3NFQA

Crystal structure of the conserved central domain of yeast spn1/iws1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nfqA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3nfqA02
3VYIA 2H7HA 3IR9A 3P7KA 1G2CB 1FOSE 5APUA 1KQLA 5APTA 3V5BA 5AVQB 5AW2B 2XZRA 4C7NB 1S9KE 1T2KD 2JJLA 1MFZA 2IPPA 1X8YA 2R5DA 4I2LC 4RESB 1J2JB 4C7NA 1GU5A 1HJBA 2XV5A 1GTWA 3NTNA 1H88A 1SP4A 2Z5IA 3SWFA 2WPQA 4M3LA 1NWQA 4AQRD 4B86A 3M06A 1DH3A 5AVVB 2BASA 2ZXEB 4C46A 1GU4A 2XPNA 3TK1A 1T2KC 5APSA 1GD2E 1NAFA 2WT7B 2R3CA 2VRSA 4KHXA 3P8MC 3L37A 5AVUB 5AW0B 3M9HA 2E42A 1CI6A 1GK4A 3LIEA 3HPGG 2YO2A 3UIAA 3VN0A 5APYA 1JNMA 5AW7B 3U88C 4XE5B 3TNUB 4AUWA 1EO0A 3KDPB 2P2UA 3I5CA 3L36A 3VMZA 1HWTC 4JYCA 3M0AA 5AW1B 3TNUA 2Q5UA 3TYYA 2QM7A 1GK6A 1GZLA 2P67A 2WPSA 4GT1A 4DZOA 4EOTA 3O8ZA 1HBWA 1YYCA 3VMXA 1FOSF 2W6AA 2Z5HA 2N3AB 2E43A 2XPLA 3HE5A 5AW5B 3KQGA 1FAVA 1CZQA 3A3YB 5APWA 3HE4A 5AVWB 4AYCA 3A2AA 2YNYA 5AW4B 5AVRB 3MGNA 5AW6B 3L35A 1JUNA 3A7OA 4GKGA 3T97A 2WWWA 3P32A 3HE5B 2C9NY 1HUCA 2C9LY 3HPHE 5AVZB 2W27A 1MV8A 1A02F 5APXA 5AVYB 2XPPA 2WPRA 2B4JC 2WTYA 1MUUA 4HYTB 3HTKA 3B8EB 1SLQA 1Z9EA 2Q3IA 1OXZA 2XPOA 4JYBA 2KP8A 5AW3B 5CMZA 2QM8A 2R32A 2YO3A 3F9KC 3M0DA 1IO4A 5AVXB 5APVA 2ZFCA 5APQA 3NMDA 2P7JA 1H8AA 1A02J 1CI6B 3M9BA 3NFQA 5AVTB 2R5BA 2XU6A 5AVSB 3VMYA 3M91A 4I6MC 5AW8B 2WT7A 4LC1A 2Q7CA 3VTPC 3V4QA 1CSBA 1OWAA 1WJTA 1H89A 2N9BA 3OAKA 3NXSA 3A5TA 3MD0A 1S9KD 5AW9B 3V4WA 3LIDA 3HE4B
chains in the Genus database with same CATH superfamily
2HYNA 2OYIC 1FZCB 1RF0C 3RK3C 4C7NB 1X8YA 1KQFB 3PH0A 1ZLLA 2IX7C 2PGDA 2XNDH 2W6JH 2FFDC 3L75E 4LGDE 2N1TA 2VRSA 2XEFA 5AW0B 4XFJA 3L72J 3UIAA 2ZJSE 2HODA 1TU3F 4XE5B 4AUWA 2P2UA 3AE2C 1NTZJ 5AW1B 1KV4A 5BY0A 2P67A 1PGQA 3OJAB 2CBLA 5HKWA 1SQVD 2Z5HA 5AW5B 1YTZI 4NGRA 1KQSO 1BCCE 3VRNA 1MZ9A 1NTZE 1X22A 5AVZB 4RKUJ 4DCKA 3H1KJ 1VQ9P 2A45I 2QVAA 1R8EA 3QWOC 2K9YA 1BDDA 2FXOA 1LT9C 4ZKPA 1GL2A 2H43A 3S9OA 2BCCG 1Q86Q 4U7JA 1PP9E 3N4XA 3V6IA 1FZCC 2NPSB 1VQMP 5EFWB 2YMKA 4EYYQ 1JOCA 3A0BH 2I1KA 3HUSB 4I1LA 4RO0A 1MFZA 2IPPA 4RESB 4I2LC 5GTIH 2XKMA 3HUSA 1SQVG 3AECC 4M3LA 1EXJA 3L73G 1PV3A 3R4YA 5KLVJ 3BCCG 1NAFA 1OW7A 3H32B 1RQVA 3VRQA 3CCMP 2C0WA 5CBNA 4JPZB 1BGYD 1BCCD 1ZP0C 2FYUK 3S9LA 2E76B 5KLVE 1DE4C 1BDCA 2MJZA 1LT9A 3L71E 5BU8B 3VMXA 3KQGA 2KUBA 3O6QB 1J1EB 1KZUB 2KLUA 4NGPA 1LGHB 3L71J 2JBJA 2I1JA 4YPCA 2W83C 2G8YA 1AVYA 1ZRTD 1YITP 1M7LA 2R32A 3K5BA 3V2PA 3SJEA 1J1EC 1PGPA 3A0HH 3B71A 5KAFH 1LWUA 5GTHH 4A4BA 1FZEA 1P84D 3CWBG 1AVOA 1DX7A 4N78D 1D7MA 3VYIA 4OC0A 2RH0A 3QH9A 1BE3D 3CCSP 5APUA 3AEGC 5AVQB 2L91A 2FYZA 2KNCA 3RK2B 3SFDC 1FZAA 1K05A 1HGZA 2E75C 4MCQA 3CCLP 1GU4A 1L4AC 2D2CD 3PRJA 3SJXA 2ZYAA 3CC4P 3GG2A 1LWUB 4CPGA 3P8CE 3E7KA 3P8MC 3FEDA 1NAYA 4UB8E 2KSEA 3IFMA 4I7ZB 2HR3A 4RR2B 5J3XA 3VP8A 1GK6A 3FWNA 1S72P 1AQ5A 4EOTA 1NTMJ 2D2CB 2R3SA 5CCHC 1EQ7A 1Q90D 4JF7A 4IFMA 3GLMA 2XDJA 2A06E 3VROA 3D6ZA 5CCHD 3RK3D 3MZWB 1W5CE 2QJPB 1LP1A 1NTKK 3B5NA 1XTCC 2WTYA 1BGYJ 4HJGH 4D6TD 2OR4A 1PIXA 3AEFC 2HFED 3NFQA 3EWKA 1SQQE 4Y28J 3CCUP 4I6MC 4LC1A 1K9MQ 3L73J 2A06D 3M0DC 3IN6A 4WY4D 1KILB 1FE6A 1ZV8A 1FOSE 2E5TA 2CIJA 2GUVA 2H89C 1IFMA 1QL1A 1N7SC 4C7NA 1HJBA 3VGOA 4OC5A 1U7JA 3BRVB 1VQ4P 3FX0A 3Q2YA 3L74D 4C7RA 2ZXEB 4JYWA 3JSVC 1SQXE 3AEDC 1KQGB 2YKPA 2QEXP 3Q5RA 1UIXA 3H1HE 3U88C 3H1LJ 2Y1MA 1L0LE 3AEEC 5CCGD 2OYHB 5D29A 2VKZG 1SFCA 2I8DA 2FFDA 1IK9A 3L75J 4GODA 1FOSF 2E43A 1FAVA 3D7FA 2GM4A 5KLVK 1HVVA 4GDOA 2M5AB 2AXCA 2DW3A 3AE3C 1EDIA 2C9LY 1LTTC 4IL6H 1URQC 3L72D 3I56P 1OXZA 2N1TD 2YO3A 1EZVG 2NRGA 2YMYA 3SJFA 2V4HA 1NGMB 1OVRA 3A5TA 1BSNA 1SFCD 1L2PA 1RE4A 5KAIH 1CX8A 4DT0A 2IZ0A 3IF4A 3WU2E 1NKNA 1NH4A 2FFDB 4YTPC 2QG4A 1JCDA 2K9JA 1PFIA 5B66H 4H44D 1AA0A 3FF3A 2BASA 4IFFA 4IL6E 1T2KC 1LNQA 1NVOA 3VMAA 2LXBA 1NU1J 1JB0J 2PP6A 1KYOD 3G3ZA 1JO5A 1PGOA 3RK2C 1GW3A 2YIUB 4R4LA 4JYCA 3L72G 2PAJA 1N7SD 2QM7A 1YHQP 3AEBC 2P58A 1L0NE 1EZVD 4I7ZC 1VQPP 2E74D 2W6AA 2WSEH 2WSSH 3SWYA 3AE7C 1YQ3C 4AYCA 1HGVA 4DJGA 3L35A 4GKGA 4IFDK 1N73C 1RF1B 1KYOE 5KLVD 2C9NY 5B5EE 1JY2N 3S4RA 3E1RA 2XEGA 1JM0A 2OTKE 2IBZE 2SPZA 3GHGC 1JY3N 1BCCJ 2M3BA 1PPJE 3P8CD 1FC2C 1T3JA 1L0LJ 3M0DA 1LP1B 3B5NB 2LR2A 2QJKC 2HPCA 1NTKD 1CI6B 4HB1A 4D6TG 1OWAA 2NZ2A 3L75D 2KIKA 1H89A 2JO1A 3NXSA 1LWUC 1N7SA 5AW9B 3H1HJ 4U3FG 2PRRA 1LTJB 4L75A 3D7DA 5AW2B 4P4IA 2IFNA 1GDTA 2OOTA 1LTGC 1GU5A 1GL2C 2A45H 3CL3D 5H2FE 1N7SB 3CWBE 1N8RQ 3TK1A 4BXLA 3H1HG 5B5EH 4MCPA 2IYPA 2E76D 1FJKA 4W80A 3CC7P 1R5SA 1SQBE 1KTMA 2BEZF 2YO2A 1S2EA 1M56D 5KLIC 4U3FE 2Y9YA 3PP5A 1SVFA 1AJYA 2MKVA 1GZLA 3EFGA 1AFOA 1G1JA 3BHXA 1M90Q 5GTHE 4EI2A 2PFXA 1PPJG 3T97B 3A2AA 4U3FJ 2E74C 1M1KQ 1VQ6P 2P1JA 3CX5E 3CXHH 1ZR2A 5ELYA 3RK2D 1JY3P 2BCCJ 5H2FH 2H8PD 1NTZD 3ITKA 1SLQA 1G1IA 3FECA 1M1JB 2FY8A 5KJ7C 3CCRP 4GPLB 2RN0A 5E79H 2ZFCA 2KB7P 3AE4C 3NMDA 2UV8G 1H8AA 2O1KA 1NHLA 3PT1A 4EIJA 1S3JA 1CSBA 1VQ7P 4ASVA 1S9KD 3KZIH 2POHA 2WSFH 1B47A 3LIDA 1N7LA 3AE5C 2ZVOB 3H1JG 5CCGC 2WMMA 1NKZB 1SQPK 2NPSD 1FU1A 1QL2A 2XV5A 3U59A 1SQQG 3H1IJ 3E1IA 4D6TJ 3O6QA 2Z4EA 4KT0J 5HKZA 1NTME 2JDIH 1L0LK 1L0LD 2HLOA 3HD7B 3CCJP 1KB9H 2ITAA 2OARA 1Z56A 1PGJA 3TDKA 3VRRA 4W9YA 4WY4A 4MCRA 3KZIE 3GF7A 3CXHD 1W2BO 5AVWB 2PVWA 1Y47A 1URQD 2O3JA 2QJKB 2WWWA 5TJHA 1HTLC 3R2PA 3L72E 1EZVI 1KILE 4N78E 4NGQA 2XPPA 1KMIZ 2WPRA 3TSIA 5GTIE 3CX5D 4TT3H 1ZXGA 4H44C 2OYIA 2J58A 1FDMA 5CCHA 3H1LD 1NO4A 1VF5D 3B5ND 3H1KG 2M0BA 2M8RA 5AVSB 3ZDMA 3L70D 2E5YA 1WJTA 3L71D 3MHVA 4PD4H 2C0XA 3V4WA 3WUVA 4H13B 1EDLA 4XA4A 1G2CB 1NTKG 2QRXA 3HTKB 4WY4C 1S9KE 1T2KD 1YIJP 4HH2A 3L75G 1RE3C 4BTFA 3BVHA 4A4CA 1SP4A 2AEFA 3HD7D 5AVVB 4LLHA 4WB4A 2WT7B 3H1KE 1IFJA 3CXHE 1OZHA 5AVUB 2JP3A 1NYHA 1VQKP 2FYUE 5AW7B 4H44B 4L76A 4RJTA 2DLAA 2ZAEB 3I5CA 3MP7B 3H1IG 2Q5UA 1ZR4A 3JCUE 2HODB 1BE3E 1HBWA 1YYCA 4PD4E 1CZQA 2OGUA 5KAFE 4OC4A 3D70A 5AW4B 3TGUJ 5CJ0A 2V7QH 1E5WA 2O1JA 3CMAP 1KFMA 1SQXG 1U7MA 1NTMG 2J59M 5TISH 1YVHA 1RE3A 5HKYA 4WBAA 1NU1D 5B66E 4K3AA 1IZNB 1KILC 5F13A 1N73B 4OMEA 3PHLA 5AW3B 2B89A 1PZQA 1L4AD 4NPEA 5CMZA 5APVA 1A02J 3G6EP 3H1JE 1HJ0A 4P44A 1NTMK 2C6GA 1KB9E 1GL2D 1JY2P 1LTAC 1ZOYC 1RQUA 3RBUA 3C1LA 2IYOA 1LTBC 4GIFA 2KSJA 3AEAC 3H1JJ 3A0HE 2D2CC 4ZMDA 1OFCX 1N86A 1KILD 2ZVNB 4PJ0H 1NWQA 3M06A 1BGYE 3BATA 5TISE 4PD4D 2KK7A 1LJ2A 1QVFO 1S5LX 4H0LC 3IWWA 1VPCA 2OTJP 4NGSA 1CW5A 2W90A 3KYQA 4GT1A 2A45G 1NOHA 1VQ8P 4BWNA 2V7QJ 3MIWA 1WRGA 1MKMA 3USSA 4N6JA 2GA1A 1VQOP 1OX3A 3BUWB 3HPHE 2ZT9C 2W27A 1ZRTE 1P84H 3EQ2A 3PLNA 4PJ0E 2QIWA 4L74A 3MTUE 3HTKA 3CXHI 1L0LG 2H88C 2ZXXA 1RY3A 2XPOA 1L0ND 2FYUD 3U1CA 2JWDA 3OP0A 5APQA 1U57A 1VQLP 1QX8A 3OB2B 2O01J 1VQ5P 1IFIA 4Y99B 3SSUA 3HE4B 1IJDB 4U3FD 1KQLA 5APTA 2YXRB 2R5DA 5KLIB 1UIIA 1KD1Q 2GUSA 2K88A 5M1BA 2Z5IA 4LQGA 3WMM0 2CK3H 1YJNP 2KS1B 1JCCA 1P84E 3CX5H 1IFPA 1P84I 4ASWA 2O01N 1GK4A 4PV1B 5AXIA 3VN0A 1JNMA 2E76C 2N1TC 2R44A 1Q2NA 3CX5I 1VQNP 3D7HA 2B87A 2WPSA 3C9IA 1PPJD 2XPLA 5BVZA 2UWJE 3BXMA 3H1ID 2FKWB 1KYOI 5AW6B 4OH8B 2WPVB 2WZ7A 1PP9D 3P32A 1SQBD 3KHUA 2AEJA 4OWFA 1JMBA 1NTZG 1QVGO 2JEEA 2KP8A 1KYOH 3S9NA 3F9KC 2KLVA 1NU1G 5CHXA 1FZBA 2WQYC 3BCCD 1WT6A 5AW8B 2QJYC 1M8OB 3OAKA 2AXTE 3N7NA 3U1AA 1X79B 1M1JA 1IC2A 2B9BA 1KORA 4L73A 1VDFA 2J5UA 4NPFX 3L74E 1SQPD 3CD6P 1OW8A 1SQXJ 1XTGB 2YKOA 2P10A 2E75B 1FZCA 1SQQD 2WPQA 1S1CX 4OGQB 2WSFJ 1QGKB 4OVNF 1L4AB 3BCCE 4Z1MH 1NU1E 3D6YA 2K1AA 2R3CA 2NPSA 4OC1A 2FYUJ 2E42A 1KFNA 3OB1B 3HPGG 1SFCB 2N9YB 4NGMA 3FXEA 3L36A 3M0AA 1DEBA 3TYYA 4YXDC 3GW6A 3RK3B 4O9BA 4OC2A 1FS0E 3MGNA 3WUUA 3A7OA 4JBZA 3CWBJ 2KZIA 1N2DC 3V2NA 3BI0A 3BUMB 2B87B 1SQVK 1Y8AA 3HRNA 2QSIA 1FDOA 1K73Q 1T8ZA 1KILA 5AVXB 3H1LG 1NJIQ 3I55P 1IFDA 3L70G 1LT1A 3VMYA 2WT7A 3H1KD 2HPCB 2KS1A 1L0NG 2LXCB 2AXTH 3Q5SA 2BCCD 4OGQD 3G4SP 1H0TA 1Q7YQ 1GTWA 4R4MA 3D71A 2QJYB 2HG5D 4H0LB 1LTIC 2XPNA 5F09A 2JKVA 5K5GB 1DD3A 4BPWB 3L70E 1FBVA 2M3EA 4IL6X 3M9HA 2YXQB 2E74B 1L4AA 3OW2O 2C6CA 3BCCJ 1S5LH 2BCCE 2RKLA 5L8RJ 5KJ7D 3VMZA 1N73A 1NTKE 4QMAA 2OYHC 4K35A 2Q1KA 1BGYG 4N3YB 1YI2P 2Y0EA 4DZOA 1JTHA 1AV1A 3ZNIA 3PFVA 3FWLA 3H1JD 2QA4P 1EDKA 1SQXD 2A06G 3S1KA 1HH0A 1SQQJ 3T97A 3G9RA 1W2EA 4BRYB 1MV8A 4P4JA 3SJGA 3L73E 2FBWC 2PVVA 4PV1C 1RF0A 4HYTB 3RK3E 2ZT9B 4WVZA 2Q3IA 4WWIA 4JYBA 1SQBG 1Z8LA 2QM8A 1OW6A 2XEIA 3PLFB 3RL0B 3WU2H 1M1JC 4BRYA 4ZKUA 2XEJA 1HF9A 2IBZI 5KLVG 3P7KA 2G3AA 2XZRA 3VRPA 2C6PA 3CWBD 1J2JB 1SQBK 3D7GA 2WVRA 3NTNA 1YTZT 4P4FA 2KI7B 5CJ4A 3H25A 2BEQD 5APSA 1ZN5A 1BE3J 2K37A 3RGUA 1L0NJ 5KTBA 4MCSA 1R5LA 3CLQA 1IK7A 1Q81Q 1RF1C 3L37A 1CI6A 3II6A 2CPSA 5APYA 1DEEG 5KJ7A 2OTLP 2OYIB 2XNXA 1EXIA 3L71G 3O8ZA 1RH5B 3C8VA 1E79H 2W6BA 1DIPA 3H6PA 2IDBA 2E75D 2YIUC 1T3UA 3JCUH 1S4XA 1A02F 3RL0D 3CPWO 3L70J 4P45A 2B88A 3W68A 5KKZB 1GL2B 1MUUA 3B8EB 1VF5C 1Z9EA 1OMIA 3HD7A 2FYUG 3MUDC 3M9BA 1ZW0A 3TGUD 2XU6A 3CMEP 5CBOA 3TF5A 2WSEJ 3V4QA 1BSHA 3IAOA 4P4EA 3MD0A 1GW4A 2H7HA 3BI1A 4W7ZA 2K9JB 1OVUA 4TLFA 1KB9I 2W8ZA 1SQVJ 1YJ9P 1YQ4C 1K04A 2O01H 3AE6C 2JWAA 3GHGB 4X3RA 1H88A 1G2CA 3L73D 1SQXK 3SWFA 3V2RA 1NTMD 4C46A 2NPSC 3BUXB 3BRTB 2AEMA 1EC5A 3AE9C 2Q3EA 1OIPA 3KASA 1JMMA 2QE7H 4KHXA 3KPEA 1T6AA 1QEXA 3PJSK 2Y0DA 3L74G 3HD7C 5DJUB 1X0TA 4PV1D 3KDPB 1GMJA 4GOEA 1NU1K 3G71P 2KNCB 1NTZK 4ZNCA 1J1DC 4A7PA 3HE5A 4PD4I 4Y99C 3TGUG 1EDJA 2FXMA 1LTJC 1SQPJ 1FDIA 4P4BA 4KJMA 2OYOA 1JUNA 2M5AA 1DD4A 2JR8A 1RHZB 1PP9G 4NPDA 5APXA 2IZ1A 3H1LE 2B4JC 1M57D 2ZYGA 3AE1C 1SQPE 5KAIE 3BASA 3FEEA 1ZMEC 3GF3A 3L74J 5AVTB 1USEA 5BU5A 3M91A 4UB6H 3H1IE 1EZVE 1BE3G 1J1DB 2KYVA 3IR9A 3EFFK 1MFTA 3GHGA 3V5BA 4D6TE 1LT9B 1IFNA 3RBZA 1URQB 3RL0g 3V2QA 1LTJA 3Q1MA 3VOPA 3GMAA 2IBZD 3W67A 5C39A 2Y1NA 1GD2E 2Y9ZA 2ZT9D 2IFMA 4IOIH 3L4FA 3LIEA 4NGTA 2CPBA 4BPXB 5DJTB 2L5GB 1Q82Q 3Q3DA 1HWTC 1LTSC 3TNUA 2WSCH 3F89A 1AQTA 4H13D 4YXWH 4JQ0D 3PTZA 3H32A 3A3YB 3HE4A 1YBKA 2YNYA 1SQQK 3VP9A 1FZGA 3AE8C 3HE5B 1Y9BA 1JTHB 3FGAD 4P4DA 3S9MA 3HMJG 1YJWP 1X9VA 4BPUB 5AVYB 4UB8H 2JBKA 4W7YA 2IBZG 1BCCG 3OA7A 2FYNC 3RBXA 3CI9A 3F5HA 3BUOB 2YKQA 1OVVA 3VTPC 1PP9J 1S5LE 4UB6E 1SQBJ 1K8AQ 2QJPC 1JY2O 2ZYDA 2FXPA 2WSCJ 1JY3O 2WITA 4WY4B 2JJLA 1H0TB 1FBMA 4OC3A 3ABVC 1KC8Q 4MN4C 3CCQP 2KOGA 3KXDA 1QLED 4AQRD 4B86A 1DH3A 3SWKA 2Q6QA 3HUSC 1KB9D 3LW5J 5CCGA 2LKMA 3SFEC 1KN7A 1JEKA 1VL2A 1SFCC 3TNUB 2KZJA 1EO0A 1L0NK 1SS1A 1SQVE 2OQQA 3TGUE 2Q9IA 1URQA 1FZFA 3B5NC 2KXPB 4HKZH 4EDFA 2N3AB 1RF1A 2N1TB 4DOJA 5APWA 1NTKJ 3Q5PA 3CCVP 3B4SA 3CCEP 5KKZC 5AVRB 2FYNB 4JZ0A 5E79E 2RMZA 1HUCA 1SQPG 1VF5B 2K3RA 4OGQC 3H1HD 1RE4C 3CC2P 2OYHA 3WUTA 4NGNA 1PL5A 1WMKA 3MUDA 3FXDA 3BUNB 1IO4A 3RL0C 4GOFA 2P7JA 1FJPA 4H13C 2R5BA 1USDA 2Y0CA 2Q7CA 4H0LD 2N9BA 3LW5H 3JC22 3M9QA 3A0BE
chains in the Genus database with same CATH topology
2HYNA 2OYIC 1FZCB 3P7KA 1LTAC 1RF0C 3RK3C 2XZRA 1NKNA 1NH4A 4C7NB 1LTBC 4GIFA 2KSJA 2FFDB 1X8YA 1J2JB 1JCDA 1SQBK 3NTNA 1YTZT 1PFIA 1ZLLA 1N86A 1KILD 2IX7C 5CJ4A 1NWQA 3M06A 2BASA 3BATA 4IFFA 2FFDC 1T2KC 5APSA 1ZN5A 5KTBA 4LGDE 3CLQA 2N1TA 2VRSA 1RF1C 3L37A 5AW0B 2PP6A 1CI6A 3G3ZA 3II6A 1JO5A 3UIAA 2HODA 2CPSA 1GW3A 5APYA 3RK2C 4XE5B 5KJ7A 1VPCA 4AUWA 2P2UA 4JYCA 2OYIB 2XNXA 5AW1B 1CW5A 2PAJA 1N7SD 2QM7A 2P67A 3KYQA 4GT1A 3OJAB 3O8ZA 2A45G 1NOHA 2W6AA 2Z5HA 2WSEH 5AW5B 2W6BA 1YTZI 3H6PA 3SWYA 3MIWA 1WRGA 4AYCA 1T3UA 1HGVA 3L35A 4N6JA 1MZ9A 4GKGA 4IFDK 1N73C 1RF1B 2C9NY 3HPHE 1GL2D 5AVZB 2W27A 1JY2N 1A02F 3RL0D 3EQ2A 1GL2B 3GHGC 2A45I 1JY3N 3MTUE 1MUUA 3HTKA 3B8EB 1Z9EA 2M3BA 1RY3A 2XPOA 3P8CD 1LT9C 1T3JA 4ZKPA 3U1CA 1GL2A 3M0DA 2H43A 3B5NB 3HD7A 5APQA 2HPCA 3M9BA 1CI6B 2XU6A 3N4XA 1IFIA 1FZCC 2NPSB 3V4QA 4Y99B 1OWAA 1H89A 3NXSA 3MD0A 1LWUC 1N7SA 1GW4A 5AW9B 3HE4B 1IJDB 2H7HA 1JOCA 2I1KA 3HUSB 4W7ZA 1KQLA 5APTA 1LTJB 4I1LA 5AW2B 2IFNA 1MFZA 2IPPA 2O01H 2R5DA 4I2LC 4RESB 1GDTA 1LTGC 1GU5A 1GL2C 2XKMA 3GHGB 2A45H 2GUSA 3HUSA 1H88A 1G2CA 3CL3D 1SQXK 2Z5IA 3SWFA 3V2RA 4M3LA 1N7SB 4C46A 2NPSC 3BRTB 3WMM0 3TK1A 1JCCA 1NAFA 3H32B 1JMMA 2C0WA 4KHXA 1FJKA 4W80A 3KPEA 1GK4A 2FYUK 2YO2A 3HD7C 3VN0A 1JNMA 3KDPB 2N1TC 3PP5A 1NU1K 1SVFA 1GZLA 3EFGA 1NTZK 2MJZA 2WPSA 1AFOA 1LT9A 3C9IA 1G1JA 5BU8B 1J1DC 3VMXA 2XPLA 3HE5A 5BVZA 3KQGA 4Y99C 2FXMA 1LTJC 3A2AA 2FKWB 5AW6B 1J1EB 4OH8B 1JUNA 1KZUB 2WZ7A 1LGHB 3P32A 2P1JA 1ZR2A 2I1JA 5APXA 3RK2D 1JY3P 2H8PD 2B4JC 1SLQA 1G1IA 1M1JB 2JEEA 3BASA 1M7LA 5KJ7C 2KP8A 2R32A 3F9KC 2KLVA 2ZFCA 2KB7P 3NMDA 3V2PA 1H8AA 5CHXA 1FZBA 2O1KA 1J1EC 1NHLA 5AVTB 5BU5A 1WT6A 1LWUA 3M91A 5AW8B 4EIJA 1FZEA 1CSBA 3OAKA 1DX7A 4N78D 1S9KD 3N7NA 2POHA 2WSFH 3U1AA 1J1DB 1X79B 2KYVA 3LIDA 1N7LA 3VYIA 1M1JA 3IR9A 5CCGC 1IC2A 5APUA 3GHGA 1NKZB 3V5BA 5AVQB 1VDFA 1LT9B 1IFNA 1SQPK 2FYZA 2NPSD 1FU1A 1QL2A 1URQB 2XV5A 3V2QA 3RK2B 1LTJA 1FZAA 3U59A 1XTGB 2YKOA 1HGZA 3VOPA 1FZCA 2WPQA 1GU4A 1L4AC 3E1IA 1L4AB 1GD2E 2Z4EA 1LWUB 2R3CA 2NPSA 3P8CE 2IFMA 3P8MC 1L0LK 2E42A 1KFNA 2HLOA 3L4FA 3LIEA 2CPBA 1SFCB 3HD7B 3HPGG 3IFMA 2L5GB 2OARA 3L36A 1HWTC 1Z56A 1LTSC 3M0AA 1DEBA 3TNUA 3VP8A 3TYYA 1GK6A 2WSCH 1AQ5A 4EOTA 4WY4A 5CCHC 1EQ7A 4JF7A 3H32A 3A3YB 3RK3B 3HE4A 4O9BA 5AVWB 2YNYA 4IFMA 2XDJA 1SQQK 1URQD 3MGNA 3VP9A 3A7OA 1FZGA 2WWWA 5CCHD 3HE5B 3RK3D 1JTHB 1HTLC 3R2PA 1N2DC 3V2NA 4N78E 1X9VA 5AVYB 1SQVK 3B5NA 1NTKK 2XPPA 2WPRA 1XTCC 3TSIA 3HRNA 2WTYA 2OYIA 1T8ZA 2J58A 1FDMA 5CCHA 1KILA 4W7YA 5AVXB 2HFED 1NO4A 3OA7A 3B5ND 3NFQA 1IFDA 3CI9A 2M8RA 2YKQA 5AVSB 3VMYA 4I6MC 2WT7A 4LC1A 3VTPC 2HPCB 1WJTA 3M0DC 4WY4D 2C0XA 1KILB 3V4WA 1JY2O 1ZV8A 4XA4A 1G2CB 1FOSE 3HTKB 1JY3O 2WITA 2GUVA 4WY4C 4WY4B 1IFMA 1S9KE 1T2KD 2JJLA 1QL1A 1FBMA 4HH2A 1N7SC 4C7NA 1HJBA 1RE3C 2KOGA 1GTWA 3BRVB 3BVHA 2HG5D 1SP4A 4AQRD 4B86A 3HD7D 1DH3A 5AVVB 1LTIC 2ZXEB 4C7RA 2XPNA 4LLHA 4WB4A 2WT7B 3HUSC 5CCGA 1IFJA 2YKPA 2LKMA 5AVUB 3M9HA 1SFCC 1L4AA 5AW7B 3U88C 3TNUB 1EO0A 5KJ7D 3I5CA 1L0NK 3VMZA 1N73A 5CCGD 2Q9IA 2OYHB 1URQA 2Q5UA 2OYHC 1ZR4A 2HODB 4N3YB 1SFCA 2FFDA 1IK9A 3B5NC 1FZFA 4DZOA 1HBWA 1YYCA 1FOSF 2N3AB 1JTHA 2E43A 1RF1A 2N1TB 1FAVA 4DOJA 1CZQA 5APWA 2GM4A 5KLVK 1HVVA 5AW4B 5CJ0A 5AVRB 1E5WA 2O1JA 1KFMA 1HH0A 3T97A 1W2EA 1HUCA 2C9LY 2J59M 1LTTC 1MV8A 1RE3A 1RE4C 4WBAA 1RF0A 1URQC 2OYHA 4HYTB 1KILC 1N73B 2Q3IA 1OXZA 4JYBA 2N1TD 3MUDA 5CMZA 2QM8A 1L4AD 2YO3A 5AW3B 1IO4A 3RL0B 3RL0C 5APVA 2P7JA 1FJPA 1A02J 1M1JC 2R5BA 2YMYA 4ZKUA 2Q7CA 1NTMK 2N9BA 3LW5H 3A5TA 3M9QA 1JY2P 1SFCD 1RE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYI A;  2H7H A;  3IR9 A;  3P7K A;  1G2C B;  1FOS E;  5APU A;  1KQL A;  5APT A;  3V5B A;  5AVQ B;  5AW2 B;  2XZR A;  4C7N B;  1S9K E;  1T2K D;  2JJL A;  1MFZ A;  2IPP A;  1X8Y A;  2R5D A;  4I2L C;  4RES B;  1J2J B;  4C7N A;  1GU5 A;  1HJB A;  2XV5 A;  1GTW A;  3NTN A;  1H88 A;  1SP4 A;  2Z5I A;  3SWF A;  2WPQ A;  4M3L A;  1NWQ A;  4AQR D;  4B86 A;  3M06 A;  1DH3 A;  5AVV B;  2BAS A;  2ZXE B;  4C46 A;  1GU4 A;  2XPN A;  3TK1 A;  1T2K C;  5APS A;  1GD2 E;  1NAF A;  2WT7 B;  2R3C A;  2VRS A;  4KHX A;  3P8M C;  3L37 A;  5AVU B;  5AW0 B;  3M9H A;  2E42 A;  1CI6 A;  1GK4 A;  3LIE A;  3HPG G;  2YO2 A;  3UIA A;  3VN0 A;  5APY A;  1JNM A;  5AW7 B;  3U88 C;  4XE5 B;  3TNU B;  4AUW A;  1EO0 A;  3KDP B;  2P2U A;  3I5C A;  3L36 A;  3VMZ A;  1HWT C;  4JYC A;  3M0A A;  5AW1 B;  3TNU A;  2Q5U A;  3TYY A;  2QM7 A;  1GK6 A;  1GZL A;  2P67 A;  2WPS A;  4GT1 A;  4DZO A;  4EOT A;  3O8Z A;  1HBW A;  1YYC A;  3VMX A;  1FOS F;  2W6A A;  2Z5H A;  2N3A B;  2E43 A;  2XPL A;  3HE5 A;  5AW5 B;  3KQG A;  1FAV A;  1CZQ A;  3A3Y B;  5APW A;  3HE4 A;  5AVW B;  4AYC A;  3A2A A;  2YNY A;  5AW4 B;  5AVR B;  3MGN A;  5AW6 B;  3L35 A;  1JUN A;  3A7O A;  4GKG A;  3T97 A;  2WWW A;  3P32 A;  3HE5 B;  2C9N Y;  1HUC A;  2C9L Y;  3HPH E;  5AVZ B;  2W27 A;  1MV8 A;  1A02 F;  5APX A;  5AVY B;  2XPP A;  2WPR A;  2B4J C;  2WTY A;  1MUU A;  4HYT B;  3HTK A;  3B8E B;  1SLQ A;  1Z9E A;  2Q3I A;  1OXZ A;  2XPO A;  4JYB A;  2KP8 A;  5AW3 B;  5CMZ A;  2QM8 A;  2R32 A;  2YO3 A;  3F9K C;  3M0D A;  1IO4 A;  5AVX B;  5APV A;  2ZFC A;  5APQ A;  3NMD A;  2P7J A;  1H8A A;  1A02 J;  1CI6 B;  3M9B A;  3NFQ A;  5AVT B;  2R5B A;  2XU6 A;  5AVS B;  3VMY A;  3M91 A;  4I6M C;  5AW8 B;  2WT7 A;  4LC1 A;  2Q7C A;  3VTP C;  3V4Q A;  1CSB A;  1OWA A;  1WJT A;  1H89 A;  2N9B A;  3OAK A;  3NXS A;  3A5T A;  3MD0 A;  1S9K D;  5AW9 B;  3V4W A;  3LID A;  3HE4 B; 
#chains in the Genus database with same CATH topology
 2HYN A;  2OYI C;  1FZC B;  1RF0 C;  3RK3 C;  4C7N B;  1X8Y A;  1KQF B;  3PH0 A;  1ZLL A;  2IX7 C;  2PGD A;  2XND H;  2W6J H;  2FFD C;  3L75 E;  4LGD E;  2N1T A;  2VRS A;  2XEF A;  5AW0 B;  4XFJ A;  3L72 J;  3UIA A;  2ZJS E;  2HOD A;  1TU3 F;  4XE5 B;  4AUW A;  2P2U A;  3AE2 C;  1NTZ J;  5AW1 B;  1KV4 A;  5BY0 A;  2P67 A;  1PGQ A;  3OJA B;  2CBL A;  5HKW A;  1SQV D;  2Z5H A;  5AW5 B;  1YTZ I;  4NGR A;  1KQS O;  1BCC E;  3VRN A;  1MZ9 A;  1NTZ E;  1X22 A;  5AVZ B;  4RKU J;  4DCK A;  3H1K J;  1VQ9 P;  2A45 I;  2QVA A;  1R8E A;  3QWO C;  2K9Y A;  1BDD A;  2FXO A;  1LT9 C;  4ZKP A;  1GL2 A;  2H43 A;  3S9O A;  2BCC G;  1Q86 Q;  4U7J A;  1PP9 E;  3N4X A;  3V6I A;  1FZC C;  2NPS B;  1VQM P;  5EFW B;  2YMK A;  4EYY Q;  1JOC A;  3A0B H;  2I1K A;  3HUS B;  4I1L A;  4RO0 A;  1MFZ A;  2IPP A;  4RES B;  4I2L C;  5GTI H;  2XKM A;  3HUS A;  1SQV G;  3AEC C;  4M3L A;  1EXJ A;  3L73 G;  1PV3 A;  3R4Y A;  5KLV J;  3BCC G;  1NAF A;  1OW7 A;  3H32 B;  1RQV A;  3VRQ A;  3CCM P;  2C0W A;  5CBN A;  4JPZ B;  1BGY D;  1BCC D;  1ZP0 C;  2FYU K;  3S9L A;  2E76 B;  5KLV E;  1DE4 C;  1BDC A;  2MJZ A;  1LT9 A;  3L71 E;  5BU8 B;  3VMX A;  3KQG A;  2KUB A;  3O6Q B;  1J1E B;  1KZU B;  2KLU A;  4NGP A;  1LGH B;  3L71 J;  2JBJ A;  2I1J A;  4YPC A;  2W83 C;  2G8Y A;  1AVY A;  1ZRT D;  1YIT P;  1M7L A;  2R32 A;  3K5B A;  3V2P A;  3SJE A;  1J1E C;  1PGP A;  3A0H H;  3B71 A;  5KAF H;  1LWU A;  5GTH H;  4A4B A;  1FZE A;  1P84 D;  3CWB G;  1AVO A;  1DX7 A;  4N78 D;  1D7M A;  3VYI A;  4OC0 A;  2RH0 A;  3QH9 A;  1BE3 D;  3CCS P;  5APU A;  3AEG C;  5AVQ B;  2L91 A;  2FYZ A;  2KNC A;  3RK2 B;  3SFD C;  1FZA A;  1K05 A;  1HGZ A;  2E75 C;  4MCQ A;  3CCL P;  1GU4 A;  1L4A C;  2D2C D;  3PRJ A;  3SJX A;  2ZYA A;  3CC4 P;  3GG2 A;  1LWU B;  4CPG A;  3P8C E;  3E7K A;  3P8M C;  3FED A;  1NAY A;  4UB8 E;  2KSE A;  3IFM A;  4I7Z B;  2HR3 A;  4RR2 B;  5J3X A;  3VP8 A;  1GK6 A;  3FWN A;  1S72 P;  1AQ5 A;  4EOT A;  1NTM J;  2D2C B;  2R3S A;  5CCH C;  1EQ7 A;  1Q90 D;  4JF7 A;  4IFM A;  3GLM A;  2XDJ A;  2A06 E;  3VRO A;  3D6Z A;  5CCH D;  3RK3 D;  3MZW B;  1W5C E;  2QJP B;  1LP1 A;  1NTK K;  3B5N A;  1XTC C;  2WTY A;  1BGY J;  4HJG H;  4D6T D;  2OR4 A;  1PIX A;  3AEF C;  2HFE D;  3NFQ A;  3EWK A;  1SQQ E;  4Y28 J;  3CCU P;  4I6M C;  4LC1 A;  1K9M Q;  3L73 J;  2A06 D;  3M0D C;  3IN6 A;  4WY4 D;  1KIL B;  1FE6 A;  1ZV8 A;  1FOS E;  2E5T A;  2CIJ A;  2GUV A;  2H89 C;  1IFM A;  1QL1 A;  1N7S C;  4C7N A;  1HJB A;  3VGO A;  4OC5 A;  1U7J A;  3BRV B;  1VQ4 P;  3FX0 A;  3Q2Y A;  3L74 D;  4C7R A;  2ZXE B;  4JYW A;  3JSV C;  1SQX E;  3AED C;  1KQG B;  2YKP A;  2QEX P;  3Q5R A;  1UIX A;  3H1H E;  3U88 C;  3H1L J;  2Y1M A;  1L0L E;  3AEE C;  5CCG D;  2OYH B;  5D29 A;  2VKZ G;  1SFC A;  2I8D A;  2FFD A;  1IK9 A;  3L75 J;  4GOD A;  1FOS F;  2E43 A;  1FAV A;  3D7F A;  2GM4 A;  5KLV K;  1HVV A;  4GDO A;  2M5A B;  2AXC A;  2DW3 A;  3AE3 C;  1EDI A;  2C9L Y;  1LTT C;  4IL6 H;  1URQ C;  3L72 D;  3I56 P;  1OXZ A;  2N1T D;  2YO3 A;  1EZV G;  2NRG A;  2YMY A;  3SJF A;  2V4H A;  1NGM B;  1OVR A;  3A5T A;  1BSN A;  1SFC D;  1L2P A;  1RE4 A;  5KAI H;  1CX8 A;  4DT0 A;  2IZ0 A;  3IF4 A;  3WU2 E;  1NKN A;  1NH4 A;  2FFD B;  4YTP C;  2QG4 A;  1JCD A;  2K9J A;  1PFI A;  5B66 H;  4H44 D;  1AA0 A;  3FF3 A;  2BAS A;  4IFF A;  4IL6 E;  1T2K C;  1LNQ A;  1NVO A;  3VMA A;  2LXB A;  1NU1 J;  1JB0 J;  2PP6 A;  1KYO D;  3G3Z A;  1JO5 A;  1PGO A;  3RK2 C;  1GW3 A;  2YIU B;  4R4L A;  4JYC A;  3L72 G;  2PAJ A;  1N7S D;  2QM7 A;  1YHQ P;  3AEB C;  2P58 A;  1L0N E;  1EZV D;  4I7Z C;  1VQP P;  2E74 D;  2W6A A;  2WSE H;  2WSS H;  3SWY A;  3AE7 C;  1YQ3 C;  4AYC A;  1HGV A;  4DJG A;  3L35 A;  4GKG A;  4IFD K;  1N73 C;  1RF1 B;  1KYO E;  5KLV D;  2C9N Y;  5B5E E;  1JY2 N;  3S4R A;  3E1R A;  2XEG A;  1JM0 A;  2OTK E;  2IBZ E;  2SPZ A;  3GHG C;  1JY3 N;  1BCC J;  2M3B A;  1PPJ E;  3P8C D;  1FC2 C;  1T3J A;  1L0L J;  3M0D A;  1LP1 B;  3B5N B;  2LR2 A;  2QJK C;  2HPC A;  1NTK D;  1CI6 B;  4HB1 A;  4D6T G;  1OWA A;  2NZ2 A;  3L75 D;  2KIK A;  1H89 A;  2JO1 A;  3NXS A;  1LWU C;  1N7S A;  5AW9 B;  3H1H J;  4U3F G;  2PRR A;  1LTJ B;  4L75 A;  3D7D A;  5AW2 B;  4P4I A;  2IFN A;  1GDT A;  2OOT A;  1LTG C;  1GU5 A;  1GL2 C;  2A45 H;  3CL3 D;  5H2F E;  1N7S B;  3CWB E;  1N8R Q;  3TK1 A;  4BXL A;  3H1H G;  5B5E H;  4MCP A;  2IYP A;  2E76 D;  1FJK A;  4W80 A;  3CC7 P;  1R5S A;  1SQB E;  1KTM A;  2BEZ F;  2YO2 A;  1S2E A;  1M56 D;  5KLI C;  4U3F E;  2Y9Y A;  3PP5 A;  1SVF A;  1AJY A;  2MKV A;  1GZL A;  3EFG A;  1AFO A;  1G1J A;  3BHX A;  1M90 Q;  5GTH E;  4EI2 A;  2PFX A;  1PPJ G;  3T97 B;  3A2A A;  4U3F J;  2E74 C;  1M1K Q;  1VQ6 P;  2P1J A;  3CX5 E;  3CXH H;  1ZR2 A;  5ELY A;  3RK2 D;  1JY3 P;  2BCC J;  5H2F H;  2H8P D;  1NTZ D;  3ITK A;  1SLQ A;  1G1I A;  3FEC A;  1M1J B;  2FY8 A;  5KJ7 C;  3CCR P;  4GPL B;  2RN0 A;  5E79 H;  2ZFC A;  2KB7 P;  3AE4 C;  3NMD A;  2UV8 G;  1H8A A;  2O1K A;  1NHL A;  3PT1 A;  4EIJ A;  1S3J A;  1CSB A;  1VQ7 P;  4ASV A;  1S9K D;  3KZI H;  2POH A;  2WSF H;  1B47 A;  3LID A;  1N7L A;  3AE5 C;  2ZVO B;  3H1J G;  5CCG C;  2WMM A;  1NKZ B;  1SQP K;  2NPS D;  1FU1 A;  1QL2 A;  2XV5 A;  3U59 A;  1SQQ G;  3H1I J;  3E1I A;  4D6T J;  3O6Q A;  2Z4E A;  4KT0 J;  5HKZ A;  1NTM E;  2JDI H;  1L0L K;  1L0L D;  2HLO A;  3HD7 B;  3CCJ P;  1KB9 H;  2ITA A;  2OAR A;  1Z56 A;  1PGJ A;  3TDK A;  3VRR A;  4W9Y A;  4WY4 A;  4MCR A;  3KZI E;  3GF7 A;  3CXH D;  1W2B O;  5AVW B;  2PVW A;  1Y47 A;  1URQ D;  2O3J A;  2QJK B;  2WWW A;  5TJH A;  1HTL C;  3R2P A;  3L72 E;  1EZV I;  1KIL E;  4N78 E;  4NGQ A;  2XPP A;  1KMI Z;  2WPR A;  3TSI A;  5GTI E;  3CX5 D;  4TT3 H;  1ZXG A;  4H44 C;  2OYI A;  2J58 A;  1FDM A;  5CCH A;  3H1L D;  1NO4 A;  1VF5 D;  3B5N D;  3H1K G;  2M0B A;  2M8R A;  5AVS B;  3ZDM A;  3L70 D;  2E5Y A;  1WJT A;  3L71 D;  3MHV A;  4PD4 H;  2C0X A;  3V4W A;  3WUV A;  4H13 B;  1EDL A;  4XA4 A;  1G2C B;  1NTK G;  2QRX A;  3HTK B;  4WY4 C;  1S9K E;  1T2K D;  1YIJ P;  4HH2 A;  3L75 G;  1RE3 C;  4BTF A;  3BVH A;  4A4C A;  1SP4 A;  2AEF A;  3HD7 D;  5AVV B;  4LLH A;  4WB4 A;  2WT7 B;  3H1K E;  1IFJ A;  3CXH E;  1OZH A;  5AVU B;  2JP3 A;  1NYH A;  1VQK P;  2FYU E;  5AW7 B;  4H44 B;  4L76 A;  4RJT A;  2DLA A;  2ZAE B;  3I5C A;  3MP7 B;  3H1I G;  2Q5U A;  1ZR4 A;  3JCU E;  2HOD B;  1BE3 E;  1HBW A;  1YYC A;  4PD4 E;  1CZQ A;  2OGU A;  5KAF E;  4OC4 A;  3D70 A;  5AW4 B;  3TGU J;  5CJ0 A;  2V7Q H;  1E5W A;  2O1J A;  3CMA P;  1KFM A;  1SQX G;  1U7M A;  1NTM G;  2J59 M;  5TIS H;  1YVH A;  1RE3 A;  5HKY A;  4WBA A;  1NU1 D;  5B66 E;  4K3A A;  1IZN B;  1KIL C;  5F13 A;  1N73 B;  4OME A;  3PHL A;  5AW3 B;  2B89 A;  1PZQ A;  1L4A D;  4NPE A;  5CMZ A;  5APV A;  1A02 J;  3G6E P;  3H1J E;  1HJ0 A;  4P44 A;  1NTM K;  2C6G A;  1KB9 E;  1GL2 D;  1JY2 P;  1LTA C;  1ZOY C;  1RQU A;  3RBU A;  3C1L A;  2IYO A;  1LTB C;  4GIF A;  2KSJ A;  3AEA C;  3H1J J;  3A0H E;  2D2C C;  4ZMD A;  1OFC X;  1N86 A;  1KIL D;  2ZVN B;  4PJ0 H;  1NWQ A;  3M06 A;  1BGY E;  3BAT A;  5TIS E;  4PD4 D;  2KK7 A;  1LJ2 A;  1QVF O;  1S5L X;  4H0L C;  3IWW A;  1VPC A;  2OTJ P;  4NGS A;  1CW5 A;  2W90 A;  3KYQ A;  4GT1 A;  2A45 G;  1NOH A;  1VQ8 P;  4BWN A;  2V7Q J;  3MIW A;  1WRG A;  1MKM A;  3USS A;  4N6J A;  2GA1 A;  1VQO P;  1OX3 A;  3BUW B;  3HPH E;  2ZT9 C;  2W27 A;  1ZRT E;  1P84 H;  3EQ2 A;  3PLN A;  4PJ0 E;  2QIW A;  4L74 A;  3MTU E;  3HTK A;  3CXH I;  1L0L G;  2H88 C;  2ZXX A;  1RY3 A;  2XPO A;  1L0N D;  2FYU D;  3U1C A;  2JWD A;  3OP0 A;  5APQ A;  1U57 A;  1VQL P;  1QX8 A;  3OB2 B;  2O01 J;  1VQ5 P;  1IFI A;  4Y99 B;  3SSU A;  3HE4 B;  1IJD B;  4U3F D;  1KQL A;  5APT A;  2YXR B;  2R5D A;  5KLI B;  1UII A;  1KD1 Q;  2GUS A;  2K88 A;  5M1B A;  2Z5I A;  4LQG A;  3WMM 0;  2CK3 H;  1YJN P;  2KS1 B;  1JCC A;  1P84 E;  3CX5 H;  1IFP A;  1P84 I;  4ASW A;  2O01 N;  1GK4 A;  4PV1 B;  5AXI A;  3VN0 A;  1JNM A;  2E76 C;  2N1T C;  2R44 A;  1Q2N A;  3CX5 I;  1VQN P;  3D7H A;  2B87 A;  2WPS A;  3C9I A;  1PPJ D;  2XPL A;  5BVZ A;  2UWJ E;  3BXM A;  3H1I D;  2FKW B;  1KYO I;  5AW6 B;  4OH8 B;  2WPV B;  2WZ7 A;  1PP9 D;  3P32 A;  1SQB D;  3KHU A;  2AEJ A;  4OWF A;  1JMB A;  1NTZ G;  1QVG O;  2JEE A;  2KP8 A;  1KYO H;  3S9N A;  3F9K C;  2KLV A;  1NU1 G;  5CHX A;  1FZB A;  2WQY C;  3BCC D;  1WT6 A;  5AW8 B;  2QJY C;  1M8O B;  3OAK A;  2AXT E;  3N7N A;  3U1A A;  1X79 B;  1M1J A;  1IC2 A;  2B9B A;  1KOR A;  4L73 A;  1VDF A;  2J5U A;  4NPF X;  3L74 E;  1SQP D;  3CD6 P;  1OW8 A;  1SQX J;  1XTG B;  2YKO A;  2P10 A;  2E75 B;  1FZC A;  1SQQ D;  2WPQ A;  1S1C X;  4OGQ B;  2WSF J;  1QGK B;  4OVN F;  1L4A B;  3BCC E;  4Z1M H;  1NU1 E;  3D6Y A;  2K1A A;  2R3C A;  2NPS A;  4OC1 A;  2FYU J;  2E42 A;  1KFN A;  3OB1 B;  3HPG G;  1SFC B;  2N9Y B;  4NGM A;  3FXE A;  3L36 A;  3M0A A;  1DEB A;  3TYY A;  4YXD C;  3GW6 A;  3RK3 B;  4O9B A;  4OC2 A;  1FS0 E;  3MGN A;  3WUU A;  3A7O A;  4JBZ A;  3CWB J;  2KZI A;  1N2D C;  3V2N A;  3BI0 A;  3BUM B;  2B87 B;  1SQV K;  1Y8A A;  3HRN A;  2QSI A;  1FDO A;  1K73 Q;  1T8Z A;  1KIL A;  5AVX B;  3H1L G;  1NJI Q;  3I55 P;  1IFD A;  3L70 G;  1LT1 A;  3VMY A;  2WT7 A;  3H1K D;  2HPC B;  2KS1 A;  1L0N G;  2LXC B;  2AXT H;  3Q5S A;  2BCC D;  4OGQ D;  3G4S P;  1H0T A;  1Q7Y Q;  1GTW A;  4R4M A;  3D71 A;  2QJY B;  2HG5 D;  4H0L B;  1LTI C;  2XPN A;  5F09 A;  2JKV A;  5K5G B;  1DD3 A;  4BPW B;  3L70 E;  1FBV A;  2M3E A;  4IL6 X;  3M9H A;  2YXQ B;  2E74 B;  1L4A A;  3OW2 O;  2C6C A;  3BCC J;  1S5L H;  2BCC E;  2RKL A;  5L8R J;  5KJ7 D;  3VMZ A;  1N73 A;  1NTK E;  4QMA A;  2OYH C;  4K35 A;  2Q1K A;  1BGY G;  4N3Y B;  1YI2 P;  2Y0E A;  4DZO A;  1JTH A;  1AV1 A;  3ZNI A;  3PFV A;  3FWL A;  3H1J D;  2QA4 P;  1EDK A;  1SQX D;  2A06 G;  3S1K A;  1HH0 A;  1SQQ J;  3T97 A;  3G9R A;  1W2E A;  4BRY B;  1MV8 A;  4P4J A;  3SJG A;  3L73 E;  2FBW C;  2PVV A;  4PV1 C;  1RF0 A;  4HYT B;  3RK3 E;  2ZT9 B;  4WVZ A;  2Q3I A;  4WWI A;  4JYB A;  1SQB G;  1Z8L A;  2QM8 A;  1OW6 A;  2XEI A;  3PLF B;  3RL0 B;  3WU2 H;  1M1J C;  4BRY A;  4ZKU A;  2XEJ A;  1HF9 A;  2IBZ I;  5KLV G;  3P7K A;  2G3A A;  2XZR A;  3VRP A;  2C6P A;  3CWB D;  1J2J B;  1SQB K;  3D7G A;  2WVR A;  3NTN A;  1YTZ T;  4P4F A;  2KI7 B;  5CJ4 A;  3H25 A;  2BEQ D;  5APS A;  1ZN5 A;  1BE3 J;  2K37 A;  3RGU A;  1L0N J;  5KTB A;  4MCS A;  1R5L A;  3CLQ A;  1IK7 A;  1Q81 Q;  1RF1 C;  3L37 A;  1CI6 A;  3II6 A;  2CPS A;  5APY A;  1DEE G;  5KJ7 A;  2OTL P;  2OYI B;  2XNX A;  1EXI A;  3L71 G;  3O8Z A;  1RH5 B;  3C8V A;  1E79 H;  2W6B A;  1DIP A;  3H6P A;  2IDB A;  2E75 D;  2YIU C;  1T3U A;  3JCU H;  1S4X A;  1A02 F;  3RL0 D;  3CPW O;  3L70 J;  4P45 A;  2B88 A;  3W68 A;  5KKZ B;  1GL2 B;  1MUU A;  3B8E B;  1VF5 C;  1Z9E A;  1OMI A;  3HD7 A;  2FYU G;  3MUD C;  3M9B A;  1ZW0 A;  3TGU D;  2XU6 A;  3CME P;  5CBO A;  3TF5 A;  2WSE J;  3V4Q A;  1BSH A;  3IAO A;  4P4E A;  3MD0 A;  1GW4 A;  2H7H A;  3BI1 A;  4W7Z A;  2K9J B;  1OVU A;  4TLF A;  1KB9 I;  2W8Z A;  1SQV J;  1YJ9 P;  1YQ4 C;  1K04 A;  2O01 H;  3AE6 C;  2JWA A;  3GHG B;  4X3R A;  1H88 A;  1G2C A;  3L73 D;  1SQX K;  3SWF A;  3V2R A;  1NTM D;  4C46 A;  2NPS C;  3BUX B;  3BRT B;  2AEM A;  1EC5 A;  3AE9 C;  2Q3E A;  1OIP A;  3KAS A;  1JMM A;  2QE7 H;  4KHX A;  3KPE A;  1T6A A;  1QEX A;  3PJS K;  2Y0D A;  3L74 G;  3HD7 C;  5DJU B;  1X0T A;  4PV1 D;  3KDP B;  1GMJ A;  4GOE A;  1NU1 K;  3G71 P;  2KNC B;  1NTZ K;  4ZNC A;  1J1D C;  4A7P A;  3HE5 A;  4PD4 I;  4Y99 C;  3TGU G;  1EDJ A;  2FXM A;  1LTJ C;  1SQP J;  1FDI A;  4P4B A;  4KJM A;  2OYO A;  1JUN A;  2M5A A;  1DD4 A;  2JR8 A;  1RHZ B;  1PP9 G;  4NPD A;  5APX A;  2IZ1 A;  3H1L E;  2B4J C;  1M57 D;  2ZYG A;  3AE1 C;  1SQP E;  5KAI E;  3BAS A;  3FEE A;  1ZME C;  3GF3 A;  3L74 J;  5AVT B;  1USE A;  5BU5 A;  3M91 A;  4UB6 H;  3H1I E;  1EZV E;  1BE3 G;  1J1D B;  2KYV A;  3IR9 A;  3EFF K;  1MFT A;  3GHG A;  3V5B A;  4D6T E;  1LT9 B;  1IFN A;  3RBZ A;  1URQ B;  3RL0 g;  3V2Q A;  1LTJ A;  3Q1M A;  3VOP A;  3GMA A;  2IBZ D;  3W67 A;  5C39 A;  2Y1N A;  1GD2 E;  2Y9Z A;  2ZT9 D;  2IFM A;  4IOI H;  3L4F A;  3LIE A;  4NGT A;  2CPB A;  4BPX B;  5DJT B;  2L5G B;  1Q82 Q;  3Q3D A;  1HWT C;  1LTS C;  3TNU A;  2WSC H;  3F89 A;  1AQT A;  4H13 D;  4YXW H;  4JQ0 D;  3PTZ A;  3H32 A;  3A3Y B;  3HE4 A;  1YBK A;  2YNY A;  1SQQ K;  3VP9 A;  1FZG A;  3AE8 C;  3HE5 B;  1Y9B A;  1JTH B;  3FGA D;  4P4D A;  3S9M A;  3HMJ G;  1YJW P;  1X9V A;  4BPU B;  5AVY B;  4UB8 H;  2JBK A;  4W7Y A;  2IBZ G;  1BCC G;  3OA7 A;  2FYN C;  3RBX A;  3CI9 A;  3F5H A;  3BUO B;  2YKQ A;  1OVV A;  3VTP C;  1PP9 J;  1S5L E;  4UB6 E;  1SQB J;  1K8A Q;  2QJP C;  1JY2 O;  2ZYD A;  2FXP A;  2WSC J;  1JY3 O;  2WIT A;  4WY4 B;  2JJL A;  1H0T B;  1FBM A;  4OC3 A;  3ABV C;  1KC8 Q;  4MN4 C;  3CCQ P;  2KOG A;  3KXD A;  1QLE D;  4AQR D;  4B86 A;  1DH3 A;  3SWK A;  2Q6Q A;  3HUS C;  1KB9 D;  3LW5 J;  5CCG A;  2LKM A;  3SFE C;  1KN7 A;  1JEK A;  1VL2 A;  1SFC C;  3TNU B;  2KZJ A;  1EO0 A;  1L0N K;  1SS1 A;  1SQV E;  2OQQ A;  3TGU E;  2Q9I A;  1URQ A;  1FZF A;  3B5N C;  2KXP B;  4HKZ H;  4EDF A;  2N3A B;  1RF1 A;  2N1T B;  4DOJ A;  5APW A;  1NTK J;  3Q5P A;  3CCV P;  3B4S A;  3CCE P;  5KKZ C;  5AVR B;  2FYN B;  4JZ0 A;  5E79 E;  2RMZ A;  1HUC A;  1SQP G;  1VF5 B;  2K3R A;  4OGQ C;  3H1H D;  1RE4 C;  3CC2 P;  2OYH A;  3WUT A;  4NGN A;  1PL5 A;  1WMK A;  3MUD A;  3FXD A;  3BUN B;  1IO4 A;  3RL0 C;  4GOF A;  2P7J A;  1FJP A;  4H13 C;  2R5B A;  1USD A;  2Y0C A;  2Q7C A;  4H0L D;  2N9B A;  3LW5 H;  3JC2 2;  3M9Q A;  3A0B E; 
#chains in the Genus database with same CATH homology
 2HYN A;  2OYI C;  1FZC B;  3P7K A;  1LTA C;  1RF0 C;  3RK3 C;  2XZR A;  1NKN A;  1NH4 A;  4C7N B;  1LTB C;  4GIF A;  2KSJ A;  2FFD B;  1X8Y A;  1J2J B;  1JCD A;  1SQB K;  3NTN A;  1YTZ T;  1PFI A;  1ZLL A;  1N86 A;  1KIL D;  2IX7 C;  5CJ4 A;  1NWQ A;  3M06 A;  2BAS A;  3BAT A;  4IFF A;  2FFD C;  1T2K C;  5APS A;  1ZN5 A;  5KTB A;  4LGD E;  3CLQ A;  2N1T A;  2VRS A;  1RF1 C;  3L37 A;  5AW0 B;  2PP6 A;  1CI6 A;  3G3Z A;  3II6 A;  1JO5 A;  3UIA A;  2HOD A;  2CPS A;  1GW3 A;  5APY A;  3RK2 C;  4XE5 B;  5KJ7 A;  1VPC A;  4AUW A;  2P2U A;  4JYC A;  2OYI B;  2XNX A;  5AW1 B;  1CW5 A;  2PAJ A;  1N7S D;  2QM7 A;  2P67 A;  3KYQ A;  4GT1 A;  3OJA B;  3O8Z A;  2A45 G;  1NOH A;  2W6A A;  2Z5H A;  2WSE H;  5AW5 B;  2W6B A;  1YTZ I;  3H6P A;  3SWY A;  3MIW A;  1WRG A;  4AYC A;  1T3U A;  1HGV A;  3L35 A;  4N6J A;  1MZ9 A;  4GKG A;  4IFD K;  1N73 C;  1RF1 B;  2C9N Y;  3HPH E;  1GL2 D;  5AVZ B;  2W27 A;  1JY2 N;  1A02 F;  3RL0 D;  3EQ2 A;  1GL2 B;  3GHG C;  2A45 I;  1JY3 N;  3MTU E;  1MUU A;  3HTK A;  3B8E B;  1Z9E A;  2M3B A;  1RY3 A;  2XPO A;  3P8C D;  1LT9 C;  1T3J A;  4ZKP A;  3U1C A;  1GL2 A;  3M0D A;  2H43 A;  3B5N B;  3HD7 A;  5APQ A;  2HPC A;  3M9B A;  1CI6 B;  2XU6 A;  3N4X A;  1IFI A;  1FZC C;  2NPS B;  3V4Q A;  4Y99 B;  1OWA A;  1H89 A;  3NXS A;  3MD0 A;  1LWU C;  1N7S A;  1GW4 A;  5AW9 B;  3HE4 B;  1IJD B;  2H7H A;  1JOC A;  2I1K A;  3HUS B;  4W7Z A;  1KQL A;  5APT A;  1LTJ B;  4I1L A;  5AW2 B;  2IFN A;  1MFZ A;  2IPP A;  2O01 H;  2R5D A;  4I2L C;  4RES B;  1GDT A;  1LTG C;  1GU5 A;  1GL2 C;  2XKM A;  3GHG B;  2A45 H;  2GUS A;  3HUS A;  1H88 A;  1G2C A;  3CL3 D;  1SQX K;  2Z5I A;  3SWF A;  3V2R A;  4M3L A;  1N7S B;  4C46 A;  2NPS C;  3BRT B;  3WMM 0;  3TK1 A;  1JCC A;  1NAF A;  3H32 B;  1JMM A;  2C0W A;  4KHX A;  1FJK A;  4W80 A;  3KPE A;  1GK4 A;  2FYU K;  2YO2 A;  3HD7 C;  3VN0 A;  1JNM A;  3KDP B;  2N1T C;  3PP5 A;  1NU1 K;  1SVF A;  1GZL A;  3EFG A;  1NTZ K;  2MJZ A;  2WPS A;  1AFO A;  1LT9 A;  3C9I A;  1G1J A;  5BU8 B;  1J1D C;  3VMX A;  2XPL A;  3HE5 A;  5BVZ A;  3KQG A;  4Y99 C;  2FXM A;  1LTJ C;  3A2A A;  2FKW B;  5AW6 B;  1J1E B;  4OH8 B;  1JUN A;  1KZU B;  2WZ7 A;  1LGH B;  3P32 A;  2P1J A;  1ZR2 A;  2I1J A;  5APX A;  3RK2 D;  1JY3 P;  2H8P D;  2B4J C;  1SLQ A;  1G1I A;  1M1J B;  2JEE A;  3BAS A;  1M7L A;  5KJ7 C;  2KP8 A;  2R32 A;  3F9K C;  2KLV A;  2ZFC A;  2KB7 P;  3NMD A;  3V2P A;  1H8A A;  5CHX A;  1FZB A;  2O1K A;  1J1E C;  1NHL A;  5AVT B;  5BU5 A;  1WT6 A;  1LWU A;  3M91 A;  5AW8 B;  4EIJ A;  1FZE A;  1CSB A;  3OAK A;  1DX7 A;  4N78 D;  1S9K D;  3N7N A;  2POH A;  2WSF H;  3U1A A;  1J1D B;  1X79 B;  2KYV A;  3LID A;  1N7L A;  3VYI A;  1M1J A;  3IR9 A;  5CCG C;  1IC2 A;  5APU A;  3GHG A;  1NKZ B;  3V5B A;  5AVQ B;  1VDF A;  1LT9 B;  1IFN A;  1SQP K;  2FYZ A;  2NPS D;  1FU1 A;  1QL2 A;  1URQ B;  2XV5 A;  3V2Q A;  3RK2 B;  1LTJ A;  1FZA A;  3U59 A;  1XTG B;  2YKO A;  1HGZ A;  3VOP A;  1FZC A;  2WPQ A;  1GU4 A;  1L4A C;  3E1I A;  1L4A B;  1GD2 E;  2Z4E A;  1LWU B;  2R3C A;  2NPS A;  3P8C E;  2IFM A;  3P8M C;  1L0L K;  2E42 A;  1KFN A;  2HLO A;  3L4F A;  3LIE A;  2CPB A;  1SFC B;  3HD7 B;  3HPG G;  3IFM A;  2L5G B;  2OAR A;  3L36 A;  1HWT C;  1Z56 A;  1LTS C;  3M0A A;  1DEB A;  3TNU A;  3VP8 A;  3TYY A;  1GK6 A;  2WSC H;  1AQ5 A;  4EOT A;  4WY4 A;  5CCH C;  1EQ7 A;  4JF7 A;  3H32 A;  3A3Y B;  3RK3 B;  3HE4 A;  4O9B A;  5AVW B;  2YNY A;  4IFM A;  2XDJ A;  1SQQ K;  1URQ D;  3MGN A;  3VP9 A;  3A7O A;  1FZG A;  2WWW A;  5CCH D;  3HE5 B;  3RK3 D;  1JTH B;  1HTL C;  3R2P A;  1N2D C;  3V2N A;  4N78 E;  1X9V A;  5AVY B;  1SQV K;  3B5N A;  1NTK K;  2XPP A;  2WPR A;  1XTC C;  3TSI A;  3HRN A;  2WTY A;  2OYI A;  1T8Z A;  2J58 A;  1FDM A;  5CCH A;  1KIL A;  4W7Y A;  5AVX B;  2HFE D;  1NO4 A;  3OA7 A;  3B5N D;  3NFQ A;  1IFD A;  3CI9 A;  2M8R A;  2YKQ A;  5AVS B;  3VMY A;  4I6M C;  2WT7 A;  4LC1 A;  3VTP C;  2HPC B;  1WJT A;  3M0D C;  4WY4 D;  2C0X A;  1KIL B;  3V4W A;  1JY2 O;  1ZV8 A;  4XA4 A;  1G2C B;  1FOS E;  3HTK B;  1JY3 O;  2WIT A;  2GUV A;  4WY4 C;  4WY4 B;  1IFM A;  1S9K E;  1T2K D;  2JJL A;  1QL1 A;  1FBM A;  4HH2 A;  1N7S C;  4C7N A;  1HJB A;  1RE3 C;  2KOG A;  1GTW A;  3BRV B;  3BVH A;  2HG5 D;  1SP4 A;  4AQR D;  4B86 A;  3HD7 D;  1DH3 A;  5AVV B;  1LTI C;  2ZXE B;  4C7R A;  2XPN A;  4LLH A;  4WB4 A;  2WT7 B;  3HUS C;  5CCG A;  1IFJ A;  2YKP A;  2LKM A;  5AVU B;  3M9H A;  1SFC C;  1L4A A;  5AW7 B;  3U88 C;  3TNU B;  1EO0 A;  5KJ7 D;  3I5C A;  1L0N K;  3VMZ A;  1N73 A;  5CCG D;  2Q9I A;  2OYH B;  1URQ A;  2Q5U A;  2OYH C;  1ZR4 A;  2HOD B;  4N3Y B;  1SFC A;  2FFD A;  1IK9 A;  3B5N C;  1FZF A;  4DZO A;  1HBW A;  1YYC A;  1FOS F;  2N3A B;  1JTH A;  2E43 A;  1RF1 A;  2N1T B;  1FAV A;  4DOJ A;  1CZQ A;  5APW A;  2GM4 A;  5KLV K;  1HVV A;  5AW4 B;  5CJ0 A;  5AVR B;  1E5W A;  2O1J A;  1KFM A;  1HH0 A;  3T97 A;  1W2E A;  1HUC A;  2C9L Y;  2J59 M;  1LTT C;  1MV8 A;  1RE3 A;  1RE4 C;  4WBA A;  1RF0 A;  1URQ C;  2OYH A;  4HYT B;  1KIL C;  1N73 B;  2Q3I A;  1OXZ A;  4JYB A;  2N1T D;  3MUD A;  5CMZ A;  2QM8 A;  1L4A D;  2YO3 A;  5AW3 B;  1IO4 A;  3RL0 B;  3RL0 C;  5APV A;  2P7J A;  1FJP A;  1A02 J;  1M1J C;  2R5B A;  2YMY A;  4ZKU A;  2Q7C A;  1NTM K;  2N9B A;  3LW5 H;  3A5T A;  3M9Q A;  1JY2 P;  1SFC D;  1RE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...