3NFQA

Crystal structure of the conserved central domain of yeast spn1/iws1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords Transcription factor IWS1
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nfqA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3nfqA02
2Q3IA 3KDPB 2YNYA 1CI6B 1FOSE 3P8MC 3A7OA 3P32A 2XU6A 3NTNA 5AW6B 3VMXA 4AYCA 2W6AA 5AW0B 3LIEA 2C9NY 5AVWB 3MGNA 3I5CA 3O8ZA 3TNUB 3M9BA 5AVUB 1GK6A 2R5BA 3NMDA 2Z5HA 3HE5A 3M0DA 1MV8A 1S9KD 4AUWA 2JJLA 2YO2A 3IR9A 1GZLA 2YO3A 5AW4B 5AW1B 1H88A 2VRSA 1CI6A 2B4JC 1HUCA 2N9BA 4I2LC 5AVYB 4I6MC 5AVZB 3VMZA 3TYYA 1CZQA 5APUA 1GTWA 1YYCA 2XZRA 1A02F 1MFZA 2WT7A 3M91A 3V4QA 5AW3B 1GK4A 3L36A 2XV5A 5APVA 2Q7CA 2C9LY 4XE5B 3M0AA 3M9HA 3VMYA 3A3YB 3F9KC 3VTPC 1NWQA 3NFQA 5AVXB 3LIDA 3A5TA 3P7KA 3HPHE 1NAFA 5AW8B 3VYIA 2XPOA 2WPSA 5AVTB 4C7NA 3HTKA 5APTA 2WPRA 2R3CA 1H8AA 1T2KC 4JYCA 1DH3A 1SLQA 3TNUA 1WJTA 3B8EB 1A02J 2ZFCA 2Z5IA 1CSBA 2KP8A 5AW2B 2WPQA 5APSA 2QM8A 4DZOA 3MD0A 4C46A 2P2UA 2P7JA 2Q5UA 3A2AA 3KQGA 5AW5B 2W27A 3NXSA 4C7NB 5APYA 1X8YA 4KHXA 5APQA 3T97A 1HBWA 3M06A 3OAKA 4RESB 3U88C 4JYBA 5AVRB 4HYTB 1J2JB 2IPPA 2WWWA 1JUNA 4GKGA 2WTYA 5APXA 1GU4A 1OWAA 2XPPA 1OXZA 1IO4A 1JNMA 3UIAA 4M3LA 2QM7A 5APWA 1MUUA 4GT1A 1S9KE 2ZXEB 2R32A 3V5BA 1HJBA 2E42A 5CMZA 2E43A 4LC1A 1FAVA 1KQLA 3L37A 2XPLA 5AVQB 2XPNA 2BASA 3HE4A 2WT7B 1HWTC 2R5DA 1EO0A 3TK1A 1FOSF 1GD2E 2H7HA 3V4WA 5AVVB 5AVSB 4B86A 1G2CB 3HE4B 3L35A 2P67A 4AQRD 1T2KD 1GU5A 5AW7B 4EOTA 3SWFA 2N3AB 1SP4A 3HE5B 5AW9B 1H89A 1Z9EA 3HPGG 3VN0A
chains in the Genus database with same CATH superfamily
1YQ4C 4DOJA 1JY2P 3BCCE 3PH0A 4Y28J 3P32A 4U3FJ 1W5CE 2O01J 3CWBG 4WBAA 5BVZA 4DT0A 4X3RA 2YIUC 2HODA 3I55P 1PZQA 1ZOYC 2FKWB 1NTZG 3QWOC 1JY3O 2YO2A 5AW4B 2PAJA 3RK3C 1EDIA 4I2LC 3VMZA 1SQPG 1T8ZA 2IZ0A 2YKQA 2Y0DA 2WT7A 1YJWP 4HJGH 3AEDC 1LTJB 2FXOA 3MUDC 2QJPC 1JM0A 2YKPA 3NFQA 2E74B 2BCCD 5DJUB 2HFED 3TDKA 2C0WA 2Y1NA 2E75B 2K9JA 1CSBA 1XTCC 3EFGA 3A0BE 3NXSA 4P44A 1BE3D 2PRRA 3M06A 3VGOA 2Z4EA 4H0LC 3CXHI 4M3LA 1MUUA 3RBZA 2OGUA 5KLVG 3WUUA 3V4WA 5KAIH 1KILE 1NU1G 5HKZA 3OJAB 2GM4A 2B89A 4EOTA 1SQQK 1CI6B 1IFNA 1OVUA 3HD7C 3D7GA 3LIEA 4GDOA 3AE9C 3I5CA 3O8ZA 2FFDC 2BEZF 1IC2A 2RMZA 3HRNA 4H44C 5AXIA 2Y0EA 2K9YA 1VL2A 1LP1A 3GHGC 1W2BO 5KJ7D 1L2PA 3HTKB 2HYNA 1Q81Q 2A06G 5KKZC 5DJTB 1BGYJ 2J59M 4BTFA 4C7RA 1JOCA 1NTMD 1FZEA 1URQB 1VF5C 1PGPA 3IAOA 1KYOI 2WPVB 3G3ZA 1E5WA 1EC5A 1FU1A 1IK9A 1LP1B 4EIJA 2OYIB 2JWAA 1FDMA 1YI2P 1RE4C 1KB9I 3Q2YA 4C46A 2Q5UA 3L72E 1DEBA 1L0LG 5CCHD 1MZ9A 2LR2A 2DLAA 5J3XA 4HYTB 1VQ8P 1OXZA 1SQXK 3V5BA 4OC1A 2ZT9C 2JP3A 2R5DA 3OA7A 3CCUP 3PHLA 2CIJA 4N78D 3FECA 1T3UA 3ABVC 3VOPA 2QJKC 2JDIH 4U3FD 2ZYGA 1BGYD 4OC5A 2XU6A 1RY3A 2WVRA 3VMXA 2W6AA 3R2PA 3GLMA 4H13C 2QJPB 3B5NB 1EDJA 3OW2O 3U1AA 1GL2D 2H88C 1NTMG 1MFTA 2YMKA 3BCCG 1OW6A 1ZLLA 1HUCA 2N9BA 3D70A 1KFNA 1CZQA 3L75D 2A06D 3H25A 1SQXJ 4PV1C 2KNCA 1YITP 1LWUA 1FJKA 4N3YB 5KLVJ 1URQD 3M0DC 4IOIH 2G3AA 1VQNP 4OC2A 3VMYA 3A3YB 1BGYE 5KJ7C 3BCCD 1PFIA 2FYNB 1H8AA 1SLQA 3L4FA 3H6PA 2IYPA 1G1IA 2Z5IA 2K88A 3FEDA 3VROA 3AEBC 2QM8A 1NTZE 1KQFB 1YQ3C 4KT0J 3KASA 5K5GB 2KK7A 1NAYA 2HLOA 1OFCX 2OOTA 3A0HH 1EZVE 2FYUG 2IPPA 1G2CA 2AXCA 1X22A 2OTJP 1JB0J 1KQSO 3RL0D 3AE8C 2FYUK 1EO0A 2JKVA 3SWYA 1K8AQ 4BRYA 4IFFA 2IFNA 4H44B 1LT1A 4B86A 5CJ4A 1JEKA 4U3FG 3HE5B 5AW9B 1Z9EA 3BUOB 5KKZB 3VN0A 1JY2N 4UB6E 1NTME 3HD7A 3TSIA 3MHVA 2W6JH 5CHXA 1FDIA 3FWLA 4JBZA 2VRSA 1CI6A 5TJHA 2OYIC 3Q5RA 2E76C 2IFMA 2KYVA 2HPCB 1SQPJ 1NTMK 4OMEA 2QIWA 4JF7A 2LKMA 1NWQA 4D6TJ 5H2FH 3RK3B 1U57A 1EZVI 5AVTB 3HTKA 3B71A 1SFCB 1T2KC 4YPCA 1DH3A 1FDOA 1D7MA 1WJTA 1LTJC 2AEFA 3CCLP 5D29A 3II6A 2RN0A 1Q2NA 1EXIA 2WPQA 1VQ7P 3E1RA 1ZRTD 1M1JA 1EDLA 4BPUB 3O6QA 2WWWA 2C6CA 1NKNA 1SQXG 2QM7A 3OP0A 3AE6C 4JPZB 1JY2O 3LW5H 4GT1A 3Q5PA 3P8CE 3B5NC 1DD4A 1IFMA 3FF3A 1K04A 1NU1K 4R4MA 2N1TD 3S1KA 3AECC 2W90A 2R44A 1RE3C 3GF7A 3N7NA 2ZVNB 3ZNIA 1N73A 2BCCE 5CBNA 3V6IA 1VQPP 1LT9A 2C9NY 2NPSB 1TU3F 3JC22 1FZBA 1QL1A 1GK6A 2P10A 3JCUH 4WY4C 3CD6P 4IFMA 3FXDA 3BRTB 3TGUD 1GZLA 1H88A 4MCPA 1PGJA 5APUA 1HVVA 3A0BH 1NGMB 4OGQB 3OB1B 3M91A 2OYHC 4XE5B 3JCUE 2H8PD 2W8ZA 3LIDA 2OR4A 2IDBA 3VYIA 2WPSA 2IBZG 5APTA 4I7ZC 3D6YA 2H89C 4JYCA 3TNUA 2QJYC 2K37A 1KB9E 3S9NA 1SQQG 2PP6A 1WMKA 1S1CX 1Q82Q 4DZOA 2Y9ZA 3MD0A 3KYQA 5HKYA 3A2AA 3KQGA 3CXHE 1SQVK 2Q6QA 3L75G 2I1KA 1NTKG 3MTUE 5E79H 5EFWB 3SJXA 1PL5A 1K9MQ 3AE2C 1FZGA 5GTHE 1OW8A 3FX0A 4RR2B 2E42A 2XNDH 1L0LD 5CCGD 4A4BA 2FFDA 3PP5A 4K35A 3CL3D 1YIJP 4XA4A 2O01N 1RF1B 5C39A 2P67A 2OYOA 4KJMA 3AEFC 2MJZA 3T97B 1KYOH 4GOEA 1L0LK 5KAFE 1M1JB 4GODA 2P58A 1VQKP 3CCVP 3HUSC 2NPSD 3H1KD 3L72J 5AVWB 3MGNA 4BWNA 3H32A 3VMAA 5CCGC 1KB9D 2QJKB 1LT9C 1Y47A 4OC4A 4I6MC 1H0TB 2D2CD 2JWDA 1BSHA 1M8OB 2AXTH 3U1CA 4IL6E 5AW3B 4ZKUA 3D6ZA 1R8EA 1EDKA 4NGTA 3P7KA 3CCJP 1NAFA 2ZYAA 3R4YA 3WU2E 2KS1A 1Z8LA 3H1HD 3RL0C 2R3CA 1KORA 1KILA 2ZFCA 3IFMA 2LXBA 4JQ0D 4IL6X 1WT6A 3H32B 3L70G 5AW5B 2W27A 1FZCB 2CK3H 1SQVE 4GPLB 2MKVA 1XTGB 1P84E 2A45H 3H1HE 5CCGA 1URQA 4CPGA 1SQBD 2Q1KA 4PJ0H 2E43A 3L37A 2ZJSE 1L0NK 1RHZB 2N1TB 2ZAEB 3HE4B 3L35A 1P84D 1BSNA 1J1EC 4OGQC 1CX8A 1NU1J 3NTNA 1ZRTE 3TNUB 3PTZA 4YXWH 4PJ0E 3W68A 1NTKJ 1S3JA 4L75A 1GTWA 2H43A 2B9BA 3F5HA 1OX3A 4OGQD 1GK4A 4W7YA 3M9HA 2YMYA 3H1HJ 2W6BA 1RF0A 3WU2H 3RK2C 3M9QA 2L91A 4P4IA 3B5NA 1N73C 1KTMA 3PLFB 3MP7B 3E1IA 2OARA 4HKZH 1RF1C 3BXMA 2WSSH 1K05A 2OTLP 1PPJG 1M1JC 1Q86Q 2QA4P 3AEGC 4LLHA 3V2RA 1JNMA 1IO4A 4RJTA 1FBMA 2R32A 4ZMDA 2M5AB 3BATA 2WT7B 3CWBD 4ASVA 5BU8B 3GW6A 1LTGC 4P4FA 3VRQA 1K73Q 3D71A 3WUVA 2O01H 2HODB 3AE1C 1EZVD 3L74E 3CCSP 4W7ZA 1HTLC 3TGUE 1FZCA 3BCCJ 4JYWA 3N4XA 3L70J 1CW5A 1X9VA 1S9KD 2NRGA 2JJLA 2JO1A 2YXQB 1ZR2A 2SPZA 2V7QH 3WMM0 4Y99C 2XZRA 3L73G 2KUBA 3CLQA 3L70D 1NJIQ 3S9OA 3F9KC 3A5TA 3CC4P 2UWJE 2QG4A 3L75E 1VF5D 3H1LG 4A4CA 1N7SD 2A45G 1QLED 3MUDA 2FXMA 2LXCB 1RE4A 3CMEP 4C7NB 3HD7B 1P84I 1J1EB 3GMAA 4JYBA 5AVRB 5CJ0A 2PVWA 4Z1MH 2ZXXA 4BRYB 4O9BA 2PFXA 2ZXEB 4N78E 1PP9D 1PV3A 5AVQB 3IN6A 1RH5B 4R4LA 1AA0A 1HH0A 1GD2E 3GF3A 1JTHA 3AEAC 2A06E 3SWFA 1SP4A 3SJFA 3CX5H 3H1IE 4EI2A 1IFIA 2WSEH 3L72D 2QVAA 1BE3G 2QSIA 1N7SA 2NPSA 3TF5A 2C6GA 1YTZI 1KQGB 2E74D 1QVFO 2ZYDA 2WSEJ 3TYYA 3SSUA 2E5TA 1N86A 1YBKA 1A02F 1LJ2A 3G9RA 3L36A 4EYYQ 2VKZG 1L4AA 1J1DB 1N2DC 5KLVE 1GW4A 2IX7C 1PGOA 4NPFX 5BU5A 3KZIE 4P45A 1N7SB 3AE4C 1AQ5A 2E74C 2OYHA 3E7KA 3H1JG 5APSA 1Y9BA 3RK3D 3HD7D 4NGRA 5F09A 3BI1A 3SJEA 4BXLA 1VQMP 1M56D 3U88C 1NYHA 2Y1MA 4D6TE 4GKGA 1GMJA 3USSA 1KILB 2E75D 2ZT9D 3TGUG 4PD4I 5GTIE 1FS0E 4H0LB 1S5LE 2QEXP 4TLFA 3G71P 4NGMA 2KI7B 3SFEC 1GU5A 4A7PA 1RE3A 1LTAC 4PD4H 4ASWA 3L71J 4H13D 3CCMP 3KDPB 1BDCA 1E79H 4AYCA 3GHGA 1PPJE 2IBZI 1KC8Q 3KPEA 2BCCJ 3HUSA 3FXEA 1PP9E 3NMDA 4LQGA 3VP9A 1S2EA 2YO3A 4U3FE 5CCHC 1LTSC 3A0HE 3I56P 2E5YA 1U7JA 1FBVA 1VQ4P 3V4QA 1SVFA 4RO0A 5TISE 4WB4A 2Q7CA 3M0AA 3B4SA 5L8RJ 3BVHA 1KB9H 2WQYC 5AVXB 3OB2B 1BCCE 3HPHE 5AW8B 1EZVG 1LGHB 3IF4A 3L73D 1JCCA 2GA1A 1BE3E 3B8EB 3D7DA 1ZV8A 5HKWA 1SQXD 3BUXB 1OIPA 1SQPK 3K5BA 3SWKA 5CCHA 2DW3A 4DCKA 1NTZJ 1KFMA 1FZFA 2IYOA 2ZT9B 2POHA 3FGAD 4D6TD 3CC2P 2BEQD 3AE5C 1S9KE 1SQPD 1HJBA 4L73A 5KLIB 2KSJA 2XPNA 3RK3E 4MCSA 3TK1A 1W2EA 1FOSF 2E76B 2A45I 3B5ND 3S9LA 1FJPA 2M3BA 3CCQP 4AQRD 2IZ1A 2JBJA 2O1JA 3BI0A 4JZ0A 3D7FA 4H13B 1PP9G 4ZKPA 1HF9A 2AEJA 1SQVG 3L71E 3G6EP 1Y8AA 2Z5HA 5TISH 4HH2A 1HJ0A 1MV8A 1N7SC 3IR9A 3H1IG 4TT3H 1ZXGA 3CXHH 3TGUJ 3HMJG 3IWWA 2GUVA 3BUWB 1B47A 3L71D 1EXJA 5APVA 1BCCG 1KV4A 1GL2B 3C1LA 4PV1B 1UIIA 1DIPA 4WVZA 1JO5A 1LWUB 2WZ7A 5B5EH 4Y99B 2KNCB 3QH9A 3FWNA 2D2CB 4P4EA 3JSVC 2WSFH 1SQBK 1LTIC 1NKZB 2FYNC 2KSEA 3BASA 4GOFA 2FYUD 5KLVK 1YJNP 1NO4A 3OAKA 3W67A 1J2JB 1OWAA 3H1LE 2XKMA 1Z56A 1KILD 4RKUJ 4WY4B 3UIAA 3BHXA 4U7JA 1SQXE 2E76D 2HPCA 1VQ9P 5AW7B 3L73E 2WMMA 2O3JA 1HGVA 1BCCD 3KZIH 2Q3IA 2KIKA 2V7QJ 5AW6B 3ITKA 2K1AA 2AXTE 4H44D 3M9BA 1NTKK 4AUWA 3CWBJ 1BE3J 1SQQE 1DD3A 3RBXA 2B4JC 5AVYB 4I1LA 2XEJA 1SQVD 3CI9A 1PPJD 4P4DA 1BDDA 4NGPA 3H1KG 1H0TA 2AEMA 5KTBA 1SFCC 5B5EE 4BPWB 1AVOA 4EDFA 1QX8A 4IFDK 3V2NA 3C8VA 1OMIA 5KLIC 3RBUA 3RGUA 4XFJA 1MKMA 2P1JA 2KP8A 5B66H 3CX5I 3VRRA 1FE6A 3VRNA 3HUSB 1X0TA 4OVNF 2UV8G 2K9JB 1RF1A 5KJ7A 1SFCD 3G4SP 4WY4D 4HB1A 2XPPA 2CBLA 4DJGA 5E79E 5APWA 1YHQP 1YTZT 2GUSA 2YKOA 2KLVA 2WSCH 1JMBA 1HWTC 1DX7A 1FC2C 3Q3DA 4NPEA 2HG5D 3CCRP 1T2KD 5KAIE 1VQLP 3EWKA 3S4RA 1KYOE 2NPSC 1OW7A 2XEFA 1NU1D 4N6JA 5KLVD 2C0XA 1SQBG 3CWBE 1QGKB 1KD1Q 4MCQA 1NVOA 3L74J 1VPCA 3L71G 1JMMA 2I8DA 2Q9IA 4LGDE 4WWIA 1OVVA 2CPSA 3EQ2A 2D2CC 5AW1B 2OYHB 2QRXA 1MFZA 2KXPB 1GW3A 2FBWC 1S72P 2PVVA 2XV5A 1JCDA 4W80A 3CX5E 4NGNA 4WY4A 2JBKA 3CCEP 3VTPC 2B88A 2XEIA 3H1ID 1LTTC 5ELYA 1L0NE 2WPRA 5BY0A 1FZAA 3Q1MA 2Y9YA 1KMIZ 2CPBA 1IFJA 5AW2B 4I7ZB 1QVGO 2P2UA 2P7JA 2QJYB 3MIWA 4GIFA 2Q3EA 1Q7YQ 1RQUA 1LTBC 4RESB 2YXRB 1USDA 1AVYA 1T3JA 1IZNB 3Q5SA 1JY3N 2B87B 5CMZA 4LC1A 1JTHB 1EQ7A 2OTKE 3SFDC 4D6TG 3ZDMA 1USEA 2WSCJ 2YIUB 2XNXA 3PLNA 2N3AB 1SQVJ 2M3EA 1H89A 1AV1A 2I1JA 3AE7C 2ITAA 2YNYA 3H1JE 1NTMJ 1LT9B 3PRJA 4NGQA 3RK2B 1L4AC 2JR8A 3H1IJ 3LW5J 1YVHA 1NTKD 2C6PA 3L70E 1SQBE 4L76A 4YXDC 2V4HA 2QE7H 4OWFA 1BCCJ 4PD4D 2FY8A 2KS1B 1S4XA 1VQOP 2E75C 3BUMB 1OZHA 5CBOA 3L74D 1JY3P 2KLUA 3AE3C 2HR3A 2J58A 2PGDA 2IBZD 1GL2C 1SQBJ 1DEEG 2FYUJ 3RL0B 3EFFK 3F89A 1LWUC 1S5LH 3PJSK 5APQA 3T97A 1NU1E 1L0ND 3H1JJ 2O1KA 1NH4A 1RF0C 4UB8E 5GTHH 2WSFJ 1AQTA 1FZCC 3CXHD 1ZW0A 2N1TC 1ZP0C 3GG2A 3MZWB 3H1KE 2H7HA 1VQ6P 5AVSB 1UIXA 1PGQA 4ZNCA 5H2FE 3FEEA 1KZUB 4MN4C 2FYZA 1YJ9P 4H0LD 3GHGB 3RK2D 3A7OA 5AW0B 1NTKE 1KN7A 1P84H 3BRVB 1QEXA 1L0LE 2IBZE 2WITA 5AVUB 2R5BA 3HE5A 3M0DA 1L0NJ 3H1JD 1T6AA 1KYOD 2BCCG 5AVZB 5GTIH 3H1KJ 4MCRA 1RQVA 1IFDA 3SJGA 3KHUA 3CC7P 4K3AA 2N1TA 2C9LY 1N7LA 3WUTA 5KAFH 4PD4E 2KZJA 1GDTA 5M1BA 2L5GB 3U59A 1NHLA 1ZR4A 1L0LJ 3VP8A 2KOGA 1S5LX 3VRPA 1N73B 3PT1A 2J5UA 2ZVOB 2WTYA 5APXA 2G8YA 1R5SA 3L73J 1GL2A 1L4AB 1LTJA 1FAVA 3HE4A 2K3RA 4YTPC 3CX5D 1X79B 3PFVA 1HGZA 1U7MA 1J1DC 2RH0A 1SQQD 3HPGG 3H1LJ 3CPWO 3CMAP 1FOSE 3P8MC 3O6QB 2OYIA 3KXDA 2XEGA 4IL6H 3P8CD 1SFCA 4BPXB 1PP9J 2OQQA 4W9YA 1Q90D 3C9IA 1VQ5P 3L74G 2XDJA 1YYCA 4UB6H 1N8RQ 1AJYA 4OC3A 4UB8H 1KILC 3V2QA 1QL2A 4NGSA 2Y0CA 1ZN5A 1SS1A 2FFDB 4NPDA 2M5AA 3H1LD 3V2PA 2XPOA 1SQQJ 2B87A 1VDFA 2W83C 4C7NA 2FXPA 4P4JA 2FYUE 2NZ2A 1A02J 1LNQA 1WRGA 5F13A 1OVRA 2KB7P 4PV1D 1M90Q 4OH8B 1NOHA 2M0BA 5APYA 1L0NG 1X8YA 4KHXA 1NTZK 4L74A 1HBWA 3S9MA 1URQC 1VF5B 4P4BA 1M1KQ 1ZMEC 1JUNA 2N9YB 1GU4A 1L4AD 3D7HA 2RKLA 1IFPA 1KQLA 3L75J 2XPLA 1BGYG 1DE4C 2BASA 1NTZD 4OC0A 1M57D 1M7LA 3AEEC 3H1HG 2M8RA 4QMAA 3RL0g 3BUNB 1AFOA 5AVVB 1SQPE 1G2CB 1PIXA 1IJDB 1R5LA 1G1JA 2R3SA 3L72G 2KZIA 2JEEA 1IK7A 5B66E
chains in the Genus database with same CATH topology
4DOJA 1JY2P 1IFIA 3P32A 4N6JA 2WSEH 2C0XA 1LT9A 2C9NY 4WBAA 5BVZA 2NPSB 1VPCA 1FZBA 1QL1A 1JMMA 2HODA 2Q9IA 1GK6A 1N7SA 2NPSA 4LGDE 4WY4C 4IFMA 3BRTB 2FKWB 2CPSA 1YTZI 1JY3O 2YO2A 3EQ2A 1GZLA 5AW4B 2PAJA 3RK3C 5AW1B 1H88A 2OYHB 4I2LC 3VMZA 3TYYA 5APUA 1T8ZA 1HVVA 1N86A 2YKQA 1A02F 1MFZA 2WT7A 1GW3A 3M91A 1LTJB 2OYHC 3L36A 1L4AA 1J1DB 1JCDA 2XV5A 4W80A 1N2DC 4XE5B 4WY4A 2H8PD 1GW4A 3VTPC 2YKPA 3NFQA 2IX7C 3LIDA 1LTTC 3VYIA 5BU5A 2WPSA 2HFED 1N7SB 5APTA 2WPRA 2C0WA 1AQ5A 4JYCA 3TNUA 1FZAA 2OYHA 1CSBA 1XTCC 3EFGA 2CPBA 1IFJA 5AW2B 2PP6A 5APSA 4DZOA 3MD0A 3KYQA 2P2UA 2P7JA 3A2AA 3HD7D 3RK3D 3KQGA 3MIWA 4GIFA 3NXSA 1SQVK 1LTBC 3M06A 4RESB 2Z4EA 3U88C 2I1KA 3MTUE 4GKGA 1KILB 1T3JA 1FZGA 4M3LA 1MUUA 1JY3N 2E42A 5CMZA 4LC1A 5CCGD 1JTHB 2FFDA 1EQ7A 3PP5A 3CL3D 4XA4A 3V4WA 1RF1B 2P67A 2XNXA 3OJAB 1GU5A 1RE3A 2GM4A 2MJZA 4EOTA 1LTAC 1SQQK 2N3AB 1L0LK 1H89A 1M1JB 2I1JA 3KDPB 2YNYA 1CI6B 1IFNA 3HUSC 3HD7C 1LT9B 4AYCA 2NPSD 3RK2B 1L4AC 3LIEA 3GHGA 5AVWB 3MGNA 3KPEA 3HUSA 3I5CA 3O8ZA 3H32A 2FFDC 1IC2A 5CCGC 3NMDA 1LT9C 3HRNA 3VP9A 2YO3A 5CCHC 4I6MC 1LTSC 3GHGC 5KJ7D 3HTKB 2HYNA 3U1CA 3V4QA 1SVFA 2J59M 5AW3B 4WB4A 4ZKUA 4C7RA 2Q7CA 1JOCA 3M0AA 3BVHA 1FZEA 1URQB 5AVXB 3P7KA 1JY3P 1NAFA 3G3ZA 3HPHE 5AW8B 1LGHB 1E5WA 1FU1A 3RL0C 2R3CA 1JCCA 1IK9A 2J58A 1KILA 3B8EB 2ZFCA 4EIJA 3IFMA 1GL2C 2OYIB 1FDMA 1ZV8A 3RL0B 1RE4C 1SQPK 4C46A 2Q5UA 1WT6A 5CCHA 1LWUC 3H32B 5AW5B 1DEBA 2W27A 5CCHD 5APQA 1MZ9A 1FZCB 3T97A 1KFMA 2O1KA 4HYTB 1FZFA 1NH4A 1XTGB 2A45H 5CCGA 1RF0C 1URQA 1OXZA 2POHA 1SQXK 1S9KE 1FZCC 3V5BA 1HJBA 2N1TC 2E43A 2KSJA 3L37A 2XPNA 2R5DA 3TK1A 1W2EA 1L0NK 1FOSF 3OA7A 2H7HA 2A45I 3B5ND 2N1TB 1FJPA 5AVSB 2M3BA 4N78D 3HE4B 3L35A 4AQRD 1T3UA 3VOPA 2O1JA 1J1EC 1KZUB 4ZKPA 2FYZA 3GHGB 3RK2D 3A7OA 2XU6A 1RY3A 3NTNA 3VMXA 2W6AA 3R2PA 5AW0B 3BRVB 3B5NB 3TNUB 2WITA 5AVUB 1GL2D 2R5BA 3U1AA 2Z5HA 3HE5A 3M0DA 4HH2A 1MV8A 1N7SC 3IR9A 1ZLLA 1HUCA 2N9BA 5AVZB 1KFNA 1CZQA 1GTWA 2H43A 2GUVA 1IFDA 1LWUA 1GK4A 1FJKA 4W7YA 2N1TA 4N3YB 5APVA 2C9LY 1GL2B 1URQD 3M0DC 3M9HA 2YMYA 3VMYA 3A3YB 2W6BA 1RF0A 1N7LA 5KJ7C 1PFIA 1JO5A 1LWUB 2WZ7A 4Y99B 1GDTA 3RK2C 3M9QA 2L5GB 1H8AA 3U59A 1SLQA 3B5NA 1N73C 1NHLA 1ZR4A 3L4FA 3H6PA 1G1IA 2Z5IA 3VP8A 2WSFH 1SQBK 3E1IA 2KOGA 1LTIC 1NKZB 2OARA 2QM8A 3BASA 1RF1C 1N73B 5KLVK 2HLOA 1NO4A 1M1JC 3OAKA 1J2JB 2IPPA 1G2CA 2WTYA 5APXA 1OWAA 2XKMA 1Z56A 4LLHA 3V2RA 1JNMA 1IO4A 1KILD 3UIAA 4WY4B 1GL2A 1L4AB 1FBMA 2R32A 1LTJA 1FAVA 3RL0D 2FYUK 3BATA 3HE4A 2WT7B 1EO0A 1X79B 3SWYA 4IFFA 5BU8B 2IFNA 1LTGC 4B86A 2HPCA 5CJ4A 5AW7B 1HGZA 1J1DC 3HE5B 5AW9B 3HPGG 1Z9EA 2O01H 2HODB 1HGVA 3VN0A 1JY2N 4W7ZA 1HTLC 2Q3IA 1FOSE 3P8MC 5AW6B 2OYIA 1FZCA 3HD7A 3TSIA 3M9BA 3P8CD 1SFCA 3N4XA 1CW5A 1NTKK 1X9VA 1S9KD 4AUWA 2JJLA 3C9IA 5CHXA 1ZR2A 2VRSA 1CI6A 2B4JC 5AVYB 2XDJA 3WMM0 4Y99C 4I1LA 1YYCA 2XZRA 2OYIC 3CI9A 3CLQA 2IFMA 2KYVA 2HPCB 1KILC 3V2QA 1QL2A 1NTMK 4JF7A 3F9KC 1ZN5A 2LKMA 5KTBA 1NWQA 1SFCC 3RK3B 3A5TA 2FFDB 3V2PA 2XPOA 4IFDK 1VDFA 5AVTB 3V2NA 4C7NA 3HTKA 1SFCB 1T2KC 1DH3A 1N7SD 2A45G 1WJTA 1LTJC 1A02J 2P1JA 1WRGA 3MUDA 2KP8A 3II6A 2FXMA 2WPQA 2KB7P 4OH8B 1RE4A 1M1JA 3HUSB 1NOHA 4C7NB 5APYA 3HD7B 1X8YA 4KHXA 1NTZK 1HBWA 1J1EB 1URQC 4JYBA 5AVRB 2WWWA 1RF1A 1JUNA 5KJ7A 5CJ0A 1SFCD 1GU4A 4WY4D 2XPPA 1NKNA 1L4AD 4O9BA 2QM7A 5APWA 1YTZT 1JY2O 3LW5H 4GT1A 2ZXEB 2GUSA 4N78E 2YKOA 3P8CE 1KQLA 2KLVA 3B5NC 2XPLA 5AVQB 1IFMA 2BASA 2WSCH 1NU1K 1HWTC 1DX7A 1M7LA 1HH0A 2N1TD 1GD2E 2M8RA 1AFOA 5AVVB 1JTHA 1G2CB 2HG5D 1RE3C 1T2KD 1IJDB 1G1JA 3SWFA 3N7NA 1SP4A 2JEEA 2NPSC 1N73A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q3I A;  3KDP B;  2YNY A;  1CI6 B;  1FOS E;  3P8M C;  3A7O A;  3P32 A;  2XU6 A;  3NTN A;  5AW6 B;  3VMX A;  4AYC A;  2W6A A;  5AW0 B;  3LIE A;  2C9N Y;  5AVW B;  3MGN A;  3I5C A;  3O8Z A;  3TNU B;  3M9B A;  5AVU B;  1GK6 A;  2R5B A;  3NMD A;  2Z5H A;  3HE5 A;  3M0D A;  1MV8 A;  1S9K D;  4AUW A;  2JJL A;  2YO2 A;  3IR9 A;  1GZL A;  2YO3 A;  5AW4 B;  5AW1 B;  1H88 A;  2VRS A;  1CI6 A;  2B4J C;  1HUC A;  2N9B A;  4I2L C;  5AVY B;  4I6M C;  5AVZ B;  3VMZ A;  3TYY A;  1CZQ A;  5APU A;  1GTW A;  1YYC A;  2XZR A;  1A02 F;  1MFZ A;  2WT7 A;  3M91 A;  3V4Q A;  5AW3 B;  1GK4 A;  3L36 A;  2XV5 A;  5APV A;  2Q7C A;  2C9L Y;  4XE5 B;  3M0A A;  3M9H A;  3VMY A;  3A3Y B;  3F9K C;  3VTP C;  1NWQ A;  3NFQ A;  5AVX B;  3LID A;  3A5T A;  3P7K A;  3HPH E;  1NAF A;  5AW8 B;  3VYI A;  2XPO A;  2WPS A;  5AVT B;  4C7N A;  3HTK A;  5APT A;  2WPR A;  2R3C A;  1H8A A;  1T2K C;  4JYC A;  1DH3 A;  1SLQ A;  3TNU A;  1WJT A;  3B8E B;  1A02 J;  2ZFC A;  2Z5I A;  1CSB A;  2KP8 A;  5AW2 B;  2WPQ A;  5APS A;  2QM8 A;  4DZO A;  3MD0 A;  4C46 A;  2P2U A;  2P7J A;  2Q5U A;  3A2A A;  3KQG A;  5AW5 B;  2W27 A;  3NXS A;  4C7N B;  5APY A;  1X8Y A;  4KHX A;  5APQ A;  3T97 A;  1HBW A;  3M06 A;  3OAK A;  4RES B;  3U88 C;  4JYB A;  5AVR B;  4HYT B;  1J2J B;  2IPP A;  2WWW A;  1JUN A;  4GKG A;  2WTY A;  5APX A;  1GU4 A;  1OWA A;  2XPP A;  1OXZ A;  1IO4 A;  1JNM A;  3UIA A;  4M3L A;  2QM7 A;  5APW A;  1MUU A;  4GT1 A;  1S9K E;  2ZXE B;  2R32 A;  3V5B A;  1HJB A;  2E42 A;  5CMZ A;  2E43 A;  4LC1 A;  1FAV A;  1KQL A;  3L37 A;  2XPL A;  5AVQ B;  2XPN A;  2BAS A;  3HE4 A;  2WT7 B;  1HWT C;  2R5D A;  1EO0 A;  3TK1 A;  1FOS F;  1GD2 E;  2H7H A;  3V4W A;  5AVV B;  5AVS B;  4B86 A;  1G2C B;  3HE4 B;  3L35 A;  2P67 A;  4AQR D;  1T2K D;  1GU5 A;  5AW7 B;  4EOT A;  3SWF A;  2N3A B;  1SP4 A;  3HE5 B;  5AW9 B;  1H89 A;  1Z9E A;  3HPG G;  3VN0 A; 
#chains in the Genus database with same CATH topology
 1YQ4 C;  4DOJ A;  1JY2 P;  3BCC E;  3PH0 A;  4Y28 J;  3P32 A;  4U3F J;  1W5C E;  2O01 J;  3CWB G;  4WBA A;  5BVZ A;  4DT0 A;  4X3R A;  2YIU C;  2HOD A;  3I55 P;  1PZQ A;  1ZOY C;  2FKW B;  1NTZ G;  3QWO C;  1JY3 O;  2YO2 A;  5AW4 B;  2PAJ A;  3RK3 C;  1EDI A;  4I2L C;  3VMZ A;  1SQP G;  1T8Z A;  2IZ0 A;  2YKQ A;  2Y0D A;  2WT7 A;  1YJW P;  4HJG H;  3AED C;  1LTJ B;  2FXO A;  3MUD C;  2QJP C;  1JM0 A;  2YKP A;  3NFQ A;  2E74 B;  2BCC D;  5DJU B;  2HFE D;  3TDK A;  2C0W A;  2Y1N A;  2E75 B;  2K9J A;  1CSB A;  1XTC C;  3EFG A;  3A0B E;  3NXS A;  4P44 A;  1BE3 D;  2PRR A;  3M06 A;  3VGO A;  2Z4E A;  4H0L C;  3CXH I;  4M3L A;  1MUU A;  3RBZ A;  2OGU A;  5KLV G;  3WUU A;  3V4W A;  5KAI H;  1KIL E;  1NU1 G;  5HKZ A;  3OJA B;  2GM4 A;  2B89 A;  4EOT A;  1SQQ K;  1CI6 B;  1IFN A;  1OVU A;  3HD7 C;  3D7G A;  3LIE A;  4GDO A;  3AE9 C;  3I5C A;  3O8Z A;  2FFD C;  2BEZ F;  1IC2 A;  2RMZ A;  3HRN A;  4H44 C;  5AXI A;  2Y0E A;  2K9Y A;  1VL2 A;  1LP1 A;  3GHG C;  1W2B O;  5KJ7 D;  1L2P A;  3HTK B;  2HYN A;  1Q81 Q;  2A06 G;  5KKZ C;  5DJT B;  1BGY J;  2J59 M;  4BTF A;  4C7R A;  1JOC A;  1NTM D;  1FZE A;  1URQ B;  1VF5 C;  1PGP A;  3IAO A;  1KYO I;  2WPV B;  3G3Z A;  1E5W A;  1EC5 A;  1FU1 A;  1IK9 A;  1LP1 B;  4EIJ A;  2OYI B;  2JWA A;  1FDM A;  1YI2 P;  1RE4 C;  1KB9 I;  3Q2Y A;  4C46 A;  2Q5U A;  3L72 E;  1DEB A;  1L0L G;  5CCH D;  1MZ9 A;  2LR2 A;  2DLA A;  5J3X A;  4HYT B;  1VQ8 P;  1OXZ A;  1SQX K;  3V5B A;  4OC1 A;  2ZT9 C;  2JP3 A;  2R5D A;  3OA7 A;  3CCU P;  3PHL A;  2CIJ A;  4N78 D;  3FEC A;  1T3U A;  3ABV C;  3VOP A;  2QJK C;  2JDI H;  4U3F D;  2ZYG A;  1BGY D;  4OC5 A;  2XU6 A;  1RY3 A;  2WVR A;  3VMX A;  2W6A A;  3R2P A;  3GLM A;  4H13 C;  2QJP B;  3B5N B;  1EDJ A;  3OW2 O;  3U1A A;  1GL2 D;  2H88 C;  1NTM G;  1MFT A;  2YMK A;  3BCC G;  1OW6 A;  1ZLL A;  1HUC A;  2N9B A;  3D70 A;  1KFN A;  1CZQ A;  3L75 D;  2A06 D;  3H25 A;  1SQX J;  4PV1 C;  2KNC A;  1YIT P;  1LWU A;  1FJK A;  4N3Y B;  5KLV J;  1URQ D;  3M0D C;  4IOI H;  2G3A A;  1VQN P;  4OC2 A;  3VMY A;  3A3Y B;  1BGY E;  5KJ7 C;  3BCC D;  1PFI A;  2FYN B;  1H8A A;  1SLQ A;  3L4F A;  3H6P A;  2IYP A;  1G1I A;  2Z5I A;  2K88 A;  3FED A;  3VRO A;  3AEB C;  2QM8 A;  1NTZ E;  1KQF B;  1YQ3 C;  4KT0 J;  3KAS A;  5K5G B;  2KK7 A;  1NAY A;  2HLO A;  1OFC X;  2OOT A;  3A0H H;  1EZV E;  2FYU G;  2IPP A;  1G2C A;  2AXC A;  1X22 A;  2OTJ P;  1JB0 J;  1KQS O;  3RL0 D;  3AE8 C;  2FYU K;  1EO0 A;  2JKV A;  3SWY A;  1K8A Q;  4BRY A;  4IFF A;  2IFN A;  4H44 B;  1LT1 A;  4B86 A;  5CJ4 A;  1JEK A;  4U3F G;  3HE5 B;  5AW9 B;  1Z9E A;  3BUO B;  5KKZ B;  3VN0 A;  1JY2 N;  4UB6 E;  1NTM E;  3HD7 A;  3TSI A;  3MHV A;  2W6J H;  5CHX A;  1FDI A;  3FWL A;  4JBZ A;  2VRS A;  1CI6 A;  5TJH A;  2OYI C;  3Q5R A;  2E76 C;  2IFM A;  2KYV A;  2HPC B;  1SQP J;  1NTM K;  4OME A;  2QIW A;  4JF7 A;  2LKM A;  1NWQ A;  4D6T J;  5H2F H;  3RK3 B;  1U57 A;  1EZV I;  5AVT B;  3HTK A;  3B71 A;  1SFC B;  1T2K C;  4YPC A;  1DH3 A;  1FDO A;  1D7M A;  1WJT A;  1LTJ C;  2AEF A;  3CCL P;  5D29 A;  3II6 A;  2RN0 A;  1Q2N A;  1EXI A;  2WPQ A;  1VQ7 P;  3E1R A;  1ZRT D;  1M1J A;  1EDL A;  4BPU B;  3O6Q A;  2WWW A;  2C6C A;  1NKN A;  1SQX G;  2QM7 A;  3OP0 A;  3AE6 C;  4JPZ B;  1JY2 O;  3LW5 H;  4GT1 A;  3Q5P A;  3P8C E;  3B5N C;  1DD4 A;  1IFM A;  3FF3 A;  1K04 A;  1NU1 K;  4R4M A;  2N1T D;  3S1K A;  3AEC C;  2W90 A;  2R44 A;  1RE3 C;  3GF7 A;  3N7N A;  2ZVN B;  3ZNI A;  1N73 A;  2BCC E;  5CBN A;  3V6I A;  1VQP P;  1LT9 A;  2C9N Y;  2NPS B;  1TU3 F;  3JC2 2;  1FZB A;  1QL1 A;  1GK6 A;  2P10 A;  3JCU H;  4WY4 C;  3CD6 P;  4IFM A;  3FXD A;  3BRT B;  3TGU D;  1GZL A;  1H88 A;  4MCP A;  1PGJ A;  5APU A;  1HVV A;  3A0B H;  1NGM B;  4OGQ B;  3OB1 B;  3M91 A;  2OYH C;  4XE5 B;  3JCU E;  2H8P D;  2W8Z A;  3LID A;  2OR4 A;  2IDB A;  3VYI A;  2WPS A;  2IBZ G;  5APT A;  4I7Z C;  3D6Y A;  2H89 C;  4JYC A;  3TNU A;  2QJY C;  2K37 A;  1KB9 E;  3S9N A;  1SQQ G;  2PP6 A;  1WMK A;  1S1C X;  1Q82 Q;  4DZO A;  2Y9Z A;  3MD0 A;  3KYQ A;  5HKY A;  3A2A A;  3KQG A;  3CXH E;  1SQV K;  2Q6Q A;  3L75 G;  2I1K A;  1NTK G;  3MTU E;  5E79 H;  5EFW B;  3SJX A;  1PL5 A;  1K9M Q;  3AE2 C;  1FZG A;  5GTH E;  1OW8 A;  3FX0 A;  4RR2 B;  2E42 A;  2XND H;  1L0L D;  5CCG D;  4A4B A;  2FFD A;  3PP5 A;  4K35 A;  3CL3 D;  1YIJ P;  4XA4 A;  2O01 N;  1RF1 B;  5C39 A;  2P67 A;  2OYO A;  4KJM A;  3AEF C;  2MJZ A;  3T97 B;  1KYO H;  4GOE A;  1L0L K;  5KAF E;  1M1J B;  4GOD A;  2P58 A;  1VQK P;  3CCV P;  3HUS C;  2NPS D;  3H1K D;  3L72 J;  5AVW B;  3MGN A;  4BWN A;  3H32 A;  3VMA A;  5CCG C;  1KB9 D;  2QJK B;  1LT9 C;  1Y47 A;  4OC4 A;  4I6M C;  1H0T B;  2D2C D;  2JWD A;  1BSH A;  1M8O B;  2AXT H;  3U1C A;  4IL6 E;  5AW3 B;  4ZKU A;  3D6Z A;  1R8E A;  1EDK A;  4NGT A;  3P7K A;  3CCJ P;  1NAF A;  2ZYA A;  3R4Y A;  3WU2 E;  2KS1 A;  1Z8L A;  3H1H D;  3RL0 C;  2R3C A;  1KOR A;  1KIL A;  2ZFC A;  3IFM A;  2LXB A;  4JQ0 D;  4IL6 X;  1WT6 A;  3H32 B;  3L70 G;  5AW5 B;  2W27 A;  1FZC B;  2CK3 H;  1SQV E;  4GPL B;  2MKV A;  1XTG B;  1P84 E;  2A45 H;  3H1H E;  5CCG A;  1URQ A;  4CPG A;  1SQB D;  2Q1K A;  4PJ0 H;  2E43 A;  3L37 A;  2ZJS E;  1L0N K;  1RHZ B;  2N1T B;  2ZAE B;  3HE4 B;  3L35 A;  1P84 D;  1BSN A;  1J1E C;  4OGQ C;  1CX8 A;  1NU1 J;  3NTN A;  1ZRT E;  3TNU B;  3PTZ A;  4YXW H;  4PJ0 E;  3W68 A;  1NTK J;  1S3J A;  4L75 A;  1GTW A;  2H43 A;  2B9B A;  3F5H A;  1OX3 A;  4OGQ D;  1GK4 A;  4W7Y A;  3M9H A;  2YMY A;  3H1H J;  2W6B A;  1RF0 A;  3WU2 H;  3RK2 C;  3M9Q A;  2L91 A;  4P4I A;  3B5N A;  1N73 C;  1KTM A;  3PLF B;  3MP7 B;  3E1I A;  2OAR A;  4HKZ H;  1RF1 C;  3BXM A;  2WSS H;  1K05 A;  2OTL P;  1PPJ G;  1M1J C;  1Q86 Q;  2QA4 P;  3AEG C;  4LLH A;  3V2R A;  1JNM A;  1IO4 A;  4RJT A;  1FBM A;  2R32 A;  4ZMD A;  2M5A B;  3BAT A;  2WT7 B;  3CWB D;  4ASV A;  5BU8 B;  3GW6 A;  1LTG C;  4P4F A;  3VRQ A;  1K73 Q;  3D71 A;  3WUV A;  2O01 H;  2HOD B;  3AE1 C;  1EZV D;  3L74 E;  3CCS P;  4W7Z A;  1HTL C;  3TGU E;  1FZC A;  3BCC J;  4JYW A;  3N4X A;  3L70 J;  1CW5 A;  1X9V A;  1S9K D;  2NRG A;  2JJL A;  2JO1 A;  2YXQ B;  1ZR2 A;  2SPZ A;  2V7Q H;  3WMM 0;  4Y99 C;  2XZR A;  3L73 G;  2KUB A;  3CLQ A;  3L70 D;  1NJI Q;  3S9O A;  3F9K C;  3A5T A;  3CC4 P;  2UWJ E;  2QG4 A;  3L75 E;  1VF5 D;  3H1L G;  4A4C A;  1N7S D;  2A45 G;  1QLE D;  3MUD A;  2FXM A;  2LXC B;  1RE4 A;  3CME P;  4C7N B;  3HD7 B;  1P84 I;  1J1E B;  3GMA A;  4JYB A;  5AVR B;  5CJ0 A;  2PVW A;  4Z1M H;  2ZXX A;  4BRY B;  4O9B A;  2PFX A;  2ZXE B;  4N78 E;  1PP9 D;  1PV3 A;  5AVQ B;  3IN6 A;  1RH5 B;  4R4L A;  1AA0 A;  1HH0 A;  1GD2 E;  3GF3 A;  1JTH A;  3AEA C;  2A06 E;  3SWF A;  1SP4 A;  3SJF A;  3CX5 H;  3H1I E;  4EI2 A;  1IFI A;  2WSE H;  3L72 D;  2QVA A;  1BE3 G;  2QSI A;  1N7S A;  2NPS A;  3TF5 A;  2C6G A;  1YTZ I;  1KQG B;  2E74 D;  1QVF O;  2ZYD A;  2WSE J;  3TYY A;  3SSU A;  2E5T A;  1N86 A;  1YBK A;  1A02 F;  1LJ2 A;  3G9R A;  3L36 A;  4EYY Q;  2VKZ G;  1L4A A;  1J1D B;  1N2D C;  5KLV E;  1GW4 A;  2IX7 C;  1PGO A;  4NPF X;  5BU5 A;  3KZI E;  4P45 A;  1N7S B;  3AE4 C;  1AQ5 A;  2E74 C;  2OYH A;  3E7K A;  3H1J G;  5APS A;  1Y9B A;  3RK3 D;  3HD7 D;  4NGR A;  5F09 A;  3BI1 A;  3SJE A;  4BXL A;  1VQM P;  1M56 D;  3U88 C;  1NYH A;  2Y1M A;  4D6T E;  4GKG A;  1GMJ A;  3USS A;  1KIL B;  2E75 D;  2ZT9 D;  3TGU G;  4PD4 I;  5GTI E;  1FS0 E;  4H0L B;  1S5L E;  2QEX P;  4TLF A;  3G71 P;  4NGM A;  2KI7 B;  3SFE C;  1GU5 A;  4A7P A;  1RE3 A;  1LTA C;  4PD4 H;  4ASW A;  3L71 J;  4H13 D;  3CCM P;  3KDP B;  1BDC A;  1E79 H;  4AYC A;  3GHG A;  1PPJ E;  2IBZ I;  1KC8 Q;  3KPE A;  2BCC J;  3HUS A;  3FXE A;  1PP9 E;  3NMD A;  4LQG A;  3VP9 A;  1S2E A;  2YO3 A;  4U3F E;  5CCH C;  1LTS C;  3A0H E;  3I56 P;  2E5Y A;  1U7J A;  1FBV A;  1VQ4 P;  3V4Q A;  1SVF A;  4RO0 A;  5TIS E;  4WB4 A;  2Q7C A;  3M0A A;  3B4S A;  5L8R J;  3BVH A;  1KB9 H;  2WQY C;  5AVX B;  3OB2 B;  1BCC E;  3HPH E;  5AW8 B;  1EZV G;  1LGH B;  3IF4 A;  3L73 D;  1JCC A;  2GA1 A;  1BE3 E;  3B8E B;  3D7D A;  1ZV8 A;  5HKW A;  1SQX D;  3BUX B;  1OIP A;  1SQP K;  3K5B A;  3SWK A;  5CCH A;  2DW3 A;  4DCK A;  1NTZ J;  1KFM A;  1FZF A;  2IYO A;  2ZT9 B;  2POH A;  3FGA D;  4D6T D;  3CC2 P;  2BEQ D;  3AE5 C;  1S9K E;  1SQP D;  1HJB A;  4L73 A;  5KLI B;  2KSJ A;  2XPN A;  3RK3 E;  4MCS A;  3TK1 A;  1W2E A;  1FOS F;  2E76 B;  2A45 I;  3B5N D;  3S9L A;  1FJP A;  2M3B A;  3CCQ P;  4AQR D;  2IZ1 A;  2JBJ A;  2O1J A;  3BI0 A;  4JZ0 A;  3D7F A;  4H13 B;  1PP9 G;  4ZKP A;  1HF9 A;  2AEJ A;  1SQV G;  3L71 E;  3G6E P;  1Y8A A;  2Z5H A;  5TIS H;  4HH2 A;  1HJ0 A;  1MV8 A;  1N7S C;  3IR9 A;  3H1I G;  4TT3 H;  1ZXG A;  3CXH H;  3TGU J;  3HMJ G;  3IWW A;  2GUV A;  3BUW B;  1B47 A;  3L71 D;  1EXJ A;  5APV A;  1BCC G;  1KV4 A;  1GL2 B;  3C1L A;  4PV1 B;  1UII A;  1DIP A;  4WVZ A;  1JO5 A;  1LWU B;  2WZ7 A;  5B5E H;  4Y99 B;  2KNC B;  3QH9 A;  3FWN A;  2D2C B;  4P4E A;  3JSV C;  2WSF H;  1SQB K;  1LTI C;  1NKZ B;  2FYN C;  2KSE A;  3BAS A;  4GOF A;  2FYU D;  5KLV K;  1YJN P;  1NO4 A;  3OAK A;  3W67 A;  1J2J B;  1OWA A;  3H1L E;  2XKM A;  1Z56 A;  1KIL D;  4RKU J;  4WY4 B;  3UIA A;  3BHX A;  4U7J A;  1SQX E;  2E76 D;  2HPC A;  1VQ9 P;  5AW7 B;  3L73 E;  2WMM A;  2O3J A;  1HGV A;  1BCC D;  3KZI H;  2Q3I A;  2KIK A;  2V7Q J;  5AW6 B;  3ITK A;  2K1A A;  2AXT E;  4H44 D;  3M9B A;  1NTK K;  4AUW A;  3CWB J;  1BE3 J;  1SQQ E;  1DD3 A;  3RBX A;  2B4J C;  5AVY B;  4I1L A;  2XEJ A;  1SQV D;  3CI9 A;  1PPJ D;  4P4D A;  1BDD A;  4NGP A;  3H1K G;  1H0T A;  2AEM A;  5KTB A;  1SFC C;  5B5E E;  4BPW B;  1AVO A;  4EDF A;  1QX8 A;  4IFD K;  3V2N A;  3C8V A;  1OMI A;  5KLI C;  3RBU A;  3RGU A;  4XFJ A;  1MKM A;  2P1J A;  2KP8 A;  5B66 H;  3CX5 I;  3VRR A;  1FE6 A;  3VRN A;  3HUS B;  1X0T A;  4OVN F;  2UV8 G;  2K9J B;  1RF1 A;  5KJ7 A;  1SFC D;  3G4S P;  4WY4 D;  4HB1 A;  2XPP A;  2CBL A;  4DJG A;  5E79 E;  5APW A;  1YHQ P;  1YTZ T;  2GUS A;  2YKO A;  2KLV A;  2WSC H;  1JMB A;  1HWT C;  1DX7 A;  1FC2 C;  3Q3D A;  4NPE A;  2HG5 D;  3CCR P;  1T2K D;  5KAI E;  1VQL P;  3EWK A;  3S4R A;  1KYO E;  2NPS C;  1OW7 A;  2XEF A;  1NU1 D;  4N6J A;  5KLV D;  2C0X A;  1SQB G;  3CWB E;  1QGK B;  1KD1 Q;  4MCQ A;  1NVO A;  3L74 J;  1VPC A;  3L71 G;  1JMM A;  2I8D A;  2Q9I A;  4LGD E;  4WWI A;  1OVV A;  2CPS A;  3EQ2 A;  2D2C C;  5AW1 B;  2OYH B;  2QRX A;  1MFZ A;  2KXP B;  1GW3 A;  2FBW C;  1S72 P;  2PVV A;  2XV5 A;  1JCD A;  4W80 A;  3CX5 E;  4NGN A;  4WY4 A;  2JBK A;  3CCE P;  3VTP C;  2B88 A;  2XEI A;  3H1I D;  1LTT C;  5ELY A;  1L0N E;  2WPR A;  5BY0 A;  1FZA A;  3Q1M A;  2Y9Y A;  1KMI Z;  2CPB A;  1IFJ A;  5AW2 B;  4I7Z B;  1QVG O;  2P2U A;  2P7J A;  2QJY B;  3MIW A;  4GIF A;  2Q3E A;  1Q7Y Q;  1RQU A;  1LTB C;  4RES B;  2YXR B;  1USD A;  1AVY A;  1T3J A;  1IZN B;  3Q5S A;  1JY3 N;  2B87 B;  5CMZ A;  4LC1 A;  1JTH B;  1EQ7 A;  2OTK E;  3SFD C;  4D6T G;  3ZDM A;  1USE A;  2WSC J;  2YIU B;  2XNX A;  3PLN A;  2N3A B;  1SQV J;  2M3E A;  1H89 A;  1AV1 A;  2I1J A;  3AE7 C;  2ITA A;  2YNY A;  3H1J E;  1NTM J;  1LT9 B;  3PRJ A;  4NGQ A;  3RK2 B;  1L4A C;  2JR8 A;  3H1I J;  3LW5 J;  1YVH A;  1NTK D;  2C6P A;  3L70 E;  1SQB E;  4L76 A;  4YXD C;  2V4H A;  2QE7 H;  4OWF A;  1BCC J;  4PD4 D;  2FY8 A;  2KS1 B;  1S4X A;  1VQO P;  2E75 C;  3BUM B;  1OZH A;  5CBO A;  3L74 D;  1JY3 P;  2KLU A;  3AE3 C;  2HR3 A;  2J58 A;  2PGD A;  2IBZ D;  1GL2 C;  1SQB J;  1DEE G;  2FYU J;  3RL0 B;  3EFF K;  3F89 A;  1LWU C;  1S5L H;  3PJS K;  5APQ A;  3T97 A;  1NU1 E;  1L0N D;  3H1J J;  2O1K A;  1NH4 A;  1RF0 C;  4UB8 E;  5GTH H;  2WSF J;  1AQT A;  1FZC C;  3CXH D;  1ZW0 A;  2N1T C;  1ZP0 C;  3GG2 A;  3MZW B;  3H1K E;  2H7H A;  1VQ6 P;  5AVS B;  1UIX A;  1PGQ A;  4ZNC A;  5H2F E;  3FEE A;  1KZU B;  4MN4 C;  2FYZ A;  1YJ9 P;  4H0L D;  3GHG B;  3RK2 D;  3A7O A;  5AW0 B;  1NTK E;  1KN7 A;  1P84 H;  3BRV B;  1QEX A;  1L0L E;  2IBZ E;  2WIT A;  5AVU B;  2R5B A;  3HE5 A;  3M0D A;  1L0N J;  3H1J D;  1T6A A;  1KYO D;  2BCC G;  5AVZ B;  5GTI H;  3H1K J;  4MCR A;  1RQV A;  1IFD A;  3SJG A;  3KHU A;  3CC7 P;  4K3A A;  2N1T A;  2C9L Y;  1N7L A;  3WUT A;  5KAF H;  4PD4 E;  2KZJ A;  1GDT A;  5M1B A;  2L5G B;  3U59 A;  1NHL A;  1ZR4 A;  1L0L J;  3VP8 A;  2KOG A;  1S5L X;  3VRP A;  1N73 B;  3PT1 A;  2J5U A;  2ZVO B;  2WTY A;  5APX A;  2G8Y A;  1R5S A;  3L73 J;  1GL2 A;  1L4A B;  1LTJ A;  1FAV A;  3HE4 A;  2K3R A;  4YTP C;  3CX5 D;  1X79 B;  3PFV A;  1HGZ A;  1U7M A;  1J1D C;  2RH0 A;  1SQQ D;  3HPG G;  3H1L J;  3CPW O;  3CMA P;  1FOS E;  3P8M C;  3O6Q B;  2OYI A;  3KXD A;  2XEG A;  4IL6 H;  3P8C D;  1SFC A;  4BPX B;  1PP9 J;  2OQQ A;  4W9Y A;  1Q90 D;  3C9I A;  1VQ5 P;  3L74 G;  2XDJ A;  1YYC A;  4UB6 H;  1N8R Q;  1AJY A;  4OC3 A;  4UB8 H;  1KIL C;  3V2Q A;  1QL2 A;  4NGS A;  2Y0C A;  1ZN5 A;  1SS1 A;  2FFD B;  4NPD A;  2M5A A;  3H1L D;  3V2P A;  2XPO A;  1SQQ J;  2B87 A;  1VDF A;  2W83 C;  4C7N A;  2FXP A;  4P4J A;  2FYU E;  2NZ2 A;  1A02 J;  1LNQ A;  1WRG A;  5F13 A;  1OVR A;  2KB7 P;  4PV1 D;  1M90 Q;  4OH8 B;  1NOH A;  2M0B A;  5APY A;  1L0N G;  1X8Y A;  4KHX A;  1NTZ K;  4L74 A;  1HBW A;  3S9M A;  1URQ C;  1VF5 B;  4P4B A;  1M1K Q;  1ZME C;  1JUN A;  2N9Y B;  1GU4 A;  1L4A D;  3D7H A;  2RKL A;  1IFP A;  1KQL A;  3L75 J;  2XPL A;  1BGY G;  1DE4 C;  2BAS A;  1NTZ D;  4OC0 A;  1M57 D;  1M7L A;  3AEE C;  3H1H G;  2M8R A;  4QMA A;  3RL0 g;  3BUN B;  1AFO A;  5AVV B;  1SQP E;  1G2C B;  1PIX A;  1IJD B;  1R5L A;  1G1J A;  2R3S A;  3L72 G;  2KZI A;  2JEE A;  1IK7 A;  5B66 E; 
#chains in the Genus database with same CATH homology
 4DOJ A;  1JY2 P;  1IFI A;  3P32 A;  4N6J A;  2WSE H;  2C0X A;  1LT9 A;  2C9N Y;  4WBA A;  5BVZ A;  2NPS B;  1VPC A;  1FZB A;  1QL1 A;  1JMM A;  2HOD A;  2Q9I A;  1GK6 A;  1N7S A;  2NPS A;  4LGD E;  4WY4 C;  4IFM A;  3BRT B;  2FKW B;  2CPS A;  1YTZ I;  1JY3 O;  2YO2 A;  3EQ2 A;  1GZL A;  5AW4 B;  2PAJ A;  3RK3 C;  5AW1 B;  1H88 A;  2OYH B;  4I2L C;  3VMZ A;  3TYY A;  5APU A;  1T8Z A;  1HVV A;  1N86 A;  2YKQ A;  1A02 F;  1MFZ A;  2WT7 A;  1GW3 A;  3M91 A;  1LTJ B;  2OYH C;  3L36 A;  1L4A A;  1J1D B;  1JCD A;  2XV5 A;  4W80 A;  1N2D C;  4XE5 B;  4WY4 A;  2H8P D;  1GW4 A;  3VTP C;  2YKP A;  3NFQ A;  2IX7 C;  3LID A;  1LTT C;  3VYI A;  5BU5 A;  2WPS A;  2HFE D;  1N7S B;  5APT A;  2WPR A;  2C0W A;  1AQ5 A;  4JYC A;  3TNU A;  1FZA A;  2OYH A;  1CSB A;  1XTC C;  3EFG A;  2CPB A;  1IFJ A;  5AW2 B;  2PP6 A;  5APS A;  4DZO A;  3MD0 A;  3KYQ A;  2P2U A;  2P7J A;  3A2A A;  3HD7 D;  3RK3 D;  3KQG A;  3MIW A;  4GIF A;  3NXS A;  1SQV K;  1LTB C;  3M06 A;  4RES B;  2Z4E A;  3U88 C;  2I1K A;  3MTU E;  4GKG A;  1KIL B;  1T3J A;  1FZG A;  4M3L A;  1MUU A;  1JY3 N;  2E42 A;  5CMZ A;  4LC1 A;  5CCG D;  1JTH B;  2FFD A;  1EQ7 A;  3PP5 A;  3CL3 D;  4XA4 A;  3V4W A;  1RF1 B;  2P67 A;  2XNX A;  3OJA B;  1GU5 A;  1RE3 A;  2GM4 A;  2MJZ A;  4EOT A;  1LTA C;  1SQQ K;  2N3A B;  1L0L K;  1H89 A;  1M1J B;  2I1J A;  3KDP B;  2YNY A;  1CI6 B;  1IFN A;  3HUS C;  3HD7 C;  1LT9 B;  4AYC A;  2NPS D;  3RK2 B;  1L4A C;  3LIE A;  3GHG A;  5AVW B;  3MGN A;  3KPE A;  3HUS A;  3I5C A;  3O8Z A;  3H32 A;  2FFD C;  1IC2 A;  5CCG C;  3NMD A;  1LT9 C;  3HRN A;  3VP9 A;  2YO3 A;  5CCH C;  4I6M C;  1LTS C;  3GHG C;  5KJ7 D;  3HTK B;  2HYN A;  3U1C A;  3V4Q A;  1SVF A;  2J59 M;  5AW3 B;  4WB4 A;  4ZKU A;  4C7R A;  2Q7C A;  1JOC A;  3M0A A;  3BVH A;  1FZE A;  1URQ B;  5AVX B;  3P7K A;  1JY3 P;  1NAF A;  3G3Z A;  3HPH E;  5AW8 B;  1LGH B;  1E5W A;  1FU1 A;  3RL0 C;  2R3C A;  1JCC A;  1IK9 A;  2J58 A;  1KIL A;  3B8E B;  2ZFC A;  4EIJ A;  3IFM A;  1GL2 C;  2OYI B;  1FDM A;  1ZV8 A;  3RL0 B;  1RE4 C;  1SQP K;  4C46 A;  2Q5U A;  1WT6 A;  5CCH A;  1LWU C;  3H32 B;  5AW5 B;  1DEB A;  2W27 A;  5CCH D;  5APQ A;  1MZ9 A;  1FZC B;  3T97 A;  1KFM A;  2O1K A;  4HYT B;  1FZF A;  1NH4 A;  1XTG B;  2A45 H;  5CCG A;  1RF0 C;  1URQ A;  1OXZ A;  2POH A;  1SQX K;  1S9K E;  1FZC C;  3V5B A;  1HJB A;  2N1T C;  2E43 A;  2KSJ A;  3L37 A;  2XPN A;  2R5D A;  3TK1 A;  1W2E A;  1L0N K;  1FOS F;  3OA7 A;  2H7H A;  2A45 I;  3B5N D;  2N1T B;  1FJP A;  5AVS B;  2M3B A;  4N78 D;  3HE4 B;  3L35 A;  4AQR D;  1T3U A;  3VOP A;  2O1J A;  1J1E C;  1KZU B;  4ZKP A;  2FYZ A;  3GHG B;  3RK2 D;  3A7O A;  2XU6 A;  1RY3 A;  3NTN A;  3VMX A;  2W6A A;  3R2P A;  5AW0 B;  3BRV B;  3B5N B;  3TNU B;  2WIT A;  5AVU B;  1GL2 D;  2R5B A;  3U1A A;  2Z5H A;  3HE5 A;  3M0D A;  4HH2 A;  1MV8 A;  1N7S C;  3IR9 A;  1ZLL A;  1HUC A;  2N9B A;  5AVZ B;  1KFN A;  1CZQ A;  1GTW A;  2H43 A;  2GUV A;  1IFD A;  1LWU A;  1GK4 A;  1FJK A;  4W7Y A;  2N1T A;  4N3Y B;  5APV A;  2C9L Y;  1GL2 B;  1URQ D;  3M0D C;  3M9H A;  2YMY A;  3VMY A;  3A3Y B;  2W6B A;  1RF0 A;  1N7L A;  5KJ7 C;  1PFI A;  1JO5 A;  1LWU B;  2WZ7 A;  4Y99 B;  1GDT A;  3RK2 C;  3M9Q A;  2L5G B;  1H8A A;  3U59 A;  1SLQ A;  3B5N A;  1N73 C;  1NHL A;  1ZR4 A;  3L4F A;  3H6P A;  1G1I A;  2Z5I A;  3VP8 A;  2WSF H;  1SQB K;  3E1I A;  2KOG A;  1LTI C;  1NKZ B;  2OAR A;  2QM8 A;  3BAS A;  1RF1 C;  1N73 B;  5KLV K;  2HLO A;  1NO4 A;  1M1J C;  3OAK A;  1J2J B;  2IPP A;  1G2C A;  2WTY A;  5APX A;  1OWA A;  2XKM A;  1Z56 A;  4LLH A;  3V2R A;  1JNM A;  1IO4 A;  1KIL D;  3UIA A;  4WY4 B;  1GL2 A;  1L4A B;  1FBM A;  2R32 A;  1LTJ A;  1FAV A;  3RL0 D;  2FYU K;  3BAT A;  3HE4 A;  2WT7 B;  1EO0 A;  1X79 B;  3SWY A;  4IFF A;  5BU8 B;  2IFN A;  1LTG C;  4B86 A;  2HPC A;  5CJ4 A;  5AW7 B;  1HGZ A;  1J1D C;  3HE5 B;  5AW9 B;  3HPG G;  1Z9E A;  2O01 H;  2HOD B;  1HGV A;  3VN0 A;  1JY2 N;  4W7Z A;  1HTL C;  2Q3I A;  1FOS E;  3P8M C;  5AW6 B;  2OYI A;  1FZC A;  3HD7 A;  3TSI A;  3M9B A;  3P8C D;  1SFC A;  3N4X A;  1CW5 A;  1NTK K;  1X9V A;  1S9K D;  4AUW A;  2JJL A;  3C9I A;  5CHX A;  1ZR2 A;  2VRS A;  1CI6 A;  2B4J C;  5AVY B;  2XDJ A;  3WMM 0;  4Y99 C;  4I1L A;  1YYC A;  2XZR A;  2OYI C;  3CI9 A;  3CLQ A;  2IFM A;  2KYV A;  2HPC B;  1KIL C;  3V2Q A;  1QL2 A;  1NTM K;  4JF7 A;  3F9K C;  1ZN5 A;  2LKM A;  5KTB A;  1NWQ A;  1SFC C;  3RK3 B;  3A5T A;  2FFD B;  3V2P A;  2XPO A;  4IFD K;  1VDF A;  5AVT B;  3V2N A;  4C7N A;  3HTK A;  1SFC B;  1T2K C;  1DH3 A;  1N7S D;  2A45 G;  1WJT A;  1LTJ C;  1A02 J;  2P1J A;  1WRG A;  3MUD A;  2KP8 A;  3II6 A;  2FXM A;  2WPQ A;  2KB7 P;  4OH8 B;  1RE4 A;  1M1J A;  3HUS B;  1NOH A;  4C7N B;  5APY A;  3HD7 B;  1X8Y A;  4KHX A;  1NTZ K;  1HBW A;  1J1E B;  1URQ C;  4JYB A;  5AVR B;  2WWW A;  1RF1 A;  1JUN A;  5KJ7 A;  5CJ0 A;  1SFC D;  1GU4 A;  4WY4 D;  2XPP A;  1NKN A;  1L4A D;  4O9B A;  2QM7 A;  5APW A;  1YTZ T;  1JY2 O;  3LW5 H;  4GT1 A;  2ZXE B;  2GUS A;  4N78 E;  2YKO A;  3P8C E;  1KQL A;  2KLV A;  3B5N C;  2XPL A;  5AVQ B;  1IFM A;  2BAS A;  2WSC H;  1NU1 K;  1HWT C;  1DX7 A;  1M7L A;  1HH0 A;  2N1T D;  1GD2 E;  2M8R A;  1AFO A;  5AVV B;  1JTH A;  1G2C B;  2HG5 D;  1RE3 C;  1T2K D;  1IJD B;  1G1J A;  3SWF A;  3N7N A;  1SP4 A;  2JEE A;  2NPS C;  1N73 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...