B;  2J58 A;  2LKM A;  1RF1 A;  4WBA A;  1JOC A;  1IC2 A;  2N9B A;  1FJK A;  2PP6 A;  2VRS A;  4IFM A;  1CW5 A;  3HUS C;  1JY2 O;  1M7L A;  3RK3 D;  1IFJ A;  1AFO A;  1GK4 A;  4I6M C;  2P1J A;  2Q9I A;  4C7N A;  4I1L A;  4C7R A;  2XU6 A;  1YYC A;  1NH4 A;  5BU8 B;  2XPL A;  3HE5 B;  3HUS A;  3T97 A;  3VP8 A;  4N78 E;  4GT1 A;  1KZU B;  1G1J A;  1HGZ A;  4W80 A;  1MZ9 A;  1GDT A;  3V2R A;  1WT6 A;  2C0X A;  5CCH A;  5AW4 B;  4Y99 B;  2XV5 A;  3OAK A;  1KIL B;  3R2P A;  3H6P A;  1N73 C;  2XZR A;  1MUU A;  3L35 A;  1IFI A;  3MTU E;  1HGV A;  2N3A B;  2WPQ A;  2HYN A;  3VMY A;  1SQP K;  1NWQ A;  1LTG C;  2E43 A;  1YTZ T;  2IX7 C;  2YO3 A;  2E42 A;  5AW3 B;  2HLO A;  3C9I A;  1EQ7 A;  3LW5 H;  1VDF A;  2WSF H;  4AUW A;  3IFM A;  5APU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...