3NFQA

Crystal structure of the conserved central domain of yeast spn1/iws1
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
147
structure length
147
Chain Sequence
DDLEQYLDEKILRLKDEMNIAAQLDIDTLNKRIETGDTSLIAMQKVKLLPKVVSVLSKANLADTILDNNLLQSVRIWLEPLPDGSLPSFEIQKSLFAALNDLPVKTEHLKESGLGRVVIFYTKSKRVEAQLARLAEKLIAEWTRPII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcription factor IWS1
publication title The Transcription Factor Spn1 Regulates Gene Expression via a Highly Conserved Novel Structural Motif.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 51
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3nfqA01
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 3nfqA02
2QM7A 2H7HA 2Z5HA 5AVTB 5AW9B 1DH3A 3L37A 4C7NB 1S9KD 5AW4B 4RESB 3TNUB 3A2AA 1SP4A 3HE5A 4EOTA 2VRSA 5APTA 1KQLA 4AQRD 1GU5A 3B8EB 1T2KD 3KDPB 5AW1B 4XE5B 1HWTC 2WPSA 3V4WA 5APWA 1H88A 3KQGA 5AW3B 1FOSE 3HPGG 2IPPA 1Z9EA 3VN0A 3VMXA 2Q5UA 3OAKA 2C9NY 2YNYA 2Q7CA 1CSBA 1IO4A 1GU4A 2C9LY 5AVYB 2W6AA 3T97A 2XPLA 1HBWA 5AW2B 4LC1A 2R5BA 2WTYA 3M0AA 2XU6A 1HJBA 1CZQA 2KP8A 3VMYA 5AVZB 2XPNA 5AVUB 1MUUA 3P7KA 3A3YB 1OXZA 4AYCA 1JUNA 1EO0A 3NFQA 4KHXA 3HE4A 5APQA 2JJLA 5AVRB 1H89A 3HPHE 3M9BA 3P8MC 2XPOA 3V5BA 1GTWA 2WT7B 1MV8A 3M06A 2YO2A 3LIEA 3MD0A 3L36A 1G2CB 5AVVB 1HUCA 5AW7B 2P67A 3A7OA 3HE4B 3V4QA 5AW0B 3NXSA 3I5CA 4I6MC 3TK1A 3O8ZA 4B86A 1GD2E 3UIAA 2WT7A 3VYIA 2YO3A 1T2KC 1WJTA 2E42A 2XZRA 5APVA 1MFZA 4JYCA 2R32A 5APYA 4GT1A 1FAVA 5AVXB 1S9KE 4M3LA 3HTKA 1NAFA 4C46A 1GK4A 2P7JA 2WWWA 5AVWB 2XPPA 5CMZA 2Z5IA 3F9KC 4JYBA 2N3AB 2WPRA 3LIDA 5AW8B 5APSA 1A02F 5AW5B 4I2LC 2P2UA 1J2JB 3M91A 1CI6A 2QM8A 1OWAA 1JNMA 3P32A 2ZXEB 4AUWA 5AW6B 1NWQA 3NTNA 3M0DA 3SWFA 1X8YA 5APXA 1YYCA 2W27A 3VTPC 3U88C 3M9HA 3TYYA 1CI6B 3MGNA 4HYTB 3NMDA 3A5TA 4DZOA 2E43A 5APUA 3IR9A 2B4JC 2XV5A 1H8AA 1GZLA 2R3CA 1FOSF 1SLQA 5AVQB 4C7NA 2WPQA 3TNUA 2R5DA 3VMZA 1GK6A 2ZFCA 3HE5B 4GKGA 2Q3IA 1A02J 2BASA 2N9BA 3L35A 5AVSB
chains in the Genus database with same CATH superfamily
2G3AA 3A0HH 2LXBA 2A06G 1SQXD 4EIJA 4PV1C 2YXRB 1RF1A 3U59A 2CPBA 5AW3B 3AEBC 1YTZT 2R3SA 1PP9E 1MUUA 3CXHE 4GODA 4WY4C 2K3RA 3H1IJ 3H1JE 2IYPA 2O01J 1JMBA 1GL2D 2HPCA 5H2FH 2FXOA 5CCGA 1ZN5A 1ZW0A 3V4QA 1BGYD 3O8ZA 3BRTB 2WT7A 3VYIA 1ZRTE 1U7MA 3CX5I 1MFZA 3GLMA 4OC0A 3TGUG 1T3UA 1G2CA 2AXTE 3HTKA 3MHVA 5CCHC 3FF3A 1SQBJ 3L71G 2WPRA 3LIDA 2IBZE 1NTZG 4IFMA 4N78E 5AW5B 1YJ9P 1JY3N 4JQ0D 3L70D 2I1KA 1IK9A 1HVVA 1VF5B 2OYHB 1H0TB 3H1LG 4OC4A 1GZLA 2OTLP 1OVUA 1Z56A 4UB8E 5KLIC 4RR2B 1QVGO 1ZV8A 2RH0A 2PGDA 2C6PA 1DD3A 2E5YA 3B5NA 3ITKA 1KMIZ 4CPGA 2H8PD 3BUMB 1JCDA 3B8EB 4JZ0A 3KDPB 2RKLA 1L0LK 1E5WA 1BCCG 4BRYA 3H1HJ 3WMM0 2PVVA 4X3RA 3RK3D 1RF1C 4P4BA 1ZR2A 3RK2C 1HJBA 1IJDB 4WY4B 2HFED 2FYZA 3PTZA 3PFVA 1VPCA 3KZIE 3LW5H 4NPFX 4IL6H 3F89A 1SQQK 1CW5A 2P67A 4OWFA 1AVOA 2D2CD 1FJKA 4DJGA 2C0XA 3CI9A 5APYA 4GPLB 1S9KE 4M3LA 2KNCB 1HH0A 1LJ2A 2XEJA 3L74J 5CCGC 5AVWB 2N3AB 4P4EA 1LT9B 1WT6A 1NTME 1J2JB 3VROA 1OWAA 1BE3E 2KZJA 3H32A 3AE6C 1AV1A 3CPWO 3MGNA 2JWDA 1RQUA 4HJGH 1NJIQ 1PGQA 3Q1MA 4PD4D 5KLIB 1Q81Q 1Z8LA 1XTCC 3CL3D 4D6TG 2BEZF 3BATA 1A02J 1VQLP 2JBJA 1IFNA 4NPDA 5AW9B 4RESB 2O01N 1YIJP 1G1IA 2WSFJ 2ZVOB 4H0LC 1PPJE 4IFFA 3T97B 2VRSA 3R4YA 3BCCJ 4O9BA 4XE5B 2HR3A 4BPUB 3KQGA 2IPPA 1SQXG 3MZWB 1IO4A 3M9QA 2PRRA 1YHQP 1L0LG 5HKZA 3RK2B 4L73A 1PFIA 3B5NC 4LC1A 4U7JA 3L4FA 4PJ0H 2UV8G 1PIXA 3IFMA 1TU3F 3HPHE 3MUDC 4Z1MH 4K35A 3G71P 5TISE 1E79H 5KJ7A 3H1KD 1W2BO 3AEGC 2DW3A 3OP0A 1M90Q 3NXSA 1SQQG 1NGMB 1KB9D 1VF5D 2YO3A 4XFJA 3PHLA 2HPCB 3CCEP 5APVA 2WSSH 1S72P 3G9RA 4OMEA 1T6AA 3AE2C 1GK4A 1NVOA 1BGYG 3L75J 4W9YA 3CCLP 4PV1D 2KLVA 2OYIC 3CX5H 1K9MQ 5KAIH 4JPZB 3ZNIA 2W90A 1PP9D 5E79H 3CXHD 2FFDA 2XEGA 1VQ9P 3KASA 3NMDA 2FYUJ 3H1JD 2E43A 1KYOI 1FZCC 3L70G 4NGQA 1FZGA 2NPSA 1KB9E 3CWBE 1LTSC 4WY4D 1M1KQ 1ZRTD 4YXDC 3V2NA 1S4XA 5AW4B 4H0LB 4ASWA 1JY3O 3V2QA 4U3FJ 2IBZD 2R44A 3RL0g 4OC1A 1YVHA 3OAKA 1CSBA 1FZEA 3B5NB 5CCHD 5DJUB 2O1JA 5L8RJ 2XU6A 3RL0C 3AE9C 5AVZB 5AVUB 3P7KA 4AYCA 3C1LA 2K9JB 4KHXA 3H1IE 1VQNP 3M9BA 1PL5A 2C6GA 5AW7B 1AFOA 1SS1A 1S3JA 4IL6E 3GG2A 1T2KC 1WJTA 3S9LA 4YTPC 3VRNA 5CHXA 3IN6A 1NH4A 5KJ7C 1RH5B 1SQBE 3JCUH 4JYBA 5ELYA 1VQPP 1EDIA 2QM8A 3M91A 2OYIB 4P4IA 4RKUJ 3L71J 2PAJA 1NWQA 1RF0A 3M9HA 1NTZJ 2BCCE 3WU2H 3BUXB 1FZCB 1LP1B 1VQ6P 1USDA 4ZKPA 2AEJA 2KXPB 3RK2D 3H32B 1VQ8P 2Q6QA 1KZUB 1LTTC 3BI0A 1S2EA 1NU1J 3H1LD 1Q2NA 2IDBA 3AEDC 1H0TA 2AEFA 3RGUA 2FKWB 3F5HA 2ITAA 1FBVA 1OIPA 1JCCA 3S9OA 1S9KD 3RBXA 4NPEA 4UB8H 4EOTA 2NPSC 2W8ZA 3CD6P 3AEFC 4IFDK 1JOCA 1MKMA 1VL2A 3CC4P 2AXCA 1NTMD 2M0BA 3H1HE 1BE3D 3D7FA 2KK7A 4H44C 2XPLA 2DLAA 2BEQD 5CCGD 1K8AQ 4OGQC 1LTAC 1J1EB 2WQYC 3L73J 4MCRA 1BCCJ 2KIKA 1L0NJ 1B47A 3D70A 2IX7C 2OTKE 2PVWA 2RMZA 3LIEA 3MD0A 1HTLC 4R4LA 3EFFK 4LQGA 2JWAA 4WY4A 2I1JA 3B4SA 5HKWA 2PP6A 3KZIH 1LTGC 2N9YB 2FXMA 3CMAP 2ZYAA 2W83C 1PPJD 2QJYC 1A02F 5GTIE 2K88A 2KNCA 4H0LD 1K73Q 1SQPJ 2H89C 1RE3A 1YYCA 1NTKJ 2IFMA 1LT9A 3CX5E 1N7SA 1OFCX 5KAIE 4DZOA 1IFJA 1QGKB 1YQ4C 2OQQA 3B5ND 2XV5A 1Q90D 3AE3C 2WITA 1RF0C 2QA4P 1PP9G 3CC7P 4DOJA 3USSA 3ZDMA 2BASA 2P7JA 2JR8A 3H1JG 1YI2P 2SPZA 2OYOA 3GMAA 1QX8A 1S5LH 3Q5PA 1LT1A 1Y47A 2NPSB 1EDKA 2KUBA 3VOPA 4UB6E 1KYOH 3BCCE 5GTHE 3CCJP 1OZHA 4OC3A 2B88A 3T97A 5BY0A 1OW8A 1DD4A 2KP8A 2IBZG 3AEEC 1L2PA 1H89A 1L0LD 2XPOA 4ZKUA 1N7LA 3M06A 2E76B 3CWBD 4B86A 3D6YA 2E42A 2L5GB 1LTBC 1G1JA 4WBAA 5TISH 1SQQD 1SVFA 4NGNA 3FEDA 1NYHA 1X9VA 2QJYB 1L0NK 3AECC 2WSCH 3FWLA 4P44A 1HJ0A 4I2LC 1QLED 1J1DC 1HGVA 3JCUE 2K37A 3O6QA 3NTNA 1IK7A 3M0DA 1KFMA 3GF3A 1EZVE 2FYUE 4HYTB 3WU2E 2QE7H 3RL0D 2WPQA 1OW7A 2R5DA 3E1RA 1RE3C 3FGAD 4I1LA 3I56P 4YPCA 1LT9C 1N86A 4OH8B 1N7SC 2A45H 3L70J 3FWNA 1SQBD 4A4BA 4U3FE 5KLVK 1T2KD 1BDDA 1JM0A 1OVRA 4K3AA 1URQA 3G3ZA 1VQOP 5KJ7D 1FDIA 4YXWH 1QL1A 5AW2B 5M1BA 1ZMEC 2BCCD 2ZVNB 1NTMG 2M5AB 2JJLA 1KQFB 1KD1Q 1BE3G 4L74A 1R5LA 2K9JA 3MUDA 2GUVA 4OC2A 4H13B 1NOHA 3UIAA 2O01H 2R32A 2GUSA 3OA7A 4HKZH 2MJZA 3QWOC 2Z4EA 3BXMA 2Q1KA 1J1DB 1OMIA 3S1KA 1P84I 3TSIA 3U1AA 3CXHI 1LWUC 1EQ7A 3N7NA 2NPSD 1PPJG 2OR4A 2C0WA 2OYIA 4BPWB 4H44D 4OGQD 3PT1A 4C7NA 3H25A 2J59M 1USEA 3M0DC 1NU1E 3SSUA 1FZCA 1N7SB 3L35A 2V7QJ 1LP1A 1DH3A 2FY8A 1SQVJ 1KILA 2IBZI 2GM4A 1VDFA 2XNDH 5D29A 2IZ0A 3V2PA 1S5LE 1M7LA 1SQBK 3VN0A 1KYOE 3SFDC 2KI7B 3L72J 2R5BA 3L73E 1CZQA 1JUNA 1L0NE 3CX5D 2XEIA 3FXEA 1URQC 4A4CA 2E74B 4P4JA 1PV3A 2YIUC 5AVVB 3RBUA 1IFPA 5B66H 2A45G 1JY2N 1EXJA 3JSVC 4JYCA 5K5GB 1NAFA 3CWBG 3BCCD 3PJSK 1JY3P 1LWUB 3H1KJ 2KYVA 1SQPE 1NTKE 3HRNA 1ZR4A 2JDIH 1D7MA 5KLVE 1PGOA 5GTIH 3R2PA 4MN4C 1BSNA 3O6QB 2H43A 3TNUA 2Y1MA 3WUUA 3H1IG 4JF7A 2Q3IA 1N73A 5CJ0A 1U7JA 3L37A 3S9MA 3Q5SA 3H1JJ 3AE1C 4BTFA 3HPGG 2Q7CA 1SFCC 2WSFH 1WRGA 1KILC 1RHZB 1SQBG 2KLUA 4UB6H 1JMMA 2XPNA 2LXCB 5GTHH 1EZVD 3HE4A 5AVRB 1URQB 1SQVK 4DCKA 1KILE 2QG4A 3CMEP 2YIUB 1PGPA 3WUVA 4N78D 2BCCG 4GDOA 4I6MC 1LNQA 2N1TA 4NGRA 3EQ2A 3EWKA 2YMKA 1OW6A 4GT1A 1J1EC 2Y1NA 1BDCA 4U3FD 3P8CE 3AEAC 1N7SD 2Q9IA 3FX0A 3GHGC 3IWWA 4Y99B 1YQ3C 2P58A 3ABVC 4OC5A 5APXA 3C9IA 2J58A 2L91A 3Q3DA 3H1HG 2Y0DA 3TGUJ 1L4AB 2O3JA 1GK6A 3E1IA 5KKZC 2HG5D 3VP8A 2AEMA 1Q86Q 4C7NB 1NHLA 5AXIA 2JEEA 1M57D 1RY3A 3K5BA 2OGUA 1IFIA 1LGHB 5CJ4A 3D7DA 2Q3EA 3Q5RA 5AW1B 1N73C 1HWTC 2IZ1A 1SFCB 2WZ7A 1KILB 2C9NY 1ZOYC 4N3YB 2YKPA 2WSEJ 1HBWA 2WVRA 3H1LJ 1QVFO 1GW3A 2ZT9C 2W6BA 2HODA 2QJPC 3V5BA 2QEXP 1MV8A 2FYUK 3C8VA 3D7GA 2LR2A 2M3EA 3A7OA 2M5AA 1QEXA 3I5CA 1BE3J 3AE5C 1Q7YQ 4XA4A 1KQGB 1FAVA 3EFGA 2KSEA 5B66E 3HMJG 2N1TC 3GHGB 4A7PA 1KYOD 2W6JH 4MCSA 3OB2B 2YKQA 3P32A 2E76C 3L73D 3BCCG 1L0ND 5BVZA 4GIFA 2Y0EA 4ZNCA 3L74E 2QVAA 1JY2O 1X0TA 2B4JC 2K1AA 4NGMA 1NKNA 3GW6A 2P10A 4BPXB 4ASVA 5KKZB 1X22A 5CBNA 2KSJA 1ZXGA 2H7HA 1URQD 1SQVE 1KN7A 4NGTA 3TNUB 1UIXA 5DJTB 1N73B 1IFMA 1KQLA 2P1JA 3V4WA 3CCVP 1FDMA 1Z9EA 4EDFA 1SQPD 3KXDA 2XEFA 1EXIA 3L72E 3QH9A 2KOGA 1NTKD 4WVZA 2ZT9B 1VQMP 4D6TJ 2QJPB 5KLVD 2YKOA 4MCPA 1JTHB 2ZYDA 2HYNA 1IZNB 1NTZK 1GTWA 2FYNC 3HE4B 1VQ4P 1EZVG 2FYUG 5AW0B 1GD2E 4I7ZC 1Y9BA 1YBKA 4IL6X 1GDTA 4BXLA 2D2CB 5F09A 1NU1K 3BUOB 2M3BA 1M1JC 2NZ2A 3AE7C 5B5EE 1SQXJ 1KC8Q 1L0LJ 2N1TB 3BVHA 3H1KE 1N2DC 2ZJSE 3PH0A 1CI6A 2POHA 4U3FG 3S9NA 4EI2A 2W27A 3GF7A 4H13C 1GW4A 1LWUA 2OTJP 1SFCD 1SQQJ 1FZBA 1KILD 3L75E 3W68A 1H8AA 3OJAB 3CCSP 1JEKA 3VMZA 3HD7A 1FU1A 3KYQA 4BWNA 4GKGA 1ZP0C 2CPSA 2XDJA 2QM7A 1BGYJ 2J5UA 3RBZA 1R5SA 2Z5HA 1P84E 3CCMP 1FBMA 1WMKA 3A2AA 3H1ID 4PD4I 3SJXA 3A0BH 3P8CD 1OX3A 2K9YA 3PP5A 1GU5A 3CLQA 1H88A 2IYOA 1HGZA 2YNYA 3D6ZA 3LW5J 2YXQB 2WTYA 2V4HA 1SQPK 2G8YA 3A3YB 1OXZA 5APQA 2Y9ZA 3SJFA 1NTKK 3E7KA 3N4XA 2FYNB 2MKVA 2A06E 1LTIC 4C7RA 4I7ZB 1YJNP 3MP7B 1OVVA 2HODB 3CC2P 4OVNF 4KT0J 1M1JB 3FECA 2WMMA 2BCCJ 1DIPA 1NU1G 5CMZA 3VRQA 1YTZI 5AW8B 1KB9I 5TJHA 3CCRP 1JNMA 2E74C 2ZXEB 2OOTA 5AW6B 3SJEA 4PV1B 2CIJA 4W7YA 1W5CE 1HF9A 3KPEA 1LTJC 1VQ7P 1AQTA 1SQXK 3TGUE 3L73G 2B87B 2ZFCA 1L0NG 3HE5B 2ZT9D 3H1HD 1KORA 3L71E 2E75C 4NGSA 5AVTB 1NTZE 4KJMA 1L4AA 3MTUE 4GOEA 1SP4A 3U1CA 3HD7C 5APTA 4R4MA 3HUSA 2WPSA 2CK3H 1T3JA 1YITP 2I8DA 3G6EP 2C9LY 2W6AA 1EZVI 3H1LE 2N1TD 3D7HA 1AA0A 1U57A 1SFCA 5KAFH 1XTGB 1R8EA 2M8RA 3TF5A 3L74D 1SQPG 1KTMA 2E76D 1NTKG 2FXPA 5HKYA 5KLVG 3TK1A 2KS1A 4NGPA 2PFXA 5CBOA 3I55P 2KZIA 4HB1A 1SQVD 1M56D 1BCCE 3SWYA 5AVXB 1GL2A 2KB7P 2C6CA 1FDOA 1X79B 1MFTA 3PLNA 3IF4A 3L72D 5EFWB 1DX7A 4AUWA 1EC5A 5J3XA 3SWFA 1X8YA 1FZFA 3CCQP 3GHGA 3VTPC 2VKZG 1LTJB 1CI6B 1KV4A 3A5TA 3A0HE 3IR9A 3PRJA 4TT3H 2XNXA 2E75B 4GOFA 1RF1B 1YJWP 1AVYA 4Y99C 1MZ9A 4P4FA 3B71A 2ZXXA 1VQ5P 3HD7B 3TDKA 4MCQA 3W67A 4AQRD 2V7QH 5C39A 2B89A 4HH2A 2Q5UA 3A0BE 3KHUA 3VGOA 1N8RQ 2NRGA 1L4AC 4Y28J 5H2FE 3M0AA 4D6TE 1EO0A 4PD4H 1PP9J 3HUSC 4EYYQ 2LKMA 2O1KA 2WT7B 1IC2A 3L75D 2YO2A 3OB1B 4H13D 2FBWC 3L36A 1G2CB 3HTKB 1JTHA 1GMJA 1P84D 1NO4A 2YMYA 3VRRA 1SQXE 2FYUD 1L0LE 2QSIA 4C46A 2Z5IA 4IOIH 3Q2YA 5APSA 2JO1A 4TLFA 2Y0CA 2WPVB 3MIWA 4RJTA 1GL2C 5B5EH 1VQKP 3U88C 1T8ZA 1SQQE 2IFNA 1M8OB 1AQ5A 1KB9H 3D71A 2A06D 1CX8A 1PZQA 1BGYE 2N9BA 1Y8AA 2UWJE 3VMAA 1IFDA 1W2EA 2Y9YA 4BRYB 3IAOA 2CBLA 1FJPA 1EDLA 2B9BA 2JBKA 3SFEC 1FE6A 3G4SP 1KFNA 1S5LX 1FZAA 1P84H 2QRXA 4JBZA 3CXHH 3V2RA 1GU4A 2QIWA 3L70E 1Q82Q 4ZMDA 3HUSB 4WWIA 1BSHA 3AE8C 1JO5A 3P8MC 2E74D 3SWKA 3FXDA 2ZYGA 3TGUD 4RO0A 5KAFE 1JY2P 1FC2C 3L71D 2AXTH 4P4DA 3L74G 5F13A 3VRPA 2A45I 1NTZD 2XZRA 1PGJA 1DE4C 1DEEG 1RE4A 2KS1B 3RK3C 2E75D 2WWWA 3OW2O 1M1JA 1SQVG 4WB4A 2H88C 2P2UA 2FFDC 1NTMJ 1GL2B 4N6JA 1NU1D 2OYHA 3HD7D 1QL2A 3JC22 3RK3E 3H6PA 4P45A 3TYYA 2QJKC 2D2CC 3L72G 5APUA 3S4RA 2R3CA 1FOSF 1SLQA 5AVQB 1K05A 2E5TA 4LGDE 1AJYA 4L75A 3RL0B 5AVSB 1KQSO 5BU5A 5BU8B 1BCCD 2B87A 1S1CX 3HE5A 2RN0A 3BASA 1NKZB 4PJ0E 1K04A 2JP3A 5APWA 1FOSE 3VMXA 1UIIA 5AVYB 4LLHA 5KTBA 1EDJA 3VMYA 3FEEA 3H1KG 3NFQA 2WSEH 4W7ZA 4PD4E 3WUTA 5CCHA 2GA1A 3SJGA 1HUCA 3V6IA 2WSCJ 4L76A 2JKVA 3VP9A 3L75G 3BHXA 3RK3B 5KLVJ 1DEBA 2HLOA 3PLFB 2XKMA 5E79E 3CCUP 2XPPA 3F9KC 2FFDB 3BRVB 3BUWB 4JYWA 3BI1A 3II6A 1RE4C 2QJKB 4D6TD 1ZLLA 1NAYA 4QMAA 2OARA 1L4AD 1VF5C 3BUNB 2OYHC 1RQVA 4W80A 4DT0A 4H44B 1JB0J 1LTJA 4OGQB 3CWBJ 1FS0E 3AE4C 2ZAEB 1NTMK
chains in the Genus database with same CATH topology
5AVTB 2FKWB 1JCCA 3L37A 1S9KD 4EIJA 1L4AA 3MTUE 1SP4A 3U1CA 1RF1A 4EOTA 3HD7C 2NPSC 5APTA 3U59A 2CPBA 4IFDK 1JOCA 3HUSA 2WPSA 5AW3B 3HPGG 1T3JA 2Q7CA 1SFCC 2WSFH 1WRGA 2C9LY 2W6AA 1KILC 2XPLA 5CCGD 1LTAC 1YTZT 1J1EB 1JMMA 2N1TD 2XPNA 1MUUA 1SFCA 1XTGB 2M8RA 3HE4A 5AVRB 1URQB 2IX7C 4WY4C 1SQVK 1GL2D 2HPCA 3LIEA 3MD0A 1HTLC 4N78D 4WY4A 5CCGA 1ZN5A 3V4QA 2I1JA 4I6MC 3TK1A 3O8ZA 2N1TA 3BRTB 3EQ2A 2WT7A 3VYIA 2PP6A 1MFZA 1LTGC 4GT1A 1T3UA 2FXMA 3SWYA 5AVXB 1G2CA 1J1EC 1GL2A 2KB7P 3HTKA 5CCHC 3P8CE 1X79B 1N7SD 2WPRA 2Q9IA 3LIDA 1A02F 4IFMA 5AW5B 4N78E 3GHGC 4Y99B 1JY3N 1DX7A 4AUWA 2I1KA 1RE3A 1X8YA 3SWFA 1FZFA 5APXA 1YYCA 3GHGA 2IFMA 3VTPC 3C9IA 1IK9A 1HVVA 1LT9A 2J58A 1LTJB 1CI6B 1N7SA 3A5TA 2OYHB 4DZOA 1IFJA 3IR9A 3B5ND 2XV5A 1GZLA 2WITA 1Z56A 1RF0C 2XNXA 1L4AB 1GK6A 4DOJA 1RF1B 3E1IA 2HG5D 2BASA 1ZV8A 3VP8A 2P7JA 4Y99C 1MZ9A 4C7NB 1NHLA 2JEEA 3HD7B 2NPSB 3B5NA 1RY3A 3VOPA 2H8PD 1IFIA 4AQRD 1LGHB 5CJ4A 1JCDA 3B8EB 3KDPB 5AW1B 1N73C 1HWTC 1L0LK 1E5WA 1SFCB 2WZ7A 4HH2A 2Q5UA 1KILB 2C9NY 4N3YB 2YKPA 1L4AC 3WMM0 3T97A 1HBWA 3RK3D 1RF1C 1ZR2A 3M0AA 3RK2C 1HJBA 2KP8A 1IJDB 1EO0A 4WY4B 2HFED 1GW3A 3HUSC 2W6BA 2FYZA 1H89A 2LKMA 1VPCA 2HODA 2XPOA 3V5BA 4ZKUA 3LW5H 2O1KA 2WT7B 1IC2A 1N7LA 1MV8A 3M06A 2YO2A 2FYUK 1SQQK 3L36A 1G2CB 1CW5A 2P67A 3A7OA 3HTKB 1JTHA 3I5CA 4B86A 1FJKA 4XA4A 1NO4A 2E42A 2C0XA 3CI9A 5APYA 2L5GB 2YMYA 1LTBC 1G1JA 4WBAA 1FAVA 1S9KE 4M3LA 3EFGA 1SVFA 1HH0A 1X9VA 4C46A 5CCGC 1L0NK 2WSCH 5AVWB 2Z5IA 2N3AB 2N1TC 3GHGB 5APSA 1LT9B 1WT6A 4I2LC 1J2JB 1J1DC 1OWAA 1HGVA 2YKQA 3P32A 3MIWA 1GL2C 3NTNA 3M0DA 1KFMA 3H32A 3U88C 1T8ZA 5BVZA 4GIFA 3MGNA 4HYTB 2IFNA 1AQ5A 1JY2O 2B4JC 1NKNA 3RL0D 1XTCC 2WPQA 3CL3D 2R5DA 1RE3C 4I1LA 1LT9C 2KSJA 3BATA 1A02J 2N9BA 1N86A 1IFNA 4OH8B 2H7HA 1N7SC 1URQD 2A45H 1IFDA 1W2EA 5AW9B 4RESB 3TNUB 1G1IA 1FJPA 4IFFA 2VRSA 1N73B 1IFMA 1KQLA 2P1JA 5KLVK 1T2KD 4O9BA 4XE5B 1KFNA 3V4WA 1FDMA 3KQGA 1FZAA 2IPPA 1Z9EA 3V2RA 1URQA 1IO4A 3G3ZA 5KJ7D 1GU4A 3M9QA 1QL1A 2KOGA 3RK2B 5AW2B 1PFIA 3B5NC 4LC1A 3L4FA 3HUSB 1JO5A 3IFMA 2YKOA 1JTHB 2JJLA 2HYNA 3P8MC 3HPHE 1NTZK 1GTWA 5KJ7A 1JY2P 3HE4B 3MUDA 5AW0B 3NXSA 2GUVA 1GD2E 1NOHA 3UIAA 2O01H 2YO3A 2HPCB 2A45I 1GDTA 2XZRA 5APVA 2R32A 2GUSA 1NU1K 2M3BA 1M1JC 3OA7A 1RE4A 2MJZA 2N1TB 1GK4A 3RK3C 2WWWA 2Z4EA 3BVHA 1M1JA 1J1DB 1N2DC 4WB4A 2P2UA 1CI6A 2FFDC 3TSIA 2KLVA 3U1AA 1GL2B 4N6JA 1LWUC 2OYHA 2OYIC 1EQ7A 3N7NA 3HD7D 2NPSD 2POHA 1QL2A 3H6PA 2W27A 2FFDA 2C0WA 3TYYA 1GW4A 1LWUA 2OYIA 1SFCD 3NMDA 1FZBA 2E43A 1KILD 1FZCC 5APUA 1H8AA 2R3CA 1FOSF 1SLQA 3OJAB 5AVQB 4C7NA 2J59M 3M0DC 4LGDE 3HD7A 2NPSA 3VMZA 1FZGA 1FU1A 3KYQA 1LTSC 4GKGA 1FZCA 1N7SB 4WY4D 3RL0B 2CPSA 3L35A 2XDJA 5AVSB 2QM7A 2Z5HA 5BU5A 5BU8B 3V2NA 1FBMA 1DH3A 5AW4B 1KILA 3A2AA 1JY3O 2GM4A 3HE5A 1VDFA 3BASA 1NKZB 3P8CD 3PP5A 3V2QA 3V2PA 1GU5A 1M7LA 3CLQA 5APWA 1H88A 1SQBK 1FOSE 3VN0A 3VMXA 1HGZA 3OAKA 2YNYA 1CSBA 1FZEA 3B5NB 5CCHD 5AVYB 2O1JA 2R5BA 4LLHA 5KTBA 2WTYA 2XU6A 3RL0C 1CZQA 3VMYA 1SQPK 5AVZB 5AVUB 3P7KA 4AYCA 3A3YB 1OXZA 1JUNA 3NFQA 4KHXA 5APQA 1NTKK 3M9BA 3N4XA 2WSEH 1URQC 4W7ZA 5CCHA 1LTIC 5AVVB 1HUCA 4C7RA 5AW7B 1AFOA 2HODB 2A45G 1JY2N 1T2KC 3VP9A 1WJTA 1M1JB 4JYCA 5CHXA 1NH4A 3RK3B 5KJ7C 1NAFA 1DEBA 2HLOA 2XKMA 2XPPA 5CMZA 3F9KC 4JYBA 1YTZI 5AW8B 1JY3P 2FFDB 1LWUB 3BRVB 2QM8A 3M91A 2OYIB 2KYVA 1JNMA 2ZXEB 5AW6B 2PAJA 3II6A 1NWQA 1RF0A 3HRNA 1RE4C 1ZR4A 4W7YA 1ZLLA 3M9HA 1FZCB 3KPEA 2OARA 1LTJC 1L4AD 3R2PA 1SQXK 4ZKPA 2OYHC 3RK2D 3H32B 4W80A 2H43A 1KZUB 3TNUA 2ZFCA 1LTJA 3HE5B 1LTTC 4JF7A 2Q3IA 1N73A 5CJ0A 1NTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM7 A;  2H7H A;  2Z5H A;  5AVT B;  5AW9 B;  1DH3 A;  3L37 A;  4C7N B;  1S9K D;  5AW4 B;  4RES B;  3TNU B;  3A2A A;  1SP4 A;  3HE5 A;  4EOT A;  2VRS A;  5APT A;  1KQL A;  4AQR D;  1GU5 A;  3B8E B;  1T2K D;  3KDP B;  5AW1 B;  4XE5 B;  1HWT C;  2WPS A;  3V4W A;  5APW A;  1H88 A;  3KQG A;  5AW3 B;  1FOS E;  3HPG G;  2IPP A;  1Z9E A;  3VN0 A;  3VMX A;  2Q5U A;  3OAK A;  2C9N Y;  2YNY A;  2Q7C A;  1CSB A;  1IO4 A;  1GU4 A;  2C9L Y;  5AVY B;  2W6A A;  3T97 A;  2XPL A;  1HBW A;  5AW2 B;  4LC1 A;  2R5B A;  2WTY A;  3M0A A;  2XU6 A;  1HJB A;  1CZQ A;  2KP8 A;  3VMY A;  5AVZ B;  2XPN A;  5AVU B;  1MUU A;  3P7K A;  3A3Y B;  1OXZ A;  4AYC A;  1JUN A;  1EO0 A;  3NFQ A;  4KHX A;  3HE4 A;  5APQ A;  2JJL A;  5AVR B;  1H89 A;  3HPH E;  3M9B A;  3P8M C;  2XPO A;  3V5B A;  1GTW A;  2WT7 B;  1MV8 A;  3M06 A;  2YO2 A;  3LIE A;  3MD0 A;  3L36 A;  1G2C B;  5AVV B;  1HUC A;  5AW7 B;  2P67 A;  3A7O A;  3HE4 B;  3V4Q A;  5AW0 B;  3NXS A;  3I5C A;  4I6M C;  3TK1 A;  3O8Z A;  4B86 A;  1GD2 E;  3UIA A;  2WT7 A;  3VYI A;  2YO3 A;  1T2K C;  1WJT A;  2E42 A;  2XZR A;  5APV A;  1MFZ A;  4JYC A;  2R32 A;  5APY A;  4GT1 A;  1FAV A;  5AVX B;  1S9K E;  4M3L A;  3HTK A;  1NAF A;  4C46 A;  1GK4 A;  2P7J A;  2WWW A;  5AVW B;  2XPP A;  5CMZ A;  2Z5I A;  3F9K C;  4JYB A;  2N3A B;  2WPR A;  3LID A;  5AW8 B;  5APS A;  1A02 F;  5AW5 B;  4I2L C;  2P2U A;  1J2J B;  3M91 A;  1CI6 A;  2QM8 A;  1OWA A;  1JNM A;  3P32 A;  2ZXE B;  4AUW A;  5AW6 B;  1NWQ A;  3NTN A;  3M0D A;  3SWF A;  1X8Y A;  5APX A;  1YYC A;  2W27 A;  3VTP C;  3U88 C;  3M9H A;  3TYY A;  1CI6 B;  3MGN A;  4HYT B;  3NMD A;  3A5T A;  4DZO A;  2E43 A;  5APU A;  3IR9 A;  2B4J C;  2XV5 A;  1H8A A;  1GZL A;  2R3C A;  1FOS F;  1SLQ A;  5AVQ B;  4C7N A;  2WPQ A;  3TNU A;  2R5D A;  3VMZ A;  1GK6 A;  2ZFC A;  3HE5 B;  4GKG A;  2Q3I A;  1A02 J;  2BAS A;  2N9B A;  3L35 A;  5AVS B; 
#chains in the Genus database with same CATH topology
 2G3A A;  3A0H H;  2LXB A;  2A06 G;  1SQX D;  4EIJ A;  4PV1 C;  2YXR B;  1RF1 A;  3U59 A;  2CPB A;  5AW3 B;  3AEB C;  1YTZ T;  2R3S A;  1PP9 E;  1MUU A;  3CXH E;  4GOD A;  4WY4 C;  2K3R A;  3H1I J;  3H1J E;  2IYP A;  2O01 J;  1JMB A;  1GL2 D;  2HPC A;  5H2F H;  2FXO A;  5CCG A;  1ZN5 A;  1ZW0 A;  3V4Q A;  1BGY D;  3O8Z A;  3BRT B;  2WT7 A;  3VYI A;  1ZRT E;  1U7M A;  3CX5 I;  1MFZ A;  3GLM A;  4OC0 A;  3TGU G;  1T3U A;  1G2C A;  2AXT E;  3HTK A;  3MHV A;  5CCH C;  3FF3 A;  1SQB J;  3L71 G;  2WPR A;  3LID A;  2IBZ E;  1NTZ G;  4IFM A;  4N78 E;  5AW5 B;  1YJ9 P;  1JY3 N;  4JQ0 D;  3L70 D;  2I1K A;  1IK9 A;  1HVV A;  1VF5 B;  2OYH B;  1H0T B;  3H1L G;  4OC4 A;  1GZL A;  2OTL P;  1OVU A;  1Z56 A;  4UB8 E;  5KLI C;  4RR2 B;  1QVG O;  1ZV8 A;  2RH0 A;  2PGD A;  2C6P A;  1DD3 A;  2E5Y A;  3B5N A;  3ITK A;  1KMI Z;  4CPG A;  2H8P D;  3BUM B;  1JCD A;  3B8E B;  4JZ0 A;  3KDP B;  2RKL A;  1L0L K;  1E5W A;  1BCC G;  4BRY A;  3H1H J;  3WMM 0;  2PVV A;  4X3R A;  3RK3 D;  1RF1 C;  4P4B A;  1ZR2 A;  3RK2 C;  1HJB A;  1IJD B;  4WY4 B;  2HFE D;  2FYZ A;  3PTZ A;  3PFV A;  1VPC A;  3KZI E;  3LW5 H;  4NPF X;  4IL6 H;  3F89 A;  1SQQ K;  1CW5 A;  2P67 A;  4OWF A;  1AVO A;  2D2C D;  1FJK A;  4DJG A;  2C0X A;  3CI9 A;  5APY A;  4GPL B;  1S9K E;  4M3L A;  2KNC B;  1HH0 A;  1LJ2 A;  2XEJ A;  3L74 J;  5CCG C;  5AVW B;  2N3A B;  4P4E A;  1LT9 B;  1WT6 A;  1NTM E;  1J2J B;  3VRO A;  1OWA A;  1BE3 E;  2KZJ A;  3H32 A;  3AE6 C;  1AV1 A;  3CPW O;  3MGN A;  2JWD A;  1RQU A;  4HJG H;  1NJI Q;  1PGQ A;  3Q1M A;  4PD4 D;  5KLI B;  1Q81 Q;  1Z8L A;  1XTC C;  3CL3 D;  4D6T G;  2BEZ F;  3BAT A;  1A02 J;  1VQL P;  2JBJ A;  1IFN A;  4NPD A;  5AW9 B;  4RES B;  2O01 N;  1YIJ P;  1G1I A;  2WSF J;  2ZVO B;  4H0L C;  1PPJ E;  4IFF A;  3T97 B;  2VRS A;  3R4Y A;  3BCC J;  4O9B A;  4XE5 B;  2HR3 A;  4BPU B;  3KQG A;  2IPP A;  1SQX G;  3MZW B;  1IO4 A;  3M9Q A;  2PRR A;  1YHQ P;  1L0L G;  5HKZ A;  3RK2 B;  4L73 A;  1PFI A;  3B5N C;  4LC1 A;  4U7J A;  3L4F A;  4PJ0 H;  2UV8 G;  1PIX A;  3IFM A;  1TU3 F;  3HPH E;  3MUD C;  4Z1M H;  4K35 A;  3G71 P;  5TIS E;  1E79 H;  5KJ7 A;  3H1K D;  1W2B O;  3AEG C;  2DW3 A;  3OP0 A;  1M90 Q;  3NXS A;  1SQQ G;  1NGM B;  1KB9 D;  1VF5 D;  2YO3 A;  4XFJ A;  3PHL A;  2HPC B;  3CCE P;  5APV A;  2WSS H;  1S72 P;  3G9R A;  4OME A;  1T6A A;  3AE2 C;  1GK4 A;  1NVO A;  1BGY G;  3L75 J;  4W9Y A;  3CCL P;  4PV1 D;  2KLV A;  2OYI C;  3CX5 H;  1K9M Q;  5KAI H;  4JPZ B;  3ZNI A;  2W90 A;  1PP9 D;  5E79 H;  3CXH D;  2FFD A;  2XEG A;  1VQ9 P;  3KAS A;  3NMD A;  2FYU J;  3H1J D;  2E43 A;  1KYO I;  1FZC C;  3L70 G;  4NGQ A;  1FZG A;  2NPS A;  1KB9 E;  3CWB E;  1LTS C;  4WY4 D;  1M1K Q;  1ZRT D;  4YXD C;  3V2N A;  1S4X A;  5AW4 B;  4H0L B;  4ASW A;  1JY3 O;  3V2Q A;  4U3F J;  2IBZ D;  2R44 A;  3RL0 g;  4OC1 A;  1YVH A;  3OAK A;  1CSB A;  1FZE A;  3B5N B;  5CCH D;  5DJU B;  2O1J A;  5L8R J;  2XU6 A;  3RL0 C;  3AE9 C;  5AVZ B;  5AVU B;  3P7K A;  4AYC A;  3C1L A;  2K9J B;  4KHX A;  3H1I E;  1VQN P;  3M9B A;  1PL5 A;  2C6G A;  5AW7 B;  1AFO A;  1SS1 A;  1S3J A;  4IL6 E;  3GG2 A;  1T2K C;  1WJT A;  3S9L A;  4YTP C;  3VRN A;  5CHX A;  3IN6 A;  1NH4 A;  5KJ7 C;  1RH5 B;  1SQB E;  3JCU H;  4JYB A;  5ELY A;  1VQP P;  1EDI A;  2QM8 A;  3M91 A;  2OYI B;  4P4I A;  4RKU J;  3L71 J;  2PAJ A;  1NWQ A;  1RF0 A;  3M9H A;  1NTZ J;  2BCC E;  3WU2 H;  3BUX B;  1FZC B;  1LP1 B;  1VQ6 P;  1USD A;  4ZKP A;  2AEJ A;  2KXP B;  3RK2 D;  3H32 B;  1VQ8 P;  2Q6Q A;  1KZU B;  1LTT C;  3BI0 A;  1S2E A;  1NU1 J;  3H1L D;  1Q2N A;  2IDB A;  3AED C;  1H0T A;  2AEF A;  3RGU A;  2FKW B;  3F5H A;  2ITA A;  1FBV A;  1OIP A;  1JCC A;  3S9O A;  1S9K D;  3RBX A;  4NPE A;  4UB8 H;  4EOT A;  2NPS C;  2W8Z A;  3CD6 P;  3AEF C;  4IFD K;  1JOC A;  1MKM A;  1VL2 A;  3CC4 P;  2AXC A;  1NTM D;  2M0B A;  3H1H E;  1BE3 D;  3D7F A;  2KK7 A;  4H44 C;  2XPL A;  2DLA A;  2BEQ D;  5CCG D;  1K8A Q;  4OGQ C;  1LTA C;  1J1E B;  2WQY C;  3L73 J;  4MCR A;  1BCC J;  2KIK A;  1L0N J;  1B47 A;  3D70 A;  2IX7 C;  2OTK E;  2PVW A;  2RMZ A;  3LIE A;  3MD0 A;  1HTL C;  4R4L A;  3EFF K;  4LQG A;  2JWA A;  4WY4 A;  2I1J A;  3B4S A;  5HKW A;  2PP6 A;  3KZI H;  1LTG C;  2N9Y B;  2FXM A;  3CMA P;  2ZYA A;  2W83 C;  1PPJ D;  2QJY C;  1A02 F;  5GTI E;  2K88 A;  2KNC A;  4H0L D;  1K73 Q;  1SQP J;  2H89 C;  1RE3 A;  1YYC A;  1NTK J;  2IFM A;  1LT9 A;  3CX5 E;  1N7S A;  1OFC X;  5KAI E;  4DZO A;  1IFJ A;  1QGK B;  1YQ4 C;  2OQQ A;  3B5N D;  2XV5 A;  1Q90 D;  3AE3 C;  2WIT A;  1RF0 C;  2QA4 P;  1PP9 G;  3CC7 P;  4DOJ A;  3USS A;  3ZDM A;  2BAS A;  2P7J A;  2JR8 A;  3H1J G;  1YI2 P;  2SPZ A;  2OYO A;  3GMA A;  1QX8 A;  1S5L H;  3Q5P A;  1LT1 A;  1Y47 A;  2NPS B;  1EDK A;  2KUB A;  3VOP A;  4UB6 E;  1KYO H;  3BCC E;  5GTH E;  3CCJ P;  1OZH A;  4OC3 A;  2B88 A;  3T97 A;  5BY0 A;  1OW8 A;  1DD4 A;  2KP8 A;  2IBZ G;  3AEE C;  1L2P A;  1H89 A;  1L0L D;  2XPO A;  4ZKU A;  1N7L A;  3M06 A;  2E76 B;  3CWB D;  4B86 A;  3D6Y A;  2E42 A;  2L5G B;  1LTB C;  1G1J A;  4WBA A;  5TIS H;  1SQQ D;  1SVF A;  4NGN A;  3FED A;  1NYH A;  1X9V A;  2QJY B;  1L0N K;  3AEC C;  2WSC H;  3FWL A;  4P44 A;  1HJ0 A;  4I2L C;  1QLE D;  1J1D C;  1HGV A;  3JCU E;  2K37 A;  3O6Q A;  3NTN A;  1IK7 A;  3M0D A;  1KFM A;  3GF3 A;  1EZV E;  2FYU E;  4HYT B;  3WU2 E;  2QE7 H;  3RL0 D;  2WPQ A;  1OW7 A;  2R5D A;  3E1R A;  1RE3 C;  3FGA D;  4I1L A;  3I56 P;  4YPC A;  1LT9 C;  1N86 A;  4OH8 B;  1N7S C;  2A45 H;  3L70 J;  3FWN A;  1SQB D;  4A4B A;  4U3F E;  5KLV K;  1T2K D;  1BDD A;  1JM0 A;  1OVR A;  4K3A A;  1URQ A;  3G3Z A;  1VQO P;  5KJ7 D;  1FDI A;  4YXW H;  1QL1 A;  5AW2 B;  5M1B A;  1ZME C;  2BCC D;  2ZVN B;  1NTM G;  2M5A B;  2JJL A;  1KQF B;  1KD1 Q;  1BE3 G;  4L74 A;  1R5L A;  2K9J A;  3MUD A;  2GUV A;  4OC2 A;  4H13 B;  1NOH A;  3UIA A;  2O01 H;  2R32 A;  2GUS A;  3OA7 A;  4HKZ H;  2MJZ A;  3QWO C;  2Z4E A;  3BXM A;  2Q1K A;  1J1D B;  1OMI A;  3S1K A;  1P84 I;  3TSI A;  3U1A A;  3CXH I;  1LWU C;  1EQ7 A;  3N7N A;  2NPS D;  1PPJ G;  2OR4 A;  2C0W A;  2OYI A;  4BPW B;  4H44 D;  4OGQ D;  3PT1 A;  4C7N A;  3H25 A;  2J59 M;  1USE A;  3M0D C;  1NU1 E;  3SSU A;  1FZC A;  1N7S B;  3L35 A;  2V7Q J;  1LP1 A;  1DH3 A;  2FY8 A;  1SQV J;  1KIL A;  2IBZ I;  2GM4 A;  1VDF A;  2XND H;  5D29 A;  2IZ0 A;  3V2P A;  1S5L E;  1M7L A;  1SQB K;  3VN0 A;  1KYO E;  3SFD C;  2KI7 B;  3L72 J;  2R5B A;  3L73 E;  1CZQ A;  1JUN A;  1L0N E;  3CX5 D;  2XEI A;  3FXE A;  1URQ C;  4A4C A;  2E74 B;  4P4J A;  1PV3 A;  2YIU C;  5AVV B;  3RBU A;  1IFP A;  5B66 H;  2A45 G;  1JY2 N;  1EXJ A;  3JSV C;  4JYC A;  5K5G B;  1NAF A;  3CWB G;  3BCC D;  3PJS K;  1JY3 P;  1LWU B;  3H1K J;  2KYV A;  1SQP E;  1NTK E;  3HRN A;  1ZR4 A;  2JDI H;  1D7M A;  5KLV E;  1PGO A;  5GTI H;  3R2P A;  4MN4 C;  1BSN A;  3O6Q B;  2H43 A;  3TNU A;  2Y1M A;  3WUU A;  3H1I G;  4JF7 A;  2Q3I A;  1N73 A;  5CJ0 A;  1U7J A;  3L37 A;  3S9M A;  3Q5S A;  3H1J J;  3AE1 C;  4BTF A;  3HPG G;  2Q7C A;  1SFC C;  2WSF H;  1WRG A;  1KIL C;  1RHZ B;  1SQB G;  2KLU A;  4UB6 H;  1JMM A;  2XPN A;  2LXC B;  5GTH H;  1EZV D;  3HE4 A;  5AVR B;  1URQ B;  1SQV K;  4DCK A;  1KIL E;  2QG4 A;  3CME P;  2YIU B;  1PGP A;  3WUV A;  4N78 D;  2BCC G;  4GDO A;  4I6M C;  1LNQ A;  2N1T A;  4NGR A;  3EQ2 A;  3EWK A;  2YMK A;  1OW6 A;  4GT1 A;  1J1E C;  2Y1N A;  1BDC A;  4U3F D;  3P8C E;  3AEA C;  1N7S D;  2Q9I A;  3FX0 A;  3GHG C;  3IWW A;  4Y99 B;  1YQ3 C;  2P58 A;  3ABV C;  4OC5 A;  5APX A;  3C9I A;  2J58 A;  2L91 A;  3Q3D A;  3H1H G;  2Y0D A;  3TGU J;  1L4A B;  2O3J A;  1GK6 A;  3E1I A;  5KKZ C;  2HG5 D;  3VP8 A;  2AEM A;  1Q86 Q;  4C7N B;  1NHL A;  5AXI A;  2JEE A;  1M57 D;  1RY3 A;  3K5B A;  2OGU A;  1IFI A;  1LGH B;  5CJ4 A;  3D7D A;  2Q3E A;  3Q5R A;  5AW1 B;  1N73 C;  1HWT C;  2IZ1 A;  1SFC B;  2WZ7 A;  1KIL B;  2C9N Y;  1ZOY C;  4N3Y B;  2YKP A;  2WSE J;  1HBW A;  2WVR A;  3H1L J;  1QVF O;  1GW3 A;  2ZT9 C;  2W6B A;  2HOD A;  2QJP C;  3V5B A;  2QEX P;  1MV8 A;  2FYU K;  3C8V A;  3D7G A;  2LR2 A;  2M3E A;  3A7O A;  2M5A A;  1QEX A;  3I5C A;  1BE3 J;  3AE5 C;  1Q7Y Q;  4XA4 A;  1KQG B;  1FAV A;  3EFG A;  2KSE A;  5B66 E;  3HMJ G;  2N1T C;  3GHG B;  4A7P A;  1KYO D;  2W6J H;  4MCS A;  3OB2 B;  2YKQ A;  3P32 A;  2E76 C;  3L73 D;  3BCC G;  1L0N D;  5BVZ A;  4GIF A;  2Y0E A;  4ZNC A;  3L74 E;  2QVA A;  1JY2 O;  1X0T A;  2B4J C;  2K1A A;  4NGM A;  1NKN A;  3GW6 A;  2P10 A;  4BPX B;  4ASV A;  5KKZ B;  1X22 A;  5CBN A;  2KSJ A;  1ZXG A;  2H7H A;  1URQ D;  1SQV E;  1KN7 A;  4NGT A;  3TNU B;  1UIX A;  5DJT B;  1N73 B;  1IFM A;  1KQL A;  2P1J A;  3V4W A;  3CCV P;  1FDM A;  1Z9E A;  4EDF A;  1SQP D;  3KXD A;  2XEF A;  1EXI A;  3L72 E;  3QH9 A;  2KOG A;  1NTK D;  4WVZ A;  2ZT9 B;  1VQM P;  4D6T J;  2QJP B;  5KLV D;  2YKO A;  4MCP A;  1JTH B;  2ZYD A;  2HYN A;  1IZN B;  1NTZ K;  1GTW A;  2FYN C;  3HE4 B;  1VQ4 P;  1EZV G;  2FYU G;  5AW0 B;  1GD2 E;  4I7Z C;  1Y9B A;  1YBK A;  4IL6 X;  1GDT A;  4BXL A;  2D2C B;  5F09 A;  1NU1 K;  3BUO B;  2M3B A;  1M1J C;  2NZ2 A;  3AE7 C;  5B5E E;  1SQX J;  1KC8 Q;  1L0L J;  2N1T B;  3BVH A;  3H1K E;  1N2D C;  2ZJS E;  3PH0 A;  1CI6 A;  2POH A;  4U3F G;  3S9N A;  4EI2 A;  2W27 A;  3GF7 A;  4H13 C;  1GW4 A;  1LWU A;  2OTJ P;  1SFC D;  1SQQ J;  1FZB A;  1KIL D;  3L75 E;  3W68 A;  1H8A A;  3OJA B;  3CCS P;  1JEK A;  3VMZ A;  3HD7 A;  1FU1 A;  3KYQ A;  4BWN A;  4GKG A;  1ZP0 C;  2CPS A;  2XDJ A;  2QM7 A;  1BGY J;  2J5U A;  3RBZ A;  1R5S A;  2Z5H A;  1P84 E;  3CCM P;  1FBM A;  1WMK A;  3A2A A;  3H1I D;  4PD4 I;  3SJX A;  3A0B H;  3P8C D;  1OX3 A;  2K9Y A;  3PP5 A;  1GU5 A;  3CLQ A;  1H88 A;  2IYO A;  1HGZ A;  2YNY A;  3D6Z A;  3LW5 J;  2YXQ B;  2WTY A;  2V4H A;  1SQP K;  2G8Y A;  3A3Y B;  1OXZ A;  5APQ A;  2Y9Z A;  3SJF A;  1NTK K;  3E7K A;  3N4X A;  2FYN B;  2MKV A;  2A06 E;  1LTI C;  4C7R A;  4I7Z B;  1YJN P;  3MP7 B;  1OVV A;  2HOD B;  3CC2 P;  4OVN F;  4KT0 J;  1M1J B;  3FEC A;  2WMM A;  2BCC J;  1DIP A;  1NU1 G;  5CMZ A;  3VRQ A;  1YTZ I;  5AW8 B;  1KB9 I;  5TJH A;  3CCR P;  1JNM A;  2E74 C;  2ZXE B;  2OOT A;  5AW6 B;  3SJE A;  4PV1 B;  2CIJ A;  4W7Y A;  1W5C E;  1HF9 A;  3KPE A;  1LTJ C;  1VQ7 P;  1AQT A;  1SQX K;  3TGU E;  3L73 G;  2B87 B;  2ZFC A;  1L0N G;  3HE5 B;  2ZT9 D;  3H1H D;  1KOR A;  3L71 E;  2E75 C;  4NGS A;  5AVT B;  1NTZ E;  4KJM A;  1L4A A;  3MTU E;  4GOE A;  1SP4 A;  3U1C A;  3HD7 C;  5APT A;  4R4M A;  3HUS A;  2WPS A;  2CK3 H;  1T3J A;  1YIT P;  2I8D A;  3G6E P;  2C9L Y;  2W6A A;  1EZV I;  3H1L E;  2N1T D;  3D7H A;  1AA0 A;  1U57 A;  1SFC A;  5KAF H;  1XTG B;  1R8E A;  2M8R A;  3TF5 A;  3L74 D;  1SQP G;  1KTM A;  2E76 D;  1NTK G;  2FXP A;  5HKY A;  5KLV G;  3TK1 A;  2KS1 A;  4NGP A;  2PFX A;  5CBO A;  3I55 P;  2KZI A;  4HB1 A;  1SQV D;  1M56 D;  1BCC E;  3SWY A;  5AVX B;  1GL2 A;  2KB7 P;  2C6C A;  1FDO A;  1X79 B;  1MFT A;  3PLN A;  3IF4 A;  3L72 D;  5EFW B;  1DX7 A;  4AUW A;  1EC5 A;  5J3X A;  3SWF A;  1X8Y A;  1FZF A;  3CCQ P;  3GHG A;  3VTP C;  2VKZ G;  1LTJ B;  1CI6 B;  1KV4 A;  3A5T A;  3A0H E;  3IR9 A;  3PRJ A;  4TT3 H;  2XNX A;  2E75 B;  4GOF A;  1RF1 B;  1YJW P;  1AVY A;  4Y99 C;  1MZ9 A;  4P4F A;  3B71 A;  2ZXX A;  1VQ5 P;  3HD7 B;  3TDK A;  4MCQ A;  3W67 A;  4AQR D;  2V7Q H;  5C39 A;  2B89 A;  4HH2 A;  2Q5U A;  3A0B E;  3KHU A;  3VGO A;  1N8R Q;  2NRG A;  1L4A C;  4Y28 J;  5H2F E;  3M0A A;  4D6T E;  1EO0 A;  4PD4 H;  1PP9 J;  3HUS C;  4EYY Q;  2LKM A;  2O1K A;  2WT7 B;  1IC2 A;  3L75 D;  2YO2 A;  3OB1 B;  4H13 D;  2FBW C;  3L36 A;  1G2C B;  3HTK B;  1JTH A;  1GMJ A;  1P84 D;  1NO4 A;  2YMY A;  3VRR A;  1SQX E;  2FYU D;  1L0L E;  2QSI A;  4C46 A;  2Z5I A;  4IOI H;  3Q2Y A;  5APS A;  2JO1 A;  4TLF A;  2Y0C A;  2WPV B;  3MIW A;  4RJT A;  1GL2 C;  5B5E H;  1VQK P;  3U88 C;  1T8Z A;  1SQQ E;  2IFN A;  1M8O B;  1AQ5 A;  1KB9 H;  3D71 A;  2A06 D;  1CX8 A;  1PZQ A;  1BGY E;  2N9B A;  1Y8A A;  2UWJ E;  3VMA A;  1IFD A;  1W2E A;  2Y9Y A;  4BRY B;  3IAO A;  2CBL A;  1FJP A;  1EDL A;  2B9B A;  2JBK A;  3SFE C;  1FE6 A;  3G4S P;  1KFN A;  1S5L X;  1FZA A;  1P84 H;  2QRX A;  4JBZ A;  3CXH H;  3V2R A;  1GU4 A;  2QIW A;  3L70 E;  1Q82 Q;  4ZMD A;  3HUS B;  4WWI A;  1BSH A;  3AE8 C;  1JO5 A;  3P8M C;  2E74 D;  3SWK A;  3FXD A;  2ZYG A;  3TGU D;  4RO0 A;  5KAF E;  1JY2 P;  1FC2 C;  3L71 D;  2AXT H;  4P4D A;  3L74 G;  5F13 A;  3VRP A;  2A45 I;  1NTZ D;  2XZR A;  1PGJ A;  1DE4 C;  1DEE G;  1RE4 A;  2KS1 B;  3RK3 C;  2E75 D;  2WWW A;  3OW2 O;  1M1J A;  1SQV G;  4WB4 A;  2H88 C;  2P2U A;  2FFD C;  1NTM J;  1GL2 B;  4N6J A;  1NU1 D;  2OYH A;  3HD7 D;  1QL2 A;  3JC2 2;  3RK3 E;  3H6P A;  4P45 A;  3TYY A;  2QJK C;  2D2C C;  3L72 G;  5APU A;  3S4R A;  2R3C A;  1FOS F;  1SLQ A;  5AVQ B;  1K05 A;  2E5T A;  4LGD E;  1AJY A;  4L75 A;  3RL0 B;  5AVS B;  1KQS O;  5BU5 A;  5BU8 B;  1BCC D;  2B87 A;  1S1C X;  3HE5 A;  2RN0 A;  3BAS A;  1NKZ B;  4PJ0 E;  1K04 A;  2JP3 A;  5APW A;  1FOS E;  3VMX A;  1UII A;  5AVY B;  4LLH A;  5KTB A;  1EDJ A;  3VMY A;  3FEE A;  3H1K G;  3NFQ A;  2WSE H;  4W7Z A;  4PD4 E;  3WUT A;  5CCH A;  2GA1 A;  3SJG A;  1HUC A;  3V6I A;  2WSC J;  4L76 A;  2JKV A;  3VP9 A;  3L75 G;  3BHX A;  3RK3 B;  5KLV J;  1DEB A;  2HLO A;  3PLF B;  2XKM A;  5E79 E;  3CCU P;  2XPP A;  3F9K C;  2FFD B;  3BRV B;  3BUW B;  4JYW A;  3BI1 A;  3II6 A;  1RE4 C;  2QJK B;  4D6T D;  1ZLL A;  1NAY A;  4QMA A;  2OAR A;  1L4A D;  1VF5 C;  3BUN B;  2OYH C;  1RQV A;  4W80 A;  4DT0 A;  4H44 B;  1JB0 J;  1LTJ A;  4OGQ B;  3CWB J;  1FS0 E;  3AE4 C;  2ZAE B;  1NTM K; 
#chains in the Genus database with same CATH homology
 5AVT B;  2FKW B;  1JCC A;  3L37 A;  1S9K D;  4EIJ A;  1L4A A;  3MTU E;  1SP4 A;  3U1C A;  1RF1 A;  4EOT A;  3HD7 C;  2NPS C;  5APT A;  3U59 A;  2CPB A;  4IFD K;  1JOC A;  3HUS A;  2WPS A;  5AW3 B;  3HPG G;  1T3J A;  2Q7C A;  1SFC C;  2WSF H;  1WRG A;  2C9L Y;  2W6A A;  1KIL C;  2XPL A;  5CCG D;  1LTA C;  1YTZ T;  1J1E B;  1JMM A;  2N1T D;  2XPN A;  1MUU A;  1SFC A;  1XTG B;  2M8R A;  3HE4 A;  5AVR B;  1URQ B;  2IX7 C;  4WY4 C;  1SQV K;  1GL2 D;  2HPC A;  3LIE A;  3MD0 A;  1HTL C;  4N78 D;  4WY4 A;  5CCG A;  1ZN5 A;  3V4Q A;  2I1J A;  4I6M C;  3TK1 A;  3O8Z A;  2N1T A;  3BRT B;  3EQ2 A;  2WT7 A;  3VYI A;  2PP6 A;  1MFZ A;  1LTG C;  4GT1 A;  1T3U A;  2FXM A;  3SWY A;  5AVX B;  1G2C A;  1J1E C;  1GL2 A;  2KB7 P;  3HTK A;  5CCH C;  3P8C E;  1X79 B;  1N7S D;  2WPR A;  2Q9I A;  3LID A;  1A02 F;  4IFM A;  5AW5 B;  4N78 E;  3GHG C;  4Y99 B;  1JY3 N;  1DX7 A;  4AUW A;  2I1K A;  1RE3 A;  1X8Y A;  3SWF A;  1FZF A;  5APX A;  1YYC A;  3GHG A;  2IFM A;  3VTP C;  3C9I A;  1IK9 A;  1HVV A;  1LT9 A;  2J58 A;  1LTJ B;  1CI6 B;  1N7S A;  3A5T A;  2OYH B;  4DZO A;  1IFJ A;  3IR9 A;  3B5N D;  2XV5 A;  1GZL A;  2WIT A;  1Z56 A;  1RF0 C;  2XNX A;  1L4A B;  1GK6 A;  4DOJ A;  1RF1 B;  3E1I A;  2HG5 D;  2BAS A;  1ZV8 A;  3VP8 A;  2P7J A;  4Y99 C;  1MZ9 A;  4C7N B;  1NHL A;  2JEE A;  3HD7 B;  2NPS B;  3B5N A;  1RY3 A;  3VOP A;  2H8P D;  1IFI A;  4AQR D;  1LGH B;  5CJ4 A;  1JCD A;  3B8E B;  3KDP B;  5AW1 B;  1N73 C;  1HWT C;  1L0L K;  1E5W A;  1SFC B;  2WZ7 A;  4HH2 A;  2Q5U A;  1KIL B;  2C9N Y;  4N3Y B;  2YKP A;  1L4A C;  3WMM 0;  3T97 A;  1HBW A;  3RK3 D;  1RF1 C;  1ZR2 A;  3M0A A;  3RK2 C;  1HJB A;  2KP8 A;  1IJD B;  1EO0 A;  4WY4 B;  2HFE D;  1GW3 A;  3HUS C;  2W6B A;  2FYZ A;  1H89 A;  2LKM A;  1VPC A;  2HOD A;  2XPO A;  3V5B A;  4ZKU A;  3LW5 H;  2O1K A;  2WT7 B;  1IC2 A;  1N7L A;  1MV8 A;  3M06 A;  2YO2 A;  2FYU K;  1SQQ K;  3L36 A;  1G2C B;  1CW5 A;  2P67 A;  3A7O A;  3HTK B;  1JTH A;  3I5C A;  4B86 A;  1FJK A;  4XA4 A;  1NO4 A;  2E42 A;  2C0X A;  3CI9 A;  5APY A;  2L5G B;  2YMY A;  1LTB C;  1G1J A;  4WBA A;  1FAV A;  1S9K E;  4M3L A;  3EFG A;  1SVF A;  1HH0 A;  1X9V A;  4C46 A;  5CCG C;  1L0N K;  2WSC H;  5AVW B;  2Z5I A;  2N3A B;  2N1T C;  3GHG B;  5APS A;  1LT9 B;  1WT6 A;  4I2L C;  1J2J B;  1J1D C;  1OWA A;  1HGV A;  2YKQ A;  3P32 A;  3MIW A;  1GL2 C;  3NTN A;  3M0D A;  1KFM A;  3H32 A;  3U88 C;  1T8Z A;  5BVZ A;  4GIF A;  3MGN A;  4HYT B;  2IFN A;  1AQ5 A;  1JY2 O;  2B4J C;  1NKN A;  3RL0 D;  1XTC C;  2WPQ A;  3CL3 D;  2R5D A;  1RE3 C;  4I1L A;  1LT9 C;  2KSJ A;  3BAT A;  1A02 J;  2N9B A;  1N86 A;  1IFN A;  4OH8 B;  2H7H A;  1N7S C;  1URQ D;  2A45 H;  1IFD A;  1W2E A;  5AW9 B;  4RES B;  3TNU B;  1G1I A;  1FJP A;  4IFF A;  2VRS A;  1N73 B;  1IFM A;  1KQL A;  2P1J A;  5KLV K;  1T2K D;  4O9B A;  4XE5 B;  1KFN A;  3V4W A;  1FDM A;  3KQG A;  1FZA A;  2IPP A;  1Z9E A;  3V2R A;  1URQ A;  1IO4 A;  3G3Z A;  5KJ7 D;  1GU4 A;  3M9Q A;  1QL1 A;  2KOG A;  3RK2 B;  5AW2 B;  1PFI A;  3B5N C;  4LC1 A;  3L4F A;  3HUS B;  1JO5 A;  3IFM A;  2YKO A;  1JTH B;  2JJL A;  2HYN A;  3P8M C;  3HPH E;  1NTZ K;  1GTW A;  5KJ7 A;  1JY2 P;  3HE4 B;  3MUD A;  5AW0 B;  3NXS A;  2GUV A;  1GD2 E;  1NOH A;  3UIA A;  2O01 H;  2YO3 A;  2HPC B;  2A45 I;  1GDT A;  2XZR A;  5APV A;  2R32 A;  2GUS A;  1NU1 K;  2M3B A;  1M1J C;  3OA7 A;  1RE4 A;  2MJZ A;  2N1T B;  1GK4 A;  3RK3 C;  2WWW A;  2Z4E A;  3BVH A;  1M1J A;  1J1D B;  1N2D C;  4WB4 A;  2P2U A;  1CI6 A;  2FFD C;  3TSI A;  2KLV A;  3U1A A;  1GL2 B;  4N6J A;  1LWU C;  2OYH A;  2OYI C;  1EQ7 A;  3N7N A;  3HD7 D;  2NPS D;  2POH A;  1QL2 A;  3H6P A;  2W27 A;  2FFD A;  2C0W A;  3TYY A;  1GW4 A;  1LWU A;  2OYI A;  1SFC D;  3NMD A;  1FZB A;  2E43 A;  1KIL D;  1FZC C;  5APU A;  1H8A A;  2R3C A;  1FOS F;  1SLQ A;  3OJA B;  5AVQ B;  4C7N A;  2J59 M;  3M0D C;  4LGD E;  3HD7 A;  2NPS A;  3VMZ A;  1FZG A;  1FU1 A;  3KYQ A;  1LTS C;  4GKG A;  1FZC A;  1N7S B;  4WY4 D;  3RL0 B;  2CPS A;  3L35 A;  2XDJ A;  5AVS B;  2QM7 A;  2Z5H A;  5BU5 A;  5BU8 B;  3V2N A;  1FBM A;  1DH3 A;  5AW4 B;  1KIL A;  3A2A A;  1JY3 O;  2GM4 A;  3HE5 A;  1VDF A;  3BAS A;  1NKZ B;  3P8C D;  3PP5 A;  3V2Q A;  3V2P A;  1GU5 A;  1M7L A;  3CLQ A;  5APW A;  1H88 A;  1SQB K;  1FOS E;  3VN0 A;  3VMX A;  1HGZ A;  3OAK A;  2YNY A;  1CSB A;  1FZE A;  3B5N B;  5CCH D;  5AVY B;  2O1J A;  2R5B A;  4LLH A;  5KTB A;  2WTY A;  2XU6 A;  3RL0 C;  1CZQ A;  3VMY A;  1SQP K;  5AVZ B;  5AVU B;  3P7K A;  4AYC A;  3A3Y B;  1OXZ A;  1JUN A;  3NFQ A;  4KHX A;  5APQ A;  1NTK K;  3M9B A;  3N4X A;  2WSE H;  1URQ C;  4W7Z A;  5CCH A;  1LTI C;  5AVV B;  1HUC A;  4C7R A;  5AW7 B;  1AFO A;  2HOD B;  2A45 G;  1JY2 N;  1T2K C;  3VP9 A;  1WJT A;  1M1J B;  4JYC A;  5CHX A;  1NH4 A;  3RK3 B;  5KJ7 C;  1NAF A;  1DEB A;  2HLO A;  2XKM A;  2XPP A;  5CMZ A;  3F9K C;  4JYB A;  1YTZ I;  5AW8 B;  1JY3 P;  2FFD B;  1LWU B;  3BRV B;  2QM8 A;  3M91 A;  2OYI B;  2KYV A;  1JNM A;  2ZXE B;  5AW6 B;  2PAJ A;  3II6 A;  1NWQ A;  1RF0 A;  3HRN A;  1RE4 C;  1ZR4 A;  4W7Y A;  1ZLL A;  3M9H A;  1FZC B;  3KPE A;  2OAR A;  1LTJ C;  1L4A D;  3R2P A;  1SQX K;  4ZKP A;  2OYH C;  3RK2 D;  3H32 B;  4W80 A;  2H43 A;  1KZU B;  3TNU A;  2ZFC A;  1LTJ A;  3HE5 B;  1LTT C;  4JF7 A;  2Q3I A;  1N73 A;  5CJ0 A;  1NTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...