3NFQA

Crystal structure of the conserved central domain of yeast spn1/iws1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nfqA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3nfqA02
1HWTC 2C9NY 3A5TA 1S9KD 3P32A 1YYCA 1GK6A 2H7HA 5APUA 2Z5HA 2R5BA 2WPSA 2E43A 5AW3B 1WJTA 1OXZA 4AYCA 4JYBA 5AW2B 2WPRA 2WT7A 4HYTB 4C7NB 3B8EB 3VN0A 3HE5B 3M0DA 5AW4B 1GZLA 3F9KC 3HPGG 1MV8A 5APSA 2WT7B 1MFZA 1T2KC 2Q3IA 2P7JA 3O8ZA 5AVUB 1IO4A 3LIEA 3MGNA 4M3LA 3M91A 3M9BA 5AW5B 2BASA 1KQLA 4GT1A 4AQRD 2W6AA 3I5CA 4B86A 4I2LC 5AW0B 5AVWB 2YNYA 3NXSA 2WPQA 1OWAA 4LC1A 3SWFA 2WWWA 1HUCA 3KDPB 1J2JB 2XV5A 2VRSA 2R3CA 3T97A 1GTWA 1H89A 4AUWA 1JUNA 3P7KA 1X8YA 2R32A 4DZOA 5AVQB 5AVZB 5CMZA 2IPPA 3TNUB 1CI6B 1FOSE 3A3YB 5AW1B 3VMYA 2XPLA 3VMZA 3LIDA 1HJBA 1EO0A 3OAKA 1GU5A 1CZQA 1FOSF 4GKGA 4I6MC 5AVYB 1A02F 2QM8A 2WTYA 1GD2E 1CSBA 5APWA 1H8AA 1SP4A 2KP8A 5AVSB 3A2AA 5AVVB 2JJLA 3V5BA 4EOTA 5APVA 3NMDA 2Q7CA 5AW6B 1MUUA 3TNUA 1NAFA 3U88C 1JNMA 3VMXA 4JYCA 4RESB 2Q5UA 3V4QA 1GK4A 2YO3A 3V4WA 2ZFCA 5APTA 3TYYA 4C7NA 2C9LY 1GU4A 2XPOA 1DH3A 3P8MC 2P67A 2ZXEB 3IR9A 1CI6A 2YO2A 3L35A 1HBWA 3UIAA 5AW9B 2Z5IA 3HE4A 1FAVA 3VYIA 4KHXA 3TK1A 5AVRB 3HTKA 3NTNA 1S9KE 5AVXB 1T2KD 2XPNA 3M0AA 3M9HA 1SLQA 5AVTB 2B4JC 2W27A 2N3AB 3HPHE 1G2CB 5AW7B 5AW8B 2N9BA 1Z9EA 3MD0A 4C46A 3L36A 3VTPC 5APQA 1A02J 2E42A 2XU6A 5APXA 3L37A 3NFQA 2XPPA 2XZRA 1H88A 5APYA 2QM7A 3HE4B 3A7OA 3HE5A 2P2UA 3M06A 2R5DA 1NWQA 4XE5B 3KQGA
chains in the Genus database with same CATH superfamily
5KJ7A 2P10A 1SQPK 5KLVE 4W9YA 1RF1B 2XNDH 1SQPJ 1NTKG 4IFMA 1ZV8A 1ZR4A 1SQXK 3MGNA 1GL2C 4H13C 4GT1A 1M8OB 4H44B 5GTIE 3F5HA 2BCCE 4RKUJ 3II6A 1SQBJ 1GTWA 4AUWA 3O6QA 3PLFB 1S5LX 2HFED 3W68A 1A02F 4OVNF 2ZYDA 4XA4A 3KXDA 2IDBA 3GF7A 2CPSA 3PJSK 1L0LE 3VMXA 3L70D 2ZT9D 4JYCA 1BCCJ 5KLVG 3EWKA 1KD1Q 1DH3A 1JY2O 3H6PA 2M3BA 1SQVJ 3G3ZA 5D29A 1PV3A 3TK1A 5KAIE 3HMJG 1URQB 3CXHI 3AEGC 3L37A 2XZRA 1M1KQ 1S72P 5CCHD 2JWAA 4GOFA 1KYOD 1DIPA 3QH9A 3BCCD 1FBMA 1EDJA 2PRRA 3CXHD 4L74A 5APUA 1B47A 1FJPA 1SQBG 4ASVA 2YKOA 1KYOI 2W8ZA 4EIJA 3L71G 1E5WA 1IO4A 3A0HH 3VRQA 2QRXA 1ZRTE 2ZXXA 1BE3D 1KTMA 1JUNA 1JEKA 3PLNA 3B5NB 5CCGC 2YMYA 1VL2A 2WSFH 1T3UA 3V2NA 3M0DC 1HJ0A 1OVRA 3V5BA 5KLIC 1HGZA 2JR8A 4EOTA 2DW3A 5APVA 1SQQJ 3K5BA 4RESB 5L8RJ 4I1LA 2RMZA 1DX7A 1FZBA 2BCCJ 2D2CB 1CI6A 2I1JA 3L72D 2JBKA 1OW6A 1EZVI 3L74D 5BU8B 3HTKA 3F89A 1S5LH 2IBZE 1XTCC 2XPNA 1SQQG 5AVTB 3CC2P 1IC2A 3NFQA 3OA7A 1EZVD 2V7QH 2QM7A 3HE4B 2QJPB 3AEAC 1HWTC 4TT3H 2HODA 3B5ND 1M90Q 2K9YA 2KI7B 3RBUA 2WT7A 2O1KA 1OMIA 3W67A 1QEXA 1BE3J 5APSA 1HVVA 3A0HE 2J5UA 1NU1G 5AW0B 2HPCA 2L91A 2HR3A 5BU5A 3SWKA 1H89A 3HD7D 1LWUC 3G71P 1M1JA 5B5EH 3SWYA 3TGUJ 2R32A 2H88C 3JSVC 4NGMA 3AE1C 4BPXB 2WITA 4YPCA 1H0TA 1ZR2A 2WTYA 1GD2E 1KV4A 1ZN5A 1SP4A 2ZYAA 5AVVB 1RE3A 1LTJB 3LW5J 2NPSD 3D7DA 3EQ2A 1DEEG 2ITAA 2KIKA 1EXIA 5CCHA 1L4AD 4OC5A 1GU4A 1YI2P 3L73G 1QVGO 2FFDA 1M1JC 5BY0A 1GW3A 1AQTA 2PVVA 4PD4I 5KLVD 1AVYA 2M5AA 4C46A 4NGNA 3E1IA 4ZKPA 1NGMB 1J1EB 1T6AA 1NU1J 4KT0J 1H0TB 2R5DA 2JO1A 1SQBE 3H1JJ 3A5TA 1KFNA 2A45H 1Y47A 1SVFA 2E75B 3A0BH 1VQ6P 3L72G 1WMKA 1LNQA 2E74D 3L74G 1QL1A 2ZYGA 3BCCJ 3M9BA 4R4MA 1SQQD 1OW7A 3OW2O 5B66E 1AQ5A 1JY3N 1FBVA 4JYWA 1HUCA 2LR2A 1GMJA 1N7SD 4A4BA 1VF5C 4WY4C 2XPLA 5ELYA 1G1JA 2WMMA 2QM8A 1SQXG 2OYHB 1NKNA 1KILA 2IZ1A 1NVOA 2G8YA 3NMDA 1X79B 3CMAP 4P4IA 4GDOA 3SJXA 2H8PD 2ZAEB 1OFCX 2ZFCA 4H13D 1PGOA 3G4SP 3H1KJ 2AXCA 1S3JA 1T8ZA 3CWBE 2D2CC 1Q81Q 1U7JA 4JPZB 2Y9ZA 1WRGA 3H1KG 3H1IG 1PPJD 1R5LA 5AVXB 3BUOB 1SLQA 2N3AB 1FDMA 1KB9D 3MD0A 5TJHA 4HB1A 1OX3A 2XDJA 3KQGA 1LT9B 2C9NY 1JCCA 1LJ2A 2FXPA 2YKQA 1KILD 1NTZK 3CXHH 1ZRTD 1IJDB 1TU3F 1SQXE 2A45I 1OXZA 2R44A 2XEJA 1Q7YQ 4LLHA 1NH4A 1FJKA 3PTZA 5AVUB 3RK3E 4D6TD 5TISE 2E75C 4WWIA 2ZT9B 2QA4P 4BRYB 1IFPA 1DD3A 3B5NA 2R3CA 1UIIA 1L4AB 5AVQB 2KLVA 3RBZA 2J59M 2QE7H 3WU2E 5KLVJ 3OAKA 2AEJA 1N73C 4Y28J 1S4XA 2AXTH 2PAJA 5AVYB 2QEXP 3H1HG 1NKZB 3RK3D 1M57D 2KP8A 4D6TE 3TNUA 1L0NK 4H44D 3GF3A 4U3FD 5C39A 5CJ4A 3BHXA 1GK4A 3O6QB 2KYVA 3VRRA 3OB2B 2E5YA 1L0NE 3L73J 1YQ3C 1L0LG 1NTZE 1Z8LA 3D7FA 4OH8B 3HPHE 5E79E 1LT9C 2W90A 3BUXB 3H1LJ 1KQGB 5APXA 3TF5A 1GL2A 1SQXJ 4IFFA 3USSA 4BTFA 3H32B 4MN4C 1NTKJ 1SFCD 4XE5B 1ZMEC 1M7LA 4WBAA 1YYCA 3SFEC 2OTKE 1JTHA 3SJGA 3CL3D 2N1TB 1U57A 1FDIA 3D6ZA 2ZVNB 4Y99B 1K05A 3RGUA 3RL0C 4XFJA 2KZIA 2Y1NA 4GOEA 4I7ZB 5AW5B 2BASA 3BRTB 5CCGA 4WB4A 1JY2N 3MZWB 1L0NG 1AA0A 1ZP0C 1RE4C 4OC2A 2KS1B 1PGQA 4IOIH 1GL2B 5AW1B 3B5NC 3CC7P 2CBLA 2ZVOB 3V6IA 2FYUD 1LWUB 2OR4A 1J1DB 1FZCB 2E5TA 3A2AA 2BCCD 1SQPE 3BUNB 5AW6B 3U88C 3H1LD 1SQVK 3TYYA 2IFNA 2QJKC 3AE2C 3IR9A 5KKZC 2A45G 3CCUP 1VDFA 3HE4A 1RY3A 3GG2A 3HRNA 3S9MA 3JCUE 3HD7A 1SQBK 1PL5A 1ZW0A 2N1TC 2XNXA 1OW8A 3H1HD 3M06A 2P2UA 5H2FE 3H1ID 2V4HA 3CCSP 3H1JE 1SQQE 2P1JA 5E79H 2H7HA 4RJTA 4HJGH 1FS0E 1Q2NA 2K9JB 5AW3B 4P4DA 2KXPB 5F13A 4C7NB 2WSCJ 1NTMG 2WPVB 1SFCA 2B88A 2OGUA 2E76C 2UV8G 3V2PA 2HODB 1OWAA 3TGUE 1PP9E 4W7YA 1QLED 1IFDA 1X22A 1GU5A 4GIFA 2OYHA 1SQVD 3CX5E 3CX5H 1JY3P 2O3JA 3BUMB 4IL6H 5DJUB 1M1JB 2OARA 1VQ7P 5APTA 3PHLA 3L75G 1PP9D 4K3AA 1FZGA 3SFDC 3L71E 4GODA 4JF7A 3OB1B 4BPWB 3HUSC 5AVRB 5KTBA 1N7SC 3IF4A 2DLAA 3M0AA 2ZJSE 3S9OA 2IX7C 1Q90D 1LTJA 3L36A 1GW4A 5KKZB 3P8CE 3AECC 2YIUB 3SSUA 4MCQA 1DEBA 1YVHA 3WUVA 1LP1A 4P4EA 1EDKA 4NGRA 2BCCG 2FFDB 4NGPA 4BWNA 2HG5D 3AEBC 4P4BA 3C9IA 2FFDC 2YMKA 2Q3EA 2WVRA 1EZVE 1Y9BA 3HPGG 5GTHH 1EC5A 2HPCB 3G6EP 2YNYA 4OGQD 1P84H 3H1IJ 1SQPG 1J2JB 3BXMA 3GLMA 1RF1A 3WUTA 4PJ0E 1NTKK 1KILC 1JTHB 2IYPA 2WSEH 2BEZF 3EFFK 1SQQK 1P84I 2NPSA 2JBJA 1VQOP 4P44A 2WSFJ 4L73A 1BSNA 1VQ8P 3BVHA 2AEMA 1MUUA 1K04A 3H25A 1OZHA 4UB8E 1DE4C 1KB9I 4R4LA 3Q1MA 3CCMP 1FAVA 1YIJP 1NO4A 2B89A 2Z4EA 2QIWA 3H1LG 1T2KD 2N9YB 5AW7B 2Q6QA 1AJYA 3TDKA 4JQ0D 1KC8Q 2KZJA 5KLVK 1HGVA 2CIJA 2IFMA 2Y0CA 3L72J 5AW4B 4C7NA 2OYOA 1NJIQ 1KYOH 1LWUA 1S9KD 1YTZI 3RL0g 2YIUC 1KFMA 1J1EC 3TGUG 2WPSA 1RF0C 3L75D 1M56D 3FWNA 1VPCA 1GDTA 1FE6A 3G9RA 3SJFA 3L71J 3C8VA 4H0LD 5CBOA 3PH0A 3FECA 4AQRD 4N6JA 1RQUA 2KS1A 3KDPB 5DJTB 2Q9IA 4NPDA 2QVAA 1HH0A 3TNUB 5CMZA 2IPPA 3D71A 3FX0A 4NPEA 2IBZG 1LTAC 2Y9YA 3QWOC 4I6MC 1T3JA 2YXRB 2FXOA 1FDOA 2GM4A 1BGYJ 2SPZA 1YJ9P 3IWWA 4P45A 1JY2P 1LT1A 1EXJA 3T97B 2I1KA 5K5GB 3CCEP 2YO3A 1KYOE 2OTLP 1JCDA 3BCCE 2XPOA 3CCJP 3P8MC 3CD6P 1Z56A 2O1JA 3H1HE 3BASA 1KB9H 2K37A 3HD7C 3H32A 1CW5A 2C0XA 3C1LA 3NTNA 5EFWB 2PP6A 1A02J 1VQPP 1H88A 3IFMA 3L70E 2FYZA 2NZ2A 3P32A 5KAFH 1YITP 1RQVA 1BCCD 2OYIB 1USEA 3E7KA 3EFGA 2OYIC 1EDIA 1PGJA 5AW2B 3CLQA 2QSIA 3F9KC 1RE4A 4QMAA 3L73D 3L74J 1SQVE 3CX5D 3ZNIA 2O01N 4PV1C 1SQXD 4LC1A 3BRVB 3AE9C 2Q1KA 1LTSC 1UIXA 1BCCE 4MCSA 1LP1B 3P7KA 2OOTA 3D7GA 1LTIC 3VMYA 2A06D 1JB0J 1CSBA 1VQ4P 3PP5A 1G2CA 1KORA 2Q7CA 2WSSH 1U7MA 4ASWA 2E74B 4A4CA 5GTHE 1BE3E 4N3YB 2O01H 3GHGC 4DT0A 2C9LY 2P67A 2FY8A 2KNCA 2A06E 3VYIA 3RK3B 1VF5D 2HLOA 4WY4D 3IN6A 2B87B 3FWLA 2W27A 2B87A 5TISH 1GL2D 1Z9EA 4D6TJ 3VTPC 3BI1A 4EYYQ 1IFMA 1N7SB 3CCRP 1MZ9A 3VROA 2OQQA 4Y99C 4C7RA 5AXIA 1DD4A 4CPGA 4OWFA 3FEEA 5BVZA 4D6TG 4UB8H 2R5BA 3ZDMA 2KUBA 4AYCA 4JYBA 2JKVA 4HYTB 2D2CD 2KOGA 2M5AB 2MJZA 3HE5B 3PFVA 3VMAA 2WZ7A 1MV8A 4TLFA 1MFZA 3ABVC 1NAYA 2ZT9C 3V2RA 3M91A 3WMM0 4L75A 3B71A 1Y8AA 1KILB 4I2LC 4RR2B 4BPUB 1W2BO 4DOJA 3Q5PA 4OC4A 3H1KD 1S5LE 1NTME 5AVZB 1FOSE 1CI6B 3BCCG 1VQNP 1Q86Q 1JO5A 2KB7P 1KZUB 2CK3H 3AE5C 1N7LA 2P58A 5KAFE 3AE4C 4OGQB 4NGTA 3V4WA 2FKWB 1FZCC 3U1CA 4OGQC 4PJ0H 3CPWO 1S9KE 1IK9A 3L70G 4JZ0A 3AEFC 2B4JC 2I8DA 3H1LE 1QVFO 2C6CA 2N9BA 3L75E 1NTZJ 2XPPA 3D70A 1HTLC 1QX8A 5APYA 1S1CX 3RK3C 5CCGD 3MUDC 3R4YA 1L0LK 1W5CE 2GUVA 1WJTA 1KQFB 1ZXGA 2QJPC 2WPRA 3AEEC 3VN0A 4K35A 3KZIH 3A0BE 3E1RA 5KAIH 1RF0A 3AE7C 1NTMJ 5M1BA 2L5GB 1BCCG 1LTBC 4YXDC 5B66H 1N8RQ 2W83C 2AXTE 4UB6H 3Q5SA 3SWFA 1SQBD 2FYUG 1PIXA 1URQD 2VRSA 5KJ7C 1P84D 1AV1A 1EZVG 1L0LD 1NYHA 1NU1E 1USDA 3KPEA 4NGSA 3CWBD 2G3AA 4MCRA 2OYIA 1PPJE 1OIPA 4GKGA 2WQYC 5HKZA 2KK7A 1BE3G 2O01J 1H8AA 4KJMA 2JEEA 4GPLB 1KB9E 5AVSB 3RL0D 1AFOA 2Y0EA 4YXWH 1N73B 1QGKB 2A06G 2BEQD 5GTIH 3RK2D 2W6JH 1P84E 1BGYD 1BDCA 1NU1D 3H1HJ 3LW5H 1KILE 2YO2A 4OC3A 4KHXA 3MP7B 1KQSO 4NGQA 2FYNC 3Q5RA 1JM0A 3GMAA 4W80A 2E42A 2PFXA 3HUSB 3VOPA 1NTKE 4UB6E 2JP3A 1NU1K 1RHZB 2QJYB 3N4XA 3L73E 2Z5HA 4RO0A 1VQLP 2KSJA 2E43A 1EDLA 3SJEA 2YKPA 4O9BA 2Y1MA 2PGDA 1MKMA 2Q3IA 3AEDC 3FEDA 4OMEA 3LIEA 4M3LA 2JDIH 4WY4A 5AVWB 2WPQA 3HTKB 2HYNA 1W2EA 4I7ZC 4DZOA 3MHVA 3KHUA 4PV1B 1EO0A 1K8AQ 4P4FA 3BI0A 3L74E 2JJLA 2V7QJ 2B9BA 1PZQA 2GA1A 3D6YA 1R5SA 2C6GA 2FBWC 3FGAD 4H0LB 2XEIA 1AVOA 4WVZA 4MCPA 2C6PA 4P4JA 2Z5IA 2E74C 2YXQB 2M8RA 1IFNA 1YQ4C 3CWBG 4Z1MH 3L70J 5APQA 4ZNCA 2UWJE 1X9VA 3A7OA 3KYQA 3MTUE 1XTGB 1JOCA 2GUSA 2J58A 2VKZG 4BRYA 1JMBA 1GK6A 2FYUK 4OC1A 3CX5I 4H13B 1WT6A 3H1KE 1IK7A 1K73Q 1NTZD 2KSEA 5HKYA 3M0DA 2POHA 3JCUH 2FYUE 2WT7B 1LT9A 3O8ZA 1PPJG 1PP9G 1FZAA 1R8EA 3I5CA 3BUWB 2Y0DA 3JC22 3GHGA 3NXSA 3L4FA 1IFIA 3CCLP 4HH2A 3U1AA 2E76B 1JMMA 1HJBA 3Q3DA 1D7MA 1L2PA 5CCHC 2K3RA 3CCVP 1N73A 2WSEJ 1L4AA 1NAFA 1NHLA 2Q5UA 2W6BA 3H1JD 3S9NA 1LTGC 1IFJA 2RKLA 2LXBA 2ZXEB 1FC2C 3L35A 1MFTA 2MKVA 3UIAA 1YHQP 4DCKA 1YTZT 2LXCB 4EI2A 1L0NJ 1ZOYC 1YJNP 1VQ5P 1LGHB 2K88A 3IAOA 4LQGA 1G2CB 1X0TA 5CBNA 2E75D 1BGYG 2JWDA 4BXLA 3GW6A 2IYOA 1SQPD 2FYNB 4YTPC 3VRPA 1PP9J 3HE5A 3S9LA 4IFDK 1RF1C 4IL6X 2KNCB 4IL6E 4ZMDA 2FXMA 3S1KA 1QL2A 4PD4H 3CCQP 2QG4A 3AE3C 1FU1A 2H43A 1G1IA 1T2KC 4H44C 5HKWA 1VF5B 4WY4B 3OJAB 2KLUA 4N78E 3CWBJ 2N1TA 3CXHE 2W6AA 3H1IE 2NRGA 2WWWA 1VQMP 3CC4P 2XV5A 3ITKA 2NPSB 1N86A 3M9QA 1ZLLA 1Q82Q 1URQA 3TSIA 3HUSA 3VGOA 3VMZA 3LIDA 1BGYE 4W7ZA 4DJGA 1JY3O 1BSHA 1LTJC 5APWA 2XKMA 4NPFX 2WSCH 3Q2YA 2QJKB 1IZNB 3P8CD 4N78D 1SFCC 3CMEP 4U7JA 1CX8A 3WUUA 3AE6C 4H0LC 1S2EA 3V4QA 3TGUD 3FXEA 2RN0A 3RBXA 1YBKA 2M0BA 1K9MQ 3OP0A 3FF3A 2LKMA 1NTKD 1URQC 5KJ7D 4HKZH 3D7HA 1FZCA 2C0WA 4U3FG 1YJWP 2IBZI 5AW8B 4EDFA 3FXDA 1N7SA 1SS1A 2XU6A 3VP9A 4JBZA 3R2PA 3L72E 1FZFA 5CJ0A 4PD4D 3RK2B 4LGDE 2XEFA 1BDDA 2IBZD 3L71D 1PFIA 1EQ7A 3RK2C 3PRJA 1HF9A 3MUDA 2XEGA 3V2QA 3H1JG 3RL0B 1L0LJ 2FYUJ 3B8EB 3N7NA 3BATA 3I56P 2CPBA 1GZLA 2NPSC 2P7JA 1NOHA 3B4SA 1L4AC 1LTTC 1KQLA 4B86A 2K9JA 2OTJP 4PD4E 1N2DC 1NTZG 3VRNA 3KASA 5J3XA 3CI9A 3T97A 4A7PA 1OVUA 1OVVA 4X3RA 1X8YA 4U3FE 2PVWA 1SFCB 1VQKP 3A3YB 1PGPA 3MIWA 2IZ0A 3AE8C 1E79H 1RE3C 1CZQA 1FOSF 4ZKUA 2N1TD 2K1AA 2RH0A 2M3EA 3KZIE 1L0ND 5B5EE 2OYHC 3HD7B 1J1DC 4U3FJ 3VP8A 1JNMA 5KLIB 1NTMD 4PV1D 2AEFA 3GHGB 3L75J 1HBWA 5F09A 5AW9B 1RH5B 5CHXA 5H2FH 1KMIZ 3I55P 3M9HA 3WU2H 4OC0A 4L76A 1FZEA 1VQ9P 2H89C 2E76D 1NTMK 3PT1A 2QJYC 1SQVG 3U59A 1KN7A 2R3SA 1NWQA 3S4RA
chains in the Genus database with same CATH topology
5KJ7A 1LWUA 1LT9B 2C9NY 1S9KD 1JCCA 1YTZI 2YKQA 1KILD 3N4XA 1NTZK 1SQPK 2Z5HA 1KFMA 1J1EC 1IJDB 1RF1B 2WPSA 1RF0C 2KSJA 2E43A 2A45I 1OXZA 1VPCA 1GDTA 4IFMA 2YKPA 1ZV8A 4O9BA 4LLHA 1NH4A 1ZR4A 1FJKA 2Q3IA 5AVUB 1SQXK 3LIEA 3MGNA 4M3LA 1GL2C 4GT1A 4AQRD 4WY4A 5AVWB 4N6JA 2WPQA 3II6A 3B5NA 3KDPB 1GTWA 2R3CA 4AUWA 3HTKB 2Q9IA 2HYNA 1W2EA 2HFED 1HH0A 4DZOA 1L4AB 5AVQB 3TNUB 5CMZA 2IPPA 2KLVA 1LTAC 2J59M 1EO0A 3OAKA 1N73C 4I6MC 2PAJA 5AVYB 1T3JA 1A02F 1NKZB 4XA4A 3RK3D 2GM4A 2KP8A 2JJLA 1JY2P 2CPSA 2I1KA 3TNUA 1L0NK 3VMXA 4JYCA 5CJ4A 1GK4A 2YO3A 1JCDA 2KYVA 2XPOA 1DH3A 3P8MC 1JY2O 3H6PA 1Z56A 2M3BA 2O1JA 3G3ZA 3BASA 3HD7C 2Z5IA 3H32A 1CW5A 2C0XA 3TK1A 3NTNA 2M8RA 1IFNA 1URQB 4OH8B 3HPHE 1LT9C 2PP6A 1A02J 5APQA 5APXA 3L37A 1GL2A 2XZRA 4IFFA 1H88A 3IFMA 1X9VA 5CCHD 3H32B 3A7OA 3KYQA 3MTUE 1XTGB 2FYZA 1SFCD 1JOCA 4XE5B 1FBMA 1M7LA 2GUSA 2J58A 4WBAA 3P32A 1YYCA 1GK6A 1JTHA 2OYIB 2FYUK 5APUA 3CL3D 2N1TB 3EFGA 1WT6A 2OYIC 1FJPA 5AW2B 2YKOA 3CLQA 4Y99B 3M0DA 2POHA 3RL0C 4EIJA 3F9KC 2WT7B 1LT9A 3O8ZA 1E5WA 1IO4A 5AW5B 2BASA 1RE4A 1FZAA 3I5CA 3BRTB 5CCGA 4WB4A 3GHGA 3NXSA 3L4FA 1JY2N 3BRVB 1IFIA 4LC1A 4HH2A 1RE4C 1LTSC 1JUNA 3B5NB 3P7KA 5CCGC 3U1AA 2YMYA 1GL2B 1LTIC 5AW1B 3VMYA 3B5NC 2WSFH 1JMMA 1T3UA 1HJBA 3V2NA 1CSBA 1LWUB 3M0DC 1J1DB 1FZCB 5CCHC 3V5BA 3A2AA 3PP5A 1G2CA 1HGZA 4EOTA 1N73A 5APVA 2Q7CA 5AW6B 1L4AA 1NAFA 3U88C 1NHLA 4RESB 4N3YB 2O01H 2Q5UA 4I1LA 2W6BA 3GHGC 1DX7A 1SQVK 1FZBA 3TYYA 2C9LY 1LTGC 1IFJA 2IFNA 2P67A 2ZXEB 3IR9A 1CI6A 2I1JA 3L35A 3UIAA 2A45G 1VDFA 3HE4A 1YTZT 3VYIA 5BU8B 1RY3A 3HTKA 3RK3B 3HRNA 2HLOA 1XTCC 4WY4D 2XPNA 5AVTB 1LGHB 2W27A 1G2CB 1GL2D 3HD7A 1Z9EA 1SQBK 3VTPC 1IC2A 3NFQA 3OA7A 2N1TC 1IFMA 2XNXA 2QM7A 1N7SB 3HE4B 3HE5A 2P2UA 3M06A 1MZ9A 4Y99C 4C7RA 4IFDK 1HWTC 1RF1C 2HODA 2P1JA 3B5ND 5BVZA 2H7HA 2R5BA 2FXMA 5AW3B 1QL2A 4AYCA 4JYBA 2WT7A 4HYTB 2KOGA 4C7NB 2MJZA 2O1KA 3HE5B 1FU1A 2WZ7A 2H43A 1G1IA 1MV8A 1HVVA 5APSA 1MFZA 1T2KC 1SFCA 4WY4B 3V2RA 3M91A 3OJAB 3WMM0 4N78E 2N1TA 2W6AA 1KILB 4I2LC 5AW0B 2HPCA 3V2PA 2HODB 1OWAA 2WWWA 5BU5A 4DOJA 2XV5A 1H89A 3HD7D 2NPSB 1LWUC 1N86A 1M1JA 3M9QA 1ZLLA 3SWYA 4W7YA 1URQA 2R32A 3TSIA 3HUSA 5AVZB 1FOSE 1CI6B 3VMZA 3LIDA 4W7ZA 1IFDA 2WITA 1GU5A 1ZR2A 1JY3O 4GIFA 2OYHA 2WTYA 1GD2E 1LTJC 5APWA 2XKMA 1JO5A 1ZN5A 1SP4A 2WSCH 2KB7P 1KZUB 1JY3P 5AVVB 3P8CD 4N78D 1SFCC 1RE3A 1LTJB 1N7LA 2NPSD 3EQ2A 5CCHA 3V4QA 3V4WA 1M1JB 1L4AD 2OARA 5APTA 4C7NA 1GU4A 2FKWB 1FZCC 3U1CA 1FZGA 2LKMA 2FFDA 1M1JC 4JF7A 1URQC 3HUSC 5KJ7D 1GW3A 5AVRB 5KTBA 1N7SC 1S9KE 1FZCA 2C0WA 1IK9A 3M0AA 2B4JC 2IX7C 5AW8B 2N9BA 1LTJA 4C46A 3L36A 1GW4A 3E1IA 3P8CE 4ZKPA 1N7SA 2XU6A 1DEBA 3VP9A 2XPPA 1J1EB 1HTLC 3R2PA 5APYA 3RK3C 1FZFA 5CCGD 2R5DA 5CJ0A 3RK2B 2FFDB 4LGDE 3A5TA 1KFNA 2HG5D 1PFIA 2A45H 1EQ7A 1SVFA 3C9IA 3RK2C 2FFDC 1L0LK 3MUDA 3V2QA 3RL0B 2GUVA 1WJTA 2WPRA 3B8EB 3N7NA 3VN0A 3BATA 2CPBA 1GZLA 2NPSC 3HPGG 1RF0A 2P7JA 1NOHA 1QL1A 2L5GB 1LTBC 2HPCB 3M9BA 1L4AC 1LTTC 1KQLA 4B86A 1AQ5A 1JY3N 2YNYA 1N2DC 3SWFA 1HUCA 3CI9A 1URQD 1J2JB 3T97A 2VRSA 5KJ7C 1RF1A 1N7SD 4WY4C 1X8YA 3KPEA 1SFCB 2XPLA 1NTKK 3A3YB 1KILC 3MIWA 1G1JA 1JTHB 2OYIA 1RE3C 2WSEH 1CZQA 1FOSF 4GKGA 4ZKUA 2QM8A 2N1TD 1H8AA 2OYHB 2JEEA 1NKNA 1SQQK 1KILA 2NPSA 5AVSB 3RL0D 3BVHA 3NMDA 2OYHC 1X79B 3HD7B 1J1DC 1MUUA 3VP8A 1AFOA 1JNMA 1N73B 2H8PD 2ZFCA 3RK2D 3LW5H 2YO2A 3GHGB 1HBWA 1T8ZA 5AW9B 5CHXA 1FAVA 4KHXA 1NO4A 1WRGA 2Z4EA 5AVXB 1T2KD 3M9HA 1SLQA 2N3AB 5AW7B 1FDMA 1FZEA 3MD0A 4W80A 2E42A 3HUSB 1NTMK 3VOPA 5KLVK 1NWQA 1HGVA 3U59A 2IFMA 5AW4B 1NU1K 2XDJA 3KQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HWT C;  2C9N Y;  3A5T A;  1S9K D;  3P32 A;  1YYC A;  1GK6 A;  2H7H A;  5APU A;  2Z5H A;  2R5B A;  2WPS A;  2E43 A;  5AW3 B;  1WJT A;  1OXZ A;  4AYC A;  4JYB A;  5AW2 B;  2WPR A;  2WT7 A;  4HYT B;  4C7N B;  3B8E B;  3VN0 A;  3HE5 B;  3M0D A;  5AW4 B;  1GZL A;  3F9K C;  3HPG G;  1MV8 A;  5APS A;  2WT7 B;  1MFZ A;  1T2K C;  2Q3I A;  2P7J A;  3O8Z A;  5AVU B;  1IO4 A;  3LIE A;  3MGN A;  4M3L A;  3M91 A;  3M9B A;  5AW5 B;  2BAS A;  1KQL A;  4GT1 A;  4AQR D;  2W6A A;  3I5C A;  4B86 A;  4I2L C;  5AW0 B;  5AVW B;  2YNY A;  3NXS A;  2WPQ A;  1OWA A;  4LC1 A;  3SWF A;  2WWW A;  1HUC A;  3KDP B;  1J2J B;  2XV5 A;  2VRS A;  2R3C A;  3T97 A;  1GTW A;  1H89 A;  4AUW A;  1JUN A;  3P7K A;  1X8Y A;  2R32 A;  4DZO A;  5AVQ B;  5AVZ B;  5CMZ A;  2IPP A;  3TNU B;  1CI6 B;  1FOS E;  3A3Y B;  5AW1 B;  3VMY A;  2XPL A;  3VMZ A;  3LID A;  1HJB A;  1EO0 A;  3OAK A;  1GU5 A;  1CZQ A;  1FOS F;  4GKG A;  4I6M C;  5AVY B;  1A02 F;  2QM8 A;  2WTY A;  1GD2 E;  1CSB A;  5APW A;  1H8A A;  1SP4 A;  2KP8 A;  5AVS B;  3A2A A;  5AVV B;  2JJL A;  3V5B A;  4EOT A;  5APV A;  3NMD A;  2Q7C A;  5AW6 B;  1MUU A;  3TNU A;  1NAF A;  3U88 C;  1JNM A;  3VMX A;  4JYC A;  4RES B;  2Q5U A;  3V4Q A;  1GK4 A;  2YO3 A;  3V4W A;  2ZFC A;  5APT A;  3TYY A;  4C7N A;  2C9L Y;  1GU4 A;  2XPO A;  1DH3 A;  3P8M C;  2P67 A;  2ZXE B;  3IR9 A;  1CI6 A;  2YO2 A;  3L35 A;  1HBW A;  3UIA A;  5AW9 B;  2Z5I A;  3HE4 A;  1FAV A;  3VYI A;  4KHX A;  3TK1 A;  5AVR B;  3HTK A;  3NTN A;  1S9K E;  5AVX B;  1T2K D;  2XPN A;  3M0A A;  3M9H A;  1SLQ A;  5AVT B;  2B4J C;  2W27 A;  2N3A B;  3HPH E;  1G2C B;  5AW7 B;  5AW8 B;  2N9B A;  1Z9E A;  3MD0 A;  4C46 A;  3L36 A;  3VTP C;  5APQ A;  1A02 J;  2E42 A;  2XU6 A;  5APX A;  3L37 A;  3NFQ A;  2XPP A;  2XZR A;  1H88 A;  5APY A;  2QM7 A;  3HE4 B;  3A7O A;  3HE5 A;  2P2U A;  3M06 A;  2R5D A;  1NWQ A;  4XE5 B;  3KQG A; 
#chains in the Genus database with same CATH topology
 5KJ7 A;  2P10 A;  1SQP K;  5KLV E;  4W9Y A;  1RF1 B;  2XND H;  1SQP J;  1NTK G;  4IFM A;  1ZV8 A;  1ZR4 A;  1SQX K;  3MGN A;  1GL2 C;  4H13 C;  4GT1 A;  1M8O B;  4H44 B;  5GTI E;  3F5H A;  2BCC E;  4RKU J;  3II6 A;  1SQB J;  1GTW A;  4AUW A;  3O6Q A;  3PLF B;  1S5L X;  2HFE D;  3W68 A;  1A02 F;  4OVN F;  2ZYD A;  4XA4 A;  3KXD A;  2IDB A;  3GF7 A;  2CPS A;  3PJS K;  1L0L E;  3VMX A;  3L70 D;  2ZT9 D;  4JYC A;  1BCC J;  5KLV G;  3EWK A;  1KD1 Q;  1DH3 A;  1JY2 O;  3H6P A;  2M3B A;  1SQV J;  3G3Z A;  5D29 A;  1PV3 A;  3TK1 A;  5KAI E;  3HMJ G;  1URQ B;  3CXH I;  3AEG C;  3L37 A;  2XZR A;  1M1K Q;  1S72 P;  5CCH D;  2JWA A;  4GOF A;  1KYO D;  1DIP A;  3QH9 A;  3BCC D;  1FBM A;  1EDJ A;  2PRR A;  3CXH D;  4L74 A;  5APU A;  1B47 A;  1FJP A;  1SQB G;  4ASV A;  2YKO A;  1KYO I;  2W8Z A;  4EIJ A;  3L71 G;  1E5W A;  1IO4 A;  3A0H H;  3VRQ A;  2QRX A;  1ZRT E;  2ZXX A;  1BE3 D;  1KTM A;  1JUN A;  1JEK A;  3PLN A;  3B5N B;  5CCG C;  2YMY A;  1VL2 A;  2WSF H;  1T3U A;  3V2N A;  3M0D C;  1HJ0 A;  1OVR A;  3V5B A;  5KLI C;  1HGZ A;  2JR8 A;  4EOT A;  2DW3 A;  5APV A;  1SQQ J;  3K5B A;  4RES B;  5L8R J;  4I1L A;  2RMZ A;  1DX7 A;  1FZB A;  2BCC J;  2D2C B;  1CI6 A;  2I1J A;  3L72 D;  2JBK A;  1OW6 A;  1EZV I;  3L74 D;  5BU8 B;  3HTK A;  3F89 A;  1S5L H;  2IBZ E;  1XTC C;  2XPN A;  1SQQ G;  5AVT B;  3CC2 P;  1IC2 A;  3NFQ A;  3OA7 A;  1EZV D;  2V7Q H;  2QM7 A;  3HE4 B;  2QJP B;  3AEA C;  1HWT C;  4TT3 H;  2HOD A;  3B5N D;  1M90 Q;  2K9Y A;  2KI7 B;  3RBU A;  2WT7 A;  2O1K A;  1OMI A;  3W67 A;  1QEX A;  1BE3 J;  5APS A;  1HVV A;  3A0H E;  2J5U A;  1NU1 G;  5AW0 B;  2HPC A;  2L91 A;  2HR3 A;  5BU5 A;  3SWK A;  1H89 A;  3HD7 D;  1LWU C;  3G71 P;  1M1J A;  5B5E H;  3SWY A;  3TGU J;  2R32 A;  2H88 C;  3JSV C;  4NGM A;  3AE1 C;  4BPX B;  2WIT A;  4YPC A;  1H0T A;  1ZR2 A;  2WTY A;  1GD2 E;  1KV4 A;  1ZN5 A;  1SP4 A;  2ZYA A;  5AVV B;  1RE3 A;  1LTJ B;  3LW5 J;  2NPS D;  3D7D A;  3EQ2 A;  1DEE G;  2ITA A;  2KIK A;  1EXI A;  5CCH A;  1L4A D;  4OC5 A;  1GU4 A;  1YI2 P;  3L73 G;  1QVG O;  2FFD A;  1M1J C;  5BY0 A;  1GW3 A;  1AQT A;  2PVV A;  4PD4 I;  5KLV D;  1AVY A;  2M5A A;  4C46 A;  4NGN A;  3E1I A;  4ZKP A;  1NGM B;  1J1E B;  1T6A A;  1NU1 J;  4KT0 J;  1H0T B;  2R5D A;  2JO1 A;  1SQB E;  3H1J J;  3A5T A;  1KFN A;  2A45 H;  1Y47 A;  1SVF A;  2E75 B;  3A0B H;  1VQ6 P;  3L72 G;  1WMK A;  1LNQ A;  2E74 D;  3L74 G;  1QL1 A;  2ZYG A;  3BCC J;  3M9B A;  4R4M A;  1SQQ D;  1OW7 A;  3OW2 O;  5B66 E;  1AQ5 A;  1JY3 N;  1FBV A;  4JYW A;  1HUC A;  2LR2 A;  1GMJ A;  1N7S D;  4A4B A;  1VF5 C;  4WY4 C;  2XPL A;  5ELY A;  1G1J A;  2WMM A;  2QM8 A;  1SQX G;  2OYH B;  1NKN A;  1KIL A;  2IZ1 A;  1NVO A;  2G8Y A;  3NMD A;  1X79 B;  3CMA P;  4P4I A;  4GDO A;  3SJX A;  2H8P D;  2ZAE B;  1OFC X;  2ZFC A;  4H13 D;  1PGO A;  3G4S P;  3H1K J;  2AXC A;  1S3J A;  1T8Z A;  3CWB E;  2D2C C;  1Q81 Q;  1U7J A;  4JPZ B;  2Y9Z A;  1WRG A;  3H1K G;  3H1I G;  1PPJ D;  1R5L A;  5AVX B;  3BUO B;  1SLQ A;  2N3A B;  1FDM A;  1KB9 D;  3MD0 A;  5TJH A;  4HB1 A;  1OX3 A;  2XDJ A;  3KQG A;  1LT9 B;  2C9N Y;  1JCC A;  1LJ2 A;  2FXP A;  2YKQ A;  1KIL D;  1NTZ K;  3CXH H;  1ZRT D;  1IJD B;  1TU3 F;  1SQX E;  2A45 I;  1OXZ A;  2R44 A;  2XEJ A;  1Q7Y Q;  4LLH A;  1NH4 A;  1FJK A;  3PTZ A;  5AVU B;  3RK3 E;  4D6T D;  5TIS E;  2E75 C;  4WWI A;  2ZT9 B;  2QA4 P;  4BRY B;  1IFP A;  1DD3 A;  3B5N A;  2R3C A;  1UII A;  1L4A B;  5AVQ B;  2KLV A;  3RBZ A;  2J59 M;  2QE7 H;  3WU2 E;  5KLV J;  3OAK A;  2AEJ A;  1N73 C;  4Y28 J;  1S4X A;  2AXT H;  2PAJ A;  5AVY B;  2QEX P;  3H1H G;  1NKZ B;  3RK3 D;  1M57 D;  2KP8 A;  4D6T E;  3TNU A;  1L0N K;  4H44 D;  3GF3 A;  4U3F D;  5C39 A;  5CJ4 A;  3BHX A;  1GK4 A;  3O6Q B;  2KYV A;  3VRR A;  3OB2 B;  2E5Y A;  1L0N E;  3L73 J;  1YQ3 C;  1L0L G;  1NTZ E;  1Z8L A;  3D7F A;  4OH8 B;  3HPH E;  5E79 E;  1LT9 C;  2W90 A;  3BUX B;  3H1L J;  1KQG B;  5APX A;  3TF5 A;  1GL2 A;  1SQX J;  4IFF A;  3USS A;  4BTF A;  3H32 B;  4MN4 C;  1NTK J;  1SFC D;  4XE5 B;  1ZME C;  1M7L A;  4WBA A;  1YYC A;  3SFE C;  2OTK E;  1JTH A;  3SJG A;  3CL3 D;  2N1T B;  1U57 A;  1FDI A;  3D6Z A;  2ZVN B;  4Y99 B;  1K05 A;  3RGU A;  3RL0 C;  4XFJ A;  2KZI A;  2Y1N A;  4GOE A;  4I7Z B;  5AW5 B;  2BAS A;  3BRT B;  5CCG A;  4WB4 A;  1JY2 N;  3MZW B;  1L0N G;  1AA0 A;  1ZP0 C;  1RE4 C;  4OC2 A;  2KS1 B;  1PGQ A;  4IOI H;  1GL2 B;  5AW1 B;  3B5N C;  3CC7 P;  2CBL A;  2ZVO B;  3V6I A;  2FYU D;  1LWU B;  2OR4 A;  1J1D B;  1FZC B;  2E5T A;  3A2A A;  2BCC D;  1SQP E;  3BUN B;  5AW6 B;  3U88 C;  3H1L D;  1SQV K;  3TYY A;  2IFN A;  2QJK C;  3AE2 C;  3IR9 A;  5KKZ C;  2A45 G;  3CCU P;  1VDF A;  3HE4 A;  1RY3 A;  3GG2 A;  3HRN A;  3S9M A;  3JCU E;  3HD7 A;  1SQB K;  1PL5 A;  1ZW0 A;  2N1T C;  2XNX A;  1OW8 A;  3H1H D;  3M06 A;  2P2U A;  5H2F E;  3H1I D;  2V4H A;  3CCS P;  3H1J E;  1SQQ E;  2P1J A;  5E79 H;  2H7H A;  4RJT A;  4HJG H;  1FS0 E;  1Q2N A;  2K9J B;  5AW3 B;  4P4D A;  2KXP B;  5F13 A;  4C7N B;  2WSC J;  1NTM G;  2WPV B;  1SFC A;  2B88 A;  2OGU A;  2E76 C;  2UV8 G;  3V2P A;  2HOD B;  1OWA A;  3TGU E;  1PP9 E;  4W7Y A;  1QLE D;  1IFD A;  1X22 A;  1GU5 A;  4GIF A;  2OYH A;  1SQV D;  3CX5 E;  3CX5 H;  1JY3 P;  2O3J A;  3BUM B;  4IL6 H;  5DJU B;  1M1J B;  2OAR A;  1VQ7 P;  5APT A;  3PHL A;  3L75 G;  1PP9 D;  4K3A A;  1FZG A;  3SFD C;  3L71 E;  4GOD A;  4JF7 A;  3OB1 B;  4BPW B;  3HUS C;  5AVR B;  5KTB A;  1N7S C;  3IF4 A;  2DLA A;  3M0A A;  2ZJS E;  3S9O A;  2IX7 C;  1Q90 D;  1LTJ A;  3L36 A;  1GW4 A;  5KKZ B;  3P8C E;  3AEC C;  2YIU B;  3SSU A;  4MCQ A;  1DEB A;  1YVH A;  3WUV A;  1LP1 A;  4P4E A;  1EDK A;  4NGR A;  2BCC G;  2FFD B;  4NGP A;  4BWN A;  2HG5 D;  3AEB C;  4P4B A;  3C9I A;  2FFD C;  2YMK A;  2Q3E A;  2WVR A;  1EZV E;  1Y9B A;  3HPG G;  5GTH H;  1EC5 A;  2HPC B;  3G6E P;  2YNY A;  4OGQ D;  1P84 H;  3H1I J;  1SQP G;  1J2J B;  3BXM A;  3GLM A;  1RF1 A;  3WUT A;  4PJ0 E;  1NTK K;  1KIL C;  1JTH B;  2IYP A;  2WSE H;  2BEZ F;  3EFF K;  1SQQ K;  1P84 I;  2NPS A;  2JBJ A;  1VQO P;  4P44 A;  2WSF J;  4L73 A;  1BSN A;  1VQ8 P;  3BVH A;  2AEM A;  1MUU A;  1K04 A;  3H25 A;  1OZH A;  4UB8 E;  1DE4 C;  1KB9 I;  4R4L A;  3Q1M A;  3CCM P;  1FAV A;  1YIJ P;  1NO4 A;  2B89 A;  2Z4E A;  2QIW A;  3H1L G;  1T2K D;  2N9Y B;  5AW7 B;  2Q6Q A;  1AJY A;  3TDK A;  4JQ0 D;  1KC8 Q;  2KZJ A;  5KLV K;  1HGV A;  2CIJ A;  2IFM A;  2Y0C A;  3L72 J;  5AW4 B;  4C7N A;  2OYO A;  1NJI Q;  1KYO H;  1LWU A;  1S9K D;  1YTZ I;  3RL0 g;  2YIU C;  1KFM A;  1J1E C;  3TGU G;  2WPS A;  1RF0 C;  3L75 D;  1M56 D;  3FWN A;  1VPC A;  1GDT A;  1FE6 A;  3G9R A;  3SJF A;  3L71 J;  3C8V A;  4H0L D;  5CBO A;  3PH0 A;  3FEC A;  4AQR D;  4N6J A;  1RQU A;  2KS1 A;  3KDP B;  5DJT B;  2Q9I A;  4NPD A;  2QVA A;  1HH0 A;  3TNU B;  5CMZ A;  2IPP A;  3D71 A;  3FX0 A;  4NPE A;  2IBZ G;  1LTA C;  2Y9Y A;  3QWO C;  4I6M C;  1T3J A;  2YXR B;  2FXO A;  1FDO A;  2GM4 A;  1BGY J;  2SPZ A;  1YJ9 P;  3IWW A;  4P45 A;  1JY2 P;  1LT1 A;  1EXJ A;  3T97 B;  2I1K A;  5K5G B;  3CCE P;  2YO3 A;  1KYO E;  2OTL P;  1JCD A;  3BCC E;  2XPO A;  3CCJ P;  3P8M C;  3CD6 P;  1Z56 A;  2O1J A;  3H1H E;  3BAS A;  1KB9 H;  2K37 A;  3HD7 C;  3H32 A;  1CW5 A;  2C0X A;  3C1L A;  3NTN A;  5EFW B;  2PP6 A;  1A02 J;  1VQP P;  1H88 A;  3IFM A;  3L70 E;  2FYZ A;  2NZ2 A;  3P32 A;  5KAF H;  1YIT P;  1RQV A;  1BCC D;  2OYI B;  1USE A;  3E7K A;  3EFG A;  2OYI C;  1EDI A;  1PGJ A;  5AW2 B;  3CLQ A;  2QSI A;  3F9K C;  1RE4 A;  4QMA A;  3L73 D;  3L74 J;  1SQV E;  3CX5 D;  3ZNI A;  2O01 N;  4PV1 C;  1SQX D;  4LC1 A;  3BRV B;  3AE9 C;  2Q1K A;  1LTS C;  1UIX A;  1BCC E;  4MCS A;  1LP1 B;  3P7K A;  2OOT A;  3D7G A;  1LTI C;  3VMY A;  2A06 D;  1JB0 J;  1CSB A;  1VQ4 P;  3PP5 A;  1G2C A;  1KOR A;  2Q7C A;  2WSS H;  1U7M A;  4ASW A;  2E74 B;  4A4C A;  5GTH E;  1BE3 E;  4N3Y B;  2O01 H;  3GHG C;  4DT0 A;  2C9L Y;  2P67 A;  2FY8 A;  2KNC A;  2A06 E;  3VYI A;  3RK3 B;  1VF5 D;  2HLO A;  4WY4 D;  3IN6 A;  2B87 B;  3FWL A;  2W27 A;  2B87 A;  5TIS H;  1GL2 D;  1Z9E A;  4D6T J;  3VTP C;  3BI1 A;  4EYY Q;  1IFM A;  1N7S B;  3CCR P;  1MZ9 A;  3VRO A;  2OQQ A;  4Y99 C;  4C7R A;  5AXI A;  1DD4 A;  4CPG A;  4OWF A;  3FEE A;  5BVZ A;  4D6T G;  4UB8 H;  2R5B A;  3ZDM A;  2KUB A;  4AYC A;  4JYB A;  2JKV A;  4HYT B;  2D2C D;  2KOG A;  2M5A B;  2MJZ A;  3HE5 B;  3PFV A;  3VMA A;  2WZ7 A;  1MV8 A;  4TLF A;  1MFZ A;  3ABV C;  1NAY A;  2ZT9 C;  3V2R A;  3M91 A;  3WMM 0;  4L75 A;  3B71 A;  1Y8A A;  1KIL B;  4I2L C;  4RR2 B;  4BPU B;  1W2B O;  4DOJ A;  3Q5P A;  4OC4 A;  3H1K D;  1S5L E;  1NTM E;  5AVZ B;  1FOS E;  1CI6 B;  3BCC G;  1VQN P;  1Q86 Q;  1JO5 A;  2KB7 P;  1KZU B;  2CK3 H;  3AE5 C;  1N7L A;  2P58 A;  5KAF E;  3AE4 C;  4OGQ B;  4NGT A;  3V4W A;  2FKW B;  1FZC C;  3U1C A;  4OGQ C;  4PJ0 H;  3CPW O;  1S9K E;  1IK9 A;  3L70 G;  4JZ0 A;  3AEF C;  2B4J C;  2I8D A;  3H1L E;  1QVF O;  2C6C A;  2N9B A;  3L75 E;  1NTZ J;  2XPP A;  3D70 A;  1HTL C;  1QX8 A;  5APY A;  1S1C X;  3RK3 C;  5CCG D;  3MUD C;  3R4Y A;  1L0L K;  1W5C E;  2GUV A;  1WJT A;  1KQF B;  1ZXG A;  2QJP C;  2WPR A;  3AEE C;  3VN0 A;  4K35 A;  3KZI H;  3A0B E;  3E1R A;  5KAI H;  1RF0 A;  3AE7 C;  1NTM J;  5M1B A;  2L5G B;  1BCC G;  1LTB C;  4YXD C;  5B66 H;  1N8R Q;  2W83 C;  2AXT E;  4UB6 H;  3Q5S A;  3SWF A;  1SQB D;  2FYU G;  1PIX A;  1URQ D;  2VRS A;  5KJ7 C;  1P84 D;  1AV1 A;  1EZV G;  1L0L D;  1NYH A;  1NU1 E;  1USD A;  3KPE A;  4NGS A;  3CWB D;  2G3A A;  4MCR A;  2OYI A;  1PPJ E;  1OIP A;  4GKG A;  2WQY C;  5HKZ A;  2KK7 A;  1BE3 G;  2O01 J;  1H8A A;  4KJM A;  2JEE A;  4GPL B;  1KB9 E;  5AVS B;  3RL0 D;  1AFO A;  2Y0E A;  4YXW H;  1N73 B;  1QGK B;  2A06 G;  2BEQ D;  5GTI H;  3RK2 D;  2W6J H;  1P84 E;  1BGY D;  1BDC A;  1NU1 D;  3H1H J;  3LW5 H;  1KIL E;  2YO2 A;  4OC3 A;  4KHX A;  3MP7 B;  1KQS O;  4NGQ A;  2FYN C;  3Q5R A;  1JM0 A;  3GMA A;  4W80 A;  2E42 A;  2PFX A;  3HUS B;  3VOP A;  1NTK E;  4UB6 E;  2JP3 A;  1NU1 K;  1RHZ B;  2QJY B;  3N4X A;  3L73 E;  2Z5H A;  4RO0 A;  1VQL P;  2KSJ A;  2E43 A;  1EDL A;  3SJE A;  2YKP A;  4O9B A;  2Y1M A;  2PGD A;  1MKM A;  2Q3I A;  3AED C;  3FED A;  4OME A;  3LIE A;  4M3L A;  2JDI H;  4WY4 A;  5AVW B;  2WPQ A;  3HTK B;  2HYN A;  1W2E A;  4I7Z C;  4DZO A;  3MHV A;  3KHU A;  4PV1 B;  1EO0 A;  1K8A Q;  4P4F A;  3BI0 A;  3L74 E;  2JJL A;  2V7Q J;  2B9B A;  1PZQ A;  2GA1 A;  3D6Y A;  1R5S A;  2C6G A;  2FBW C;  3FGA D;  4H0L B;  2XEI A;  1AVO A;  4WVZ A;  4MCP A;  2C6P A;  4P4J A;  2Z5I A;  2E74 C;  2YXQ B;  2M8R A;  1IFN A;  1YQ4 C;  3CWB G;  4Z1M H;  3L70 J;  5APQ A;  4ZNC A;  2UWJ E;  1X9V A;  3A7O A;  3KYQ A;  3MTU E;  1XTG B;  1JOC A;  2GUS A;  2J58 A;  2VKZ G;  4BRY A;  1JMB A;  1GK6 A;  2FYU K;  4OC1 A;  3CX5 I;  4H13 B;  1WT6 A;  3H1K E;  1IK7 A;  1K73 Q;  1NTZ D;  2KSE A;  5HKY A;  3M0D A;  2POH A;  3JCU H;  2FYU E;  2WT7 B;  1LT9 A;  3O8Z A;  1PPJ G;  1PP9 G;  1FZA A;  1R8E A;  3I5C A;  3BUW B;  2Y0D A;  3JC2 2;  3GHG A;  3NXS A;  3L4F A;  1IFI A;  3CCL P;  4HH2 A;  3U1A A;  2E76 B;  1JMM A;  1HJB A;  3Q3D A;  1D7M A;  1L2P A;  5CCH C;  2K3R A;  3CCV P;  1N73 A;  2WSE J;  1L4A A;  1NAF A;  1NHL A;  2Q5U A;  2W6B A;  3H1J D;  3S9N A;  1LTG C;  1IFJ A;  2RKL A;  2LXB A;  2ZXE B;  1FC2 C;  3L35 A;  1MFT A;  2MKV A;  3UIA A;  1YHQ P;  4DCK A;  1YTZ T;  2LXC B;  4EI2 A;  1L0N J;  1ZOY C;  1YJN P;  1VQ5 P;  1LGH B;  2K88 A;  3IAO A;  4LQG A;  1G2C B;  1X0T A;  5CBN A;  2E75 D;  1BGY G;  2JWD A;  4BXL A;  3GW6 A;  2IYO A;  1SQP D;  2FYN B;  4YTP C;  3VRP A;  1PP9 J;  3HE5 A;  3S9L A;  4IFD K;  1RF1 C;  4IL6 X;  2KNC B;  4IL6 E;  4ZMD A;  2FXM A;  3S1K A;  1QL2 A;  4PD4 H;  3CCQ P;  2QG4 A;  3AE3 C;  1FU1 A;  2H43 A;  1G1I A;  1T2K C;  4H44 C;  5HKW A;  1VF5 B;  4WY4 B;  3OJA B;  2KLU A;  4N78 E;  3CWB J;  2N1T A;  3CXH E;  2W6A A;  3H1I E;  2NRG A;  2WWW A;  1VQM P;  3CC4 P;  2XV5 A;  3ITK A;  2NPS B;  1N86 A;  3M9Q A;  1ZLL A;  1Q82 Q;  1URQ A;  3TSI A;  3HUS A;  3VGO A;  3VMZ A;  3LID A;  1BGY E;  4W7Z A;  4DJG A;  1JY3 O;  1BSH A;  1LTJ C;  5APW A;  2XKM A;  4NPF X;  2WSC H;  3Q2Y A;  2QJK B;  1IZN B;  3P8C D;  4N78 D;  1SFC C;  3CME P;  4U7J A;  1CX8 A;  3WUU A;  3AE6 C;  4H0L C;  1S2E A;  3V4Q A;  3TGU D;  3FXE A;  2RN0 A;  3RBX A;  1YBK A;  2M0B A;  1K9M Q;  3OP0 A;  3FF3 A;  2LKM A;  1NTK D;  1URQ C;  5KJ7 D;  4HKZ H;  3D7H A;  1FZC A;  2C0W A;  4U3F G;  1YJW P;  2IBZ I;  5AW8 B;  4EDF A;  3FXD A;  1N7S A;  1SS1 A;  2XU6 A;  3VP9 A;  4JBZ A;  3R2P A;  3L72 E;  1FZF A;  5CJ0 A;  4PD4 D;  3RK2 B;  4LGD E;  2XEF A;  1BDD A;  2IBZ D;  3L71 D;  1PFI A;  1EQ7 A;  3RK2 C;  3PRJ A;  1HF9 A;  3MUD A;  2XEG A;  3V2Q A;  3H1J G;  3RL0 B;  1L0L J;  2FYU J;  3B8E B;  3N7N A;  3BAT A;  3I56 P;  2CPB A;  1GZL A;  2NPS C;  2P7J A;  1NOH A;  3B4S A;  1L4A C;  1LTT C;  1KQL A;  4B86 A;  2K9J A;  2OTJ P;  4PD4 E;  1N2D C;  1NTZ G;  3VRN A;  3KAS A;  5J3X A;  3CI9 A;  3T97 A;  4A7P A;  1OVU A;  1OVV A;  4X3R A;  1X8Y A;  4U3F E;  2PVW A;  1SFC B;  1VQK P;  3A3Y B;  1PGP A;  3MIW A;  2IZ0 A;  3AE8 C;  1E79 H;  1RE3 C;  1CZQ A;  1FOS F;  4ZKU A;  2N1T D;  2K1A A;  2RH0 A;  2M3E A;  3KZI E;  1L0N D;  5B5E E;  2OYH C;  3HD7 B;  1J1D C;  4U3F J;  3VP8 A;  1JNM A;  5KLI B;  1NTM D;  4PV1 D;  2AEF A;  3GHG B;  3L75 J;  1HBW A;  5F09 A;  5AW9 B;  1RH5 B;  5CHX A;  5H2F H;  1KMI Z;  3I55 P;  3M9H A;  3WU2 H;  4OC0 A;  4L76 A;  1FZE A;  1VQ9 P;  2H89 C;  2E76 D;  1NTM K;  3PT1 A;  2QJY C;  1SQV G;  3U59 A;  1KN7 A;  2R3S A;  1NWQ A;  3S4R A; 
#chains in the Genus database with same CATH homology
 5KJ7 A;  1LWU A;  1LT9 B;  2C9N Y;  1S9K D;  1JCC A;  1YTZ I;  2YKQ A;  1KIL D;  3N4X A;  1NTZ K;  1SQP K;  2Z5H A;  1KFM A;  1J1E C;  1IJD B;  1RF1 B;  2WPS A;  1RF0 C;  2KSJ A;  2E43 A;  2A45 I;  1OXZ A;  1VPC A;  1GDT A;  4IFM A;  2YKP A;  1ZV8 A;  4O9B A;  4LLH A;  1NH4 A;  1ZR4 A;  1FJK A;  2Q3I A;  5AVU B;  1SQX K;  3LIE A;  3MGN A;  4M3L A;  1GL2 C;  4GT1 A;  4AQR D;  4WY4 A;  5AVW B;  4N6J A;  2WPQ A;  3II6 A;  3B5N A;  3KDP B;  1GTW A;  2R3C A;  4AUW A;  3HTK B;  2Q9I A;  2HYN A;  1W2E A;  2HFE D;  1HH0 A;  4DZO A;  1L4A B;  5AVQ B;  3TNU B;  5CMZ A;  2IPP A;  2KLV A;  1LTA C;  2J59 M;  1EO0 A;  3OAK A;  1N73 C;  4I6M C;  2PAJ A;  5AVY B;  1T3J A;  1A02 F;  1NKZ B;  4XA4 A;  3RK3 D;  2GM4 A;  2KP8 A;  2JJL A;  1JY2 P;  2CPS A;  2I1K A;  3TNU A;  1L0N K;  3VMX A;  4JYC A;  5CJ4 A;  1GK4 A;  2YO3 A;  1JCD A;  2KYV A;  2XPO A;  1DH3 A;  3P8M C;  1JY2 O;  3H6P A;  1Z56 A;  2M3B A;  2O1J A;  3G3Z A;  3BAS A;  3HD7 C;  2Z5I A;  3H32 A;  1CW5 A;  2C0X A;  3TK1 A;  3NTN A;  2M8R A;  1IFN A;  1URQ B;  4OH8 B;  3HPH E;  1LT9 C;  2PP6 A;  1A02 J;  5APQ A;  5APX A;  3L37 A;  1GL2 A;  2XZR A;  4IFF A;  1H88 A;  3IFM A;  1X9V A;  5CCH D;  3H32 B;  3A7O A;  3KYQ A;  3MTU E;  1XTG B;  2FYZ A;  1SFC D;  1JOC A;  4XE5 B;  1FBM A;  1M7L A;  2GUS A;  2J58 A;  4WBA A;  3P32 A;  1YYC A;  1GK6 A;  1JTH A;  2OYI B;  2FYU K;  5APU A;  3CL3 D;  2N1T B;  3EFG A;  1WT6 A;  2OYI C;  1FJP A;  5AW2 B;  2YKO A;  3CLQ A;  4Y99 B;  3M0D A;  2POH A;  3RL0 C;  4EIJ A;  3F9K C;  2WT7 B;  1LT9 A;  3O8Z A;  1E5W A;  1IO4 A;  5AW5 B;  2BAS A;  1RE4 A;  1FZA A;  3I5C A;  3BRT B;  5CCG A;  4WB4 A;  3GHG A;  3NXS A;  3L4F A;  1JY2 N;  3BRV B;  1IFI A;  4LC1 A;  4HH2 A;  1RE4 C;  1LTS C;  1JUN A;  3B5N B;  3P7K A;  5CCG C;  3U1A A;  2YMY A;  1GL2 B;  1LTI C;  5AW1 B;  3VMY A;  3B5N C;  2WSF H;  1JMM A;  1T3U A;  1HJB A;  3V2N A;  1CSB A;  1LWU B;  3M0D C;  1J1D B;  1FZC B;  5CCH C;  3V5B A;  3A2A A;  3PP5 A;  1G2C A;  1HGZ A;  4EOT A;  1N73 A;  5APV A;  2Q7C A;  5AW6 B;  1L4A A;  1NAF A;  3U88 C;  1NHL A;  4RES B;  4N3Y B;  2O01 H;  2Q5U A;  4I1L A;  2W6B A;  3GHG C;  1DX7 A;  1SQV K;  1FZB A;  3TYY A;  2C9L Y;  1LTG C;  1IFJ A;  2IFN A;  2P67 A;  2ZXE B;  3IR9 A;  1CI6 A;  2I1J A;  3L35 A;  3UIA A;  2A45 G;  1VDF A;  3HE4 A;  1YTZ T;  3VYI A;  5BU8 B;  1RY3 A;  3HTK A;  3RK3 B;  3HRN A;  2HLO A;  1XTC C;  4WY4 D;  2XPN A;  5AVT B;  1LGH B;  2W27 A;  1G2C B;  1GL2 D;  3HD7 A;  1Z9E A;  1SQB K;  3VTP C;  1IC2 A;  3NFQ A;  3OA7 A;  2N1T C;  1IFM A;  2XNX A;  2QM7 A;  1N7S B;  3HE4 B;  3HE5 A;  2P2U A;  3M06 A;  1MZ9 A;  4Y99 C;  4C7R A;  4IFD K;  1HWT C;  1RF1 C;  2HOD A;  2P1J A;  3B5N D;  5BVZ A;  2H7H A;  2R5B A;  2FXM A;  5AW3 B;  1QL2 A;  4AYC A;  4JYB A;  2WT7 A;  4HYT B;  2KOG A;  4C7N B;  2MJZ A;  2O1K A;  3HE5 B;  1FU1 A;  2WZ7 A;  2H43 A;  1G1I A;  1MV8 A;  1HVV A;  5APS A;  1MFZ A;  1T2K C;  1SFC A;  4WY4 B;  3V2R A;  3M91 A;  3OJA B;  3WMM 0;  4N78 E;  2N1T A;  2W6A A;  1KIL B;  4I2L C;  5AW0 B;  2HPC A;  3V2P A;  2HOD B;  1OWA A;  2WWW A;  5BU5 A;  4DOJ A;  2XV5 A;  1H89 A;  3HD7 D;  2NPS B;  1LWU C;  1N86 A;  1M1J A;  3M9Q A;  1ZLL A;  3SWY A;  4W7Y A;  1URQ A;  2R32 A;  3TSI A;  3HUS A;  5AVZ B;  1FOS E;  1CI6 B;  3VMZ A;  3LID A;  4W7Z A;  1IFD A;  2WIT A;  1GU5 A;  1ZR2 A;  1JY3 O;  4GIF A;  2OYH A;  2WTY A;  1GD2 E;  1LTJ C;  5APW A;  2XKM A;  1JO5 A;  1ZN5 A;  1SP4 A;  2WSC H;  2KB7 P;  1KZU B;  1JY3 P;  5AVV B;  3P8C D;  4N78 D;  1SFC C;  1RE3 A;  1LTJ B;  1N7L A;  2NPS D;  3EQ2 A;  5CCH A;  3V4Q A;  3V4W A;  1M1J B;  1L4A D;  2OAR A;  5APT A;  4C7N A;  1GU4 A;  2FKW B;  1FZC C;  3U1C A;  1FZG A;  2LKM A;  2FFD A;  1M1J C;  4JF7 A;  1URQ C;  3HUS C;  5KJ7 D;  1GW3 A;  5AVR B;  5KTB A;  1N7S C;  1S9K E;  1FZC A;  2C0W A;  1IK9 A;  3M0A A;  2B4J C;  2IX7 C;  5AW8 B;  2N9B A;  1LTJ A;  4C46 A;  3L36 A;  1GW4 A;  3E1I A;  3P8C E;  4ZKP A;  1N7S A;  2XU6 A;  1DEB A;  3VP9 A;  2XPP A;  1J1E B;  1HTL C;  3R2P A;  5APY A;  3RK3 C;  1FZF A;  5CCG D;  2R5D A;  5CJ0 A;  3RK2 B;  2FFD B;  4LGD E;  3A5T A;  1KFN A;  2HG5 D;  1PFI A;  2A45 H;  1EQ7 A;  1SVF A;  3C9I A;  3RK2 C;  2FFD C;  1L0L K;  3MUD A;  3V2Q A;  3RL0 B;  2GUV A;  1WJT A;  2WPR A;  3B8E B;  3N7N A;  3VN0 A;  3BAT A;  2CPB A;  1GZL A;  2NPS C;  3HPG G;  1RF0 A;  2P7J A;  1NOH A;  1QL1 A;  2L5G B;  1LTB C;  2HPC B;  3M9B A;  1L4A C;  1LTT C;  1KQL A;  4B86 A;  1AQ5 A;  1JY3 N;  2YNY A;  1N2D C;  3SWF A;  1HUC A;  3CI9 A;  1URQ D;  1J2J B;  3T97 A;  2VRS A;  5KJ7 C;  1RF1 A;  1N7S D;  4WY4 C;  1X8Y A;  3KPE A;  1SFC B;  2XPL A;  1NTK K;  3A3Y B;  1KIL C;  3MIW A;  1G1J A;  1JTH B;  2OYI A;  1RE3 C;  2WSE H;  1CZQ A;  1FOS F;  4GKG A;  4ZKU A;  2QM8 A;  2N1T D;  1H8A A;  2OYH B;  2JEE A;  1NKN A;  1SQQ K;  1KIL A;  2NPS A;  5AVS B;  3RL0 D;  3BVH A;  3NMD A;  2OYH C;  1X79 B;  3HD7 B;  1J1D C;  1MUU A;  3VP8 A;  1AFO A;  1JNM A;  1N73 B;  2H8P D;  2ZFC A;  3RK2 D;  3LW5 H;  2YO2 A;  3GHG B;  1HBW A;  1T8Z A;  5AW9 B;  5CHX A;  1FAV A;  4KHX A;  1NO4 A;  1WRG A;  2Z4E A;  5AVX B;  1T2K D;  3M9H A;  1SLQ A;  2N3A B;  5AW7 B;  1FDM A;  1FZE A;  3MD0 A;  4W80 A;  2E42 A;  3HUS B;  1NTM K;  3VOP A;  5KLV K;  1NWQ A;  1HGV A;  3U59 A;  2IFM A;  5AW4 B;  1NU1 K;  2XDJ A;  3KQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...