4BTFA

Structure of mlkl
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
454
structure length
413
Chain Sequence
DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFILFHEVNEKLRDVWEELLLLLQVPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTASSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
publication title The Pseudokinase Mlkl Mediates Necroptosis Via a Molecular Switch Mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 145
structure length 413
sequence length 454
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btfA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 4btfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btfA03
3ZLXA 3NSZA 4I21A 2UW6A 2UW5A 4F9BA 4I22A 2GNHA 3HV5A 4GRBA 5BX0A 2I40A 5DR9A 1YXXA 2XK4A 1ZRZA 4UMUA 4MVFA 4EQUA 2LAVA 2WGJA 3U9CA 1OUYA 2CKPA 3VJOA 4M13A 4MD7E 1JNKA 1ATPE 4XV1A 3RK5A 5CALA 4DLJA 3OVVA 4C4JA 4RFZA 2XJ0A 3ZTXA 4FG7A 2XK8A 5DHJA 5AUXA 4XNEA 1JKKA 3SAYA 5L8LA 1TQPA 3W16A 4EQMA 4WNMA 4GS6A 3CE3A 2OGVA 4II5A 5IQHA 3Q5ZA 2PYWA 1T46A 1LR4A 2WMAA 5HKYA 4KS8A 2ZMDA 5C4LA 3UNJA 1H07A 3L9MA 5KO1A 3EIDA 3VS7A 4DGOA 3V01A 4JX3A 3NWWA 4Z9LA 3R8PA 2ITTA 4ASXA 3ORTA 2BR1A 4I5CA 1W0XC 3R22A 4GVJA 4XG4A 4PPAA 3QTZA 3GB2A 4CMUA 4YBKA 5DG5A 4EC8A 5A4CA 3T3VA 4ZTNA 5DRDA 4K77A 3UVQA 3DNDA 3WZEA 1OIQA 4ITJA 4ZTMA 2X2LA 2Z7LA 3BRBA 3MPTA 2BZHB 3CPBA 4PPBA 5BYYA 5KMJA 2VWVA 3DZOA 4EHEA 3F88A 4U42A 4EKLA 3AGLA 2QOLA 3SA0A 2YN8A 4G3EA 4IJ9A 4BF2A 2VTNA 3QGWA 4U3YA 5J5SA 4OAUC 5IDPA 2VTHA 3FEGA 4BTJA 1Y57A 3WARA 1E1VA 3LFCA 2WTCA 4TN6A 3CS9A 4UMQA 4BGGA 4R1YA 3IONA 3GGFA 3VS2A 2PUNA 5EQPA 2RFSA 3OTVA 3F7WA 4YZDA 4FX3A 3JYAA 3NIZA 1O9UA 4OUCA 4AX8A 2IWIA 5ETCA 4DH3A 4J96A 4Z16A 4FNYA 3QLFA 4OTRA 2VZ6A 4YPDA 3OCTA 3U4WA 3AD4A 2VU3A 3OXTA 4D4VA 3CJFA 1E1XA 4LGGA 3ZM9A 1B38A 4FTRA 2RG5A 3CKXA 1ZMWA 5AX3A 5L6WL 4IZYA 3QZHA 3TNPC 3ZCLA 3Q9XA 3S4QA 4N6ZA 4ZLZA 3R63A 4DTKA 1ZXEA 2NNWB 4E6AA 2C6TA 4XJ0A 2WB8A 2PSQA 5HO7A 5JQ8A 4ZMEA 5E8ZA 4ASZA 2PZIA 5HE2A 5EM5A 3O17A 5EW8A 2XBJA 1Q8UA 3ITZA 4JR7A 2G15A 1PY5A 4CMTA 4EL9A 5IH6A 3LIJA 3DBFA 3SV0A 4Q2AA 3V51A 4M84A 4M68A 4ACDA 2XJ1A 3R0TA 4BCKA 4C59A 3O23A 3A7JA 3WYYA 4TWPA 2F7EE 3K5UA 1OKVA 4NK9A 1NA7A 1OL7A 2C0OA 4YZMA 3BLQA 2B9HA 2QHMA 4AW0A 5LMKC 2ETKA 4KSPA 3LXNA 3ULIA 1IAHA 3CLYA 3DZQA 4BY9E 4MTAA 5KMIA 3SVVA 3NCZA 4EUUA 4PMTA 4CZYB 1QPJA 4AT3A 4RJ5A 4EK4A 2XIKA 5AP1A 4AA5A 4FEVA 3BCEA 3DJ5A 4GUEA 5E8VA 3QQJA 4G2FA 1WBTA 4C0TA 1Q8TA 4ZAUA 5M07A 4UYNA 3Q4ZA 4ZTLA 1R39A 3UIBA 1XH5A 4E26A 3TACA 3PPJA 4PL5A 3FQSA 5E8UA 5HNGA 1FINA 4FKOA 5EDPA 3FLSA 4HCVA 1W84A 1XHAA 2C6DA 5HTIA 3R01A 4IWDA 3TZMA 2WMVA 3MJ2A 4CNHA 1PF8A 3P5KA 4GK2A 5DIAA 3Q3BA 4JS8A 5I4NA 3GBZA 1REKA 1U46A 1BUHA 2YISA 3GU7A 4U79A 4FIEA 2BZKB 3D5VA 4C58A 2NRYA 2W4KA 2PPQA 3UOHA 5IQDA 4DBNA 4J52A 5G6VA 3C4FA 2WTDA 4YC8A 2EB3A 4BCIA 3N4VA 4R1VA 4QMOA 2YJSA 2UZWE 4MX9A 1IAJA 3E5AA 3NUNA 1YI3A 1XBBA 5A3XA 5J1VA 2BILB 4O7YA 3KA0A 2GNIA 4FMQA 4FKQA 4UBAA 1Q24A 3DOGA 5HKMA 2JLDA 3F2RA 3OCBA 5AX9A 3UIUA 4G6NA 2HELA 2W1EA 3DKCA 3FJQE 4BTMA 4F9YA 3OY1A 3D7ZA 4FTOA 2HIWA 2FSMX 3LOKA 3ZHPC 4O0XA 4N57A 4AAAA 2R7BA 2HWPA 4O1OA 4YJUA 5J7BA 3CP9A 4S32A 4BHZA 2QURA 1DI9A 2WTKB 2QOIA 4WUNA 4CZTA 2OFUA 5ACBC 3NW7A 3WZDA 3DKFA 3QALE 4U5JA 5TO8A 4GT5A 1R3CA 4QP6A 3U54A 4GJ3A 1SYKA 5HG5A 5IUHA 3AC5A 2CGXA 4LL5A 5M4IA 2ITNA 3D15A 5L3AA 4J97A 3MY5A 4EUTA 4F7SA 3AT2A 3MBLA 2VO7A 3OWJA 4RX7A 4FIHA 2OJGA 3QD0A 4L67A 3THBA 2QG7A 4PPCA 4XX9A 5CVHA 4NEUA 3KXHA 2Y6OA 3RAHA 2OG8A 1PW2A 3EQDA 1OB3A 4IX6A 5EFQA 3RPYA 5CT0A 4ZJIA 2ZV8A 4TYJA 2ZV7A 4TNBA 1UWHA 2BHHA 5HBEA 3BU6A 2CLQA 1JKLA 4JG7A 2ITQA 3WI6A 5HKZA 4FV0A 3TIZA 4I94A 1QMZA 5HG9A 3IDPA 4KIQA 3UP2A 2VGOA 4IADA 3CTQA 4FK6A 1H27A 3RK7A 3C5IA 4FSNA 4E4MA 2C5VA 5I9WA 3EQHA 2C6LA 4QP7A 1VJYA 4XOYA 3RZBA 1BL7A 2VO0A 3KREA 4L46A 5CSPA 2WU6A 3UZPA 5FBOA 5L8JA 2Y4PA 2CKOA 3BBWA 1TQMA 4R3CA 2XK9A 1J3HA 2A27A 3O8TA 3FWQA 4MH7A 4MXOA 4AT5A 4UMRA 2J0IA 1ZY4A 4YJOA 5HGIA 4U7ZA 1R78A 4D1SA 4O81A 3E92A 4FR4A 5ANGA 5AAGA 4Y8DA 3FMDA 1M7NA 5G1XA 3DB8A 4JRVA 3QHRA 4YTIA 4JBOA 2JAMA 3IS5A 4ZTRA 3LFDA 4Y85A 2XS0A 3BE9A 3KCFA 4E8AA 4P5ZA 3BYVA 2QLQA 2R0UA 3GC0A 5KHXA 4IIRA 2WHBA 4YU2A 3MFUA 4ZY4A 4MAOA 3I5ZA 3UG1A 1XH4A 5F94A 4JR3A 3RPRA 3U8WA 4S2ZA 4EOMA 3VGOA 3I5NA 5LMAA 2PVYA 4CKIA 5HTCA 2XJ2A 3RAWA 4RZVA 3VVHA 1R1WA 3BZ3A 3LFNA 3VN9A 5CEOA 5T3QA 1X8BA 2ETMA 4JXFA 2X7GA 2VTMA 4Z55A 2PMLX 2VTPA 3KMUA 5A46A 3Q60A 5CU3A 4GJ2A 3W8QA 1KWPA 2NP8A 2OF2A 4FKJA 1G5SA 4FV2A 4FKUA 4O0WA 4V01A 3FLZA 3JVRA 3FV8A 1I09A 5AP6A 4BCHA 4FYNA 4JIKA 5DA3A 4R5SA 4IAKA 3QQKA 4FEXA 4IVDA 2W1CA 3VS6A 4E7WA 5KKRC 2PE0A 3ZXTA 3MTFA 5AR7A 5FDPA 1QL6A 5CY3A 3VS5A 4CFMA 4MEDA 3QKKA 2W7XA 4YZBA 1KV1A 3C1XA 4ANQA 3WIGA 3H9FA 3EL7A 4I92A 4JDIA 4JQ7A 3ALOA 3C0IA 2XKCA 3EQFA 4EH9A 2Y1MA 4IAZA 4TKSA 4RX5A 4YTCA 3Q9ZA 3BQRA 2Y4IB 3ALNA 5EKOA 4AACA 4DG0E 4FTKA 4R78A 4HJOA 3HX4A 3UO4A 3F5GA 3F5XA 4IBMA 5JH6A 3OBGA 4O7RA 1OPKA 1YKRA 3PG1A 2OK1A 4DGNA 3FMKA 4RGJA 3D7TA 2DWBA 4C2VA 3NGAA 4MNEA 5A6NA 2O65A 2Q0BA 5AM6A 1BX6A 2GNJA 3E3PA 4UYAA 4Y95A 4E4LA 3HV7A 4APCA 5CU0A 3HRCA 2XKEA 5IEVA 2QONA 2XYUA 4NFNA 3V3VA 4IEBA 1PJKA 4ERKA 2ZYBA 4FEUA 2GQGA 4XRLA 1ZY5A 4DTBA 3U4UA 4AU8A 5KBQA 3PWYA 3DLSA 4I6QA 4G6LA 3VRNA 4W8DA 4FTQA 4TTHB 1KE8A 2OIQA 4EWQA 4TYHA 5DVRA 4FTUA 4G5PA 2OKRA 3GOKA 4OT5A 4CSVA 2J0JA 2UW3A 4X3FB 1A9UA 1JLUE 3AC4A 4BCFA 4ANNA 3LFAA 2QNJA 4R3PA 2JEDA 1B47A 3PUPA 5I9XA 1SZMA 4R7IA 2EUFB 2RFNA 2W06A 2BFYA 1U54A 3SG8A 2OJIA 4RFMA 2W1DA 3FHRA 3LFBA 3TWJA 3TTJA 5HNIX 4EZ5A 4KIOA 4I6HA 1BLXA 3QTQA 4FKSA 4EQCA 3MVLA 2BIYA 4RA4A 3PA5A 2PVFA 3PSBA 5K3YA 5FRIA 3DS6A 3C7QA 2OJFE 4QYYA 5CENA 2J50A 2YA9A 5AUYA 3M11A 5FEEA 3NVMB 2CGVA 5DEWA 4PY1A 5DR6A 4E4XA 2XYNA 4LMUA 2BZIB 5GJGA 4YSMA 2R3RA 1M2PA 4AGCA 5CF8A 2RFDA 2NRUA 4EH7A 3G90X 3ANRA 4X21A 3UDBA 2VUWA 5C8KA 1OIUA 4FTAA 4FZDB 2BDWA 4LG4A 3O71A 4PL4A 4O21A 3Q04A 4IACA 5C26A 1YVHA 4RZWA 4WOVA 1BI7A 4QT1A 4DT8A 4ZZOA 3FZOA 4BWXA 4D2PA 1DI8A 4FT3A 4BYJA 5IH4A 3SG9A 4P7EA 5C8NA 2HZ4A 3NUUA 3R8LA 3W18A 2BROA 5EK7A 4ANLA 4RJ8A 2O64A 3QCQA 3R71A 2C5YA 4M66A 4D9TA 3KQ7A 4HCTA 5DNRA 3BWFA 4K9YA 3R2YA 5F1ZA 4FNZA 1JVPP 2V55A 4O7ZA 5BYLA 3MYGA 3HV4A 4XBUA 5ANEA 4AZWA 2VWBA 2PVMA 3QF9A 1SMHA 4EOJA 4RVMA 3DAJA 5CAVA 4QMPA 1S9JA 4DEHA 2XNMA 3FL5A 2XIXA 4A4LA 2C5NA 2Y4IC 3E8NA 5CZIA 4EHZA 1DAWA 2JITA 4D5HA 3OWPA 3CY3A 2ZM3A 4AN3A 4UXLA 4XP0A 5ANDA 4F08A 5E90A 3OCSA 2YM5A 3E62A 2CNQA 2QOHA 4W4WA 5F95A 5AAFA 3M2WA 3HUBA 3QQUA 4MKCA 3LCTA 3HV6A 2ZB1A 3MFRA 3KF4A 3QUPA 4FTTA 5CEMA 4YHFA 3Q9YA 4YJRA 5CT7A 5AA9A 3LLAA 1ZYCA 2GMXA 3OWKA 4FV1A 4PDYA 2F49A 3A62A 2C4GA 3FXWA 1ZWSA 4FV3A 1ZYLA 2YM3A 3GU4A 2W4JA 3QTSA 4IB5A 5DFPA 4C3PA 5IEXA 3MDYA 4HCUA 1Y91A 4C02A 3H0ZA 2X7OA 4MCVA 4AGUA 3R7VA 4IHPA 5AWMA 2GCDA 2F7XE 3G51A 5IKWA 4M15A 2VX1A 3W8LA 3EYHA 3UJGA 3QGYA 1PXKA 4EWHA 4KS7A 4FZ7A 4QYGA 1FVRA 4QMYA 2EXEA 3NZ0A 4AWIA 4YHJA 2BRBA 3VRZA 3RCJA 1ZYSA 3I4BA 4RVLA 1CKPA 3Q96A 4G3CA 4HZRA 3EJ1A 3GCPA 3BUMB 3ZMMA 2ZV2A 4KB8A 3ZLYA 4F9CA 2JDVA 3IQ7A 4J1RA 2YDIA 2R3KA 4F9AA 3E63A 2CBLA 2IW8A 2BFXA 3AC1A 2J0MB 4IFCA 3MTLA 4MHAA 4FNXA 2ITZA 1U5RA 1KOBA 3EFWA 3OEZA 3I6WA 5J8IA 1U59A 4ASEA 3PVGA 2X8IA 5A9UA 3I6UA 4JLCA 1H25A 4FKLA 2JC6A 2VWWA 2XM8A 3FI4A 3MVJA 3KXMA 4PTEA 4YR8A 3BHUA 4N4SA 3II5A 1SM2A 4QMWA 2XNEA 5AV2A 1OM1A 3C4CA 5CASA 3NYNA 3QWJA 3RKBA 4FTIA 5KNJA 2R9SA 2WPAA 4OTFA 4FI1A 4JG8A 3COHA 3RWPA 4B8MA 4DFLA 4JAIA 5HCYA 1GZ8A 3A60A 3UPXA 4BIEA 1WBSA 3GQIA 4KSQA 5C9CA 3TV7A 3ATSA 4DGLC 4L52A 5HICA 4HW7A 2X9EA 3KK8A 4NJDA 4AZSA 4GEOA 4O96A 1YOMA 1PYXA 3BELA 3OUNB 3DFAA 5CSHA 4ORKA 1W8CA 2W4OA 3PSCA 2OF4A 5C8MA 4BDDA 2VWZA 4X6RA 3Q4TA 4I6FA 3RAKA 3VIDA 2GSFA 2ONLA 3VW8A 4FOCA 2ZDUA 4FZAB 3JUHA 5D7AA 4DC2A 2YIWA 2ZAZA 4BB4A 5EH0A 3CQWA 4BI1A 4QPMA 4DGGA 3FKLA 2PVRA 2QR8A 3CR0A 4G3DA 3MI9A 3U55A 2YEXA 4K6ZA 3MIAA 3JY0A 4JI9A 4EJNA 3BUNB 5IQIA 1JOWB 1H1RA 3MB6A 4IJPA 1HCLA 4BKZA 3LFFA 5M06A 3KRXA 3KU2A 4YP8A 1CDKA 3PPZA 4BCNA 4W4YA 1PXPA 2G2FA 2G2HA 3DPKA 4W8EA 4OTGA 5D11A 5C1QB 2YZLA 5ANIA 4U80A 4BCGA 2XP2A 3R83A 1XBCA 3S2PA 3HDNA 4FYOA 4E5BA 5KMKA 4YNOA 5IDNA 2PE2A 4F09A 3L9PA 1ZOGA 4YJVA 4F1TA 5DE2A 2QVSE 2GS7A 5JFVA 5J7HA 4FV7A 2QOFA 1OKYA 4C35A 4FV4A 3ORXA 3P9JA 1MRYA 5A14A 3BU5A 4AT4A 1FMKA 4D28A 3UGCA 1Q61A 2X39A 3K3JA 4YUQA 1RDQE 4I4EA 3UO6A 3HNGA 4KIPA 2PUIA 2PZPA 2W96B 2X7FA 4LUDA 4CZUA 4QQTA 1Q97A 3IPHA 4E5AX 5A6OA 2B9IA 3QX2A 4IM3A 1ERKA 1OI9A 3PLAE 5CF6A 3HUCA 3W2PA 2BDFA 3WF6A 4EHGA 5JQ5A 1M17A 1PXNA 4TZRA 4FKGA 2BRGA 3QUEA 2G01A 4YJTA 5CNOA 5TF9A 5AR8A 4ZMFA 3BUXB 2J90A 4B0GA 3K3IA 4IX5A 4V04A 5K5NA 3IOPA 1KE5A 3OCGA 3BYSA 3SKCA 2QR7A 3KC3A 4J7BA 4MNFA 1ZZ2A 2BAKA 2PVKA 5E8SA 4CYIA 3EFJA 4IZ7A 4WNOA 2Z2WA 4M0YA 4A9YA 2HW6A 4L01A 3TNWA 4MBJA 3E64A 2C30A 2YACA 2CNVA 1GNGA 3IG7A 2X1NA 3AMBA 3S95A 3RGFA 3OTUA 5EW3A 3BKBA 2WMUA 5EDRA 5BUJA 1H08A 1HOWA 3ORKA 4C8BA 3EN9A 3SXSA 2YM4A 1BL6A 4RIXA 3CPCA 1YI6A 5TR6A 3BV2A 3ZEWA 2IZUA 1GZNA 3A7IA 4YGAA 4DH1A 4O86A 5CANA 4EEVA 5HESA 1F0QA 4XG7A 4ZS0A 4DFBA 4AGWA 4RA5A 2VD5A 2QCSA 4ZJVA 1WZYA 3PJ2A 3RI1A 3V8WA 1J7IA 5AV0A 5AIKA 4CFNA 3DQXA 2YAKA 2PVJA 3ENHA 3QAME 4GK4A 3HLLA 3OROA 4MD8E 4TW9A 2I6LA 2B0QA 2YCSA 5BUIA 2F7ZE 3NS9A 4AZVA 1WBOA 3FUPA 4M69A 1YQJA 3A99A 2W5AA 3TM0A 1JSUA 1WVYA 2G2IA 3COIA 5T6KA 4A9RA 4DEEA 4AP7A 5GZ8A 3CSVA 3FYJX 1Q8YA 3QA8A 1YXTA 2GNFA 5IF1A 4R8QA 4XG3A 1FPUA 5CSXA 4ZSEA 1F3MC 4PDPA 3PTGA 4APPA 4ACHA 3QZFA 3VBXA 2BHEA 3OOGA 4WT6A 4F0FA 2WMBA 4RIYA 4LI5A 5HOAA 2GDOA 3NUPA 4WA9A 1H1WA 1ZYJA 3W2QA 5CAPA 4IM2A 4NL0A 1FOTA 1MQBA 3ELJA 2BZJA 1RE8A 5DWRA 3ZBFA 2PY3A 3KXGA 4I20A 4WG3A 2XRUA 4CQGA 3R7OA 4BBEA 1ZMVA 5JZNA 5EM7A 5J9LA 3Q2JA 1NVRA 1OIYA 2FYSA 2J9MA 3FE3A 5L6OA 3ORLA 2WQEA 2PHKA 1NW1A 3CKWA 2BVAA 4H05A 3CEKA 2CKEA 4H39A 5KZIA 5EI8A 4FSUA 5HHWA 4EK6A 5CEPA 4I23A 1J91A 1H01A 3KK9A 3TI1A 3BGPA 4JAJA 4XG6A 5AJQA 2OXYA 1CMKE 2CN5A 4CFUA 4BCOA 4BDAA 2WMWA 4ZJJA 5A4EA 4C61A 5EOBA 4EZ7A 4WD5A 2XNNA 4PMSA 5DEYA 4AOIA 4J71A 3OOMA 4I93A 4KRDA 5E1EA 3TIYA 3ODYX 4FE2A 4C36A 2YM7A 4Z7HA 1GIHA 2IZTA 3OUKA 4WBBB 2ZM4A 3PXYA 4ALWA 3EFLA 4F65A 2P0CA 3RM6A 2PZRA 4RPVA 2C47A 2YDKA 3CY2A 3MPAA 4QYEA 1F5QA 4ENXA 3NUAA 4KUJA 3Q2MA 2Q83A 2JIUA 4R7BA 3Q53A 3BI6A 4M67A 4YC6A 2RSVA 3OG7A 5GHVA 1OKZA 4Q5EA 3EZRA 3R8ZA 2VTRA 4XH6A 2RL5A 1APME 4FZFB 4FF8A 4RC3A 1UU7A 3GT8A 4O83A 3SRVA 5KUPA 1ZMUA 3PY3A 4TL0A 4FTCA 4LUEA 5AP5A 5A4QA 3IW4A 4LOPA 3W2RA 2CLXA 2C1AA 5CU2A 2HZ0A 3IGGA 4PL3A 2JAVA 4XCUA 2JGZA 2P3GX 2XNOA 4O0SA 2ITUA 3EQCA 4RJ4A 5IQEA 3ZBXA 4ASDA 1ZYDA 3BBTB 3WBLA 4B6LA 4PF4A 5E92A 1XH7A 1MUOA 2B4SB 2JKKA 5CSVA 3UE4A 4CFVA 3LXKA 1IA8A 4FT7A 4KABA 3QWKA 3AG9A 3KXZA 3FC2A 5JK3A 3NNXA 2OJ9A 3ZZEA 5CVFA 1Q3WA 3PJ1A 4HVGA 2WIPA 5K5XA 5HD7A 4O6LA 5LWMA 4RLLA 1BKXA 3FI2A 2JFMA 4ARKA 3CCNA 2VTJA 3SW7A 4BGQA 3NYVA 4YJQA 3OP0A 4RJ6A 2WZJA 3VC4A 3DV3A 4HVIA 2ERKA 3NRMA 2VWYA 3RP9A 5IMEA 4C4HA 1UA2A 2EWAA 3AD6A 3BUOB 3EQBA 3W55A 3UODA 3GCSA 3O0GA 4NYEA 4YNEA 3UIMA 3D7TB 5AUVA 4BZDA 3CBLA 1AQ1A 4O7LA 4I0SA 4FIIA 4I3ZA 3EN5A 4EH4A 1NXKA 2X9FA 2QC6A 2VTIA 2WTWA 3AMAA 4MNEB 4QMVA 4X2JA 4NM7A 4QMZA 5FEQA 5H2UA 2IZRA 5EYCA 5H3QA 4FT0A 4L53A 5JN2A 4DE4A 4GG5A 1XO2B 2W1HA 4QQCA 2V62A 4U9AA 3U6IA 2YWVA 4GW8A 2YIQA 4BDHA 5HIEA 4YZCA 1Z5MA 3OFMA 5BVKA 4PTCA 2QO9A 5HE1A 3GFEA 3WZUA 2Z7QA 3WILA 4L3JA 4NUSA 5ANJA 1YXVA 4C4GA 4JQEA 2C3LA 3O96A 4BVUA 3TXOA 3RPOA 3KL8A 2XF0A 4XLVA 3C5UA 3P23A 4L8MA 4NZWB 5BVFA 4ZTQA 5HLNA 4TYHB 3AC8A 2R3LA 3HKOA 4EOPA 5BVWA 1I44A 4FKPA 2YITA 4E6CA 4FIJA 4LOQA 3C51A 4L44A 5B0XA 4V0GA 2QODA 2XMYA 3SHEA 1XJDA 4JRNA 2QKWB 3HYHA 2W1GA 2XKDA 3F3ZA 1U54B 3LZBA 3LHJA 2VTOA 4XHKB 4E73A 5LVPA 1Q99A 2UVYA 4BZOA 4X2KA 3FMLA 4HGSA 4U6RA 3U51A 4KA3A 2GTNA 3IDBA 1Y6AA 4FV9A 1Z57A 4ITHA 4MF0A 5E1SA 5CS6A 4AFEA 2YHVA 3R7UA 3SC1A 3IW6A 4RBLA 2C5OA 4F9WA 4BDIA 4ALVA 4BCQA 5M4FA 4A4CA 4OTQA 3DKOA 4DEDA 4ITIA 3COMA 3RPSA 2XA4A 3FPMA 5A4TA 3Q32A 2QI8A 3AT3A 4H36A 4OTDA 4O7VA 3G0EA 5IA1A 4H58A 1VZOA 1MP8A 5AA8A 4MD9E 4O0TA 1H0VA 2XK3A 2HZIA 4AW5A 5HU9A 1JAMA 2IO6A 4YJSA 3C9WA 5CEQA 3DBQA 3COKA 3BU3A 5FGKA 5HVJA 4NCTC 2X8DA 2CHLA 3F61A 3O50A 4MXZA 2RGPA 2UZEA 2J0LA 1IA9A 5M09A 1TQIA 3R28A 4RWJA 1UU9A 4W9WA 4XG2A 2NO3A 5D9HA 4QP1A 3NAXA 4CG9A 1JKSA 3P4KA 4RVTA 2YWPA 4EOIA 3F66A 5AR5A 2PVLA 2YIRA 1W83A 3KMWA 4FG9A 3CC6A 3NUYA 2OICA 3RWQA 4IW0A 4TY1A 4NM0A 3LCOA 3AC2A 5GINE 3C13A 4U40A 3LM0A 3E8CA 5HNBA 4EI4A 2ITWA 4EH2A 4EOQA 3OXZA 2H8HA 3PLSA 5JFWA 4QMMA 5TOZA 3WZJA 4DEGA 3UOKA 4FVQA 1YW2A 4A9UA 3ZZWA 4D1ZA 3R30A 3QZGA 2R0IA 2V5QA 3LXLA 3VRQA 4QP4A 3V8SA 4F7NA 4MXYA 4AZTA 3ORPA 4I41A 3QU0A 4O91A 3OB1B 4LGDA 3NYXA 1OUKA 2XIZA 3L8SA 4E4NA 1Z9XA 3RCDA 1OPLA 4KRCA 2BKZA 5B2KA 3LM5A 2C1BA 4PDOA 4YLKA 3A7GA 3QRKA 5E8YA 5KMOA 4OT6A 1PXMA 2C3KA 1OL6A 2CPKE 2QKRA 5FP6A 3OC1A 4CT1A 4EYMA 4UWCA 4X2NA 3TG1A 3V5WA 4F1OA 2WOTA 4F7LA 1PMVA 4IX3A 3M42A 4FUXA 3P0MA 4X2FA 5GZ9A 4YHTA 5HIDA 1ZAOA 4XOZA 4BRXA 4E6DA 4FKIA 4DITA 5LMKA 4YC3A 4ANOA 2QOOA 3KRLA 3QQGA 3PE2A 4Z3VA 5KMNA 3TUCA 1A48A 5AM7A 4FC0A 3TDVA 2VNYA 3HV3A 5J9ZA 1OBDA 4JBQA 1T45A 3F7ZA 4JNWA 1NVSA 3QFVA 5DRBA 3GC7A 3GXLA 2YIXA 4U81A 4ZEGA 4EORA 4QNYA 2UZBA 3C4EA 4YLJA 5HBHA 5K0XA 1PXLA 4JT3A 3LQ5A 2WAJA 2YCRA 3F2AA 2E9VA 3QQHA 3VS0A 3MY1A 4ZOGA 1VYZA 2RKUA 3FZ1A 3R8VA 2UW0A 5E8XA 3VHKA 3PFQA 4G34A 2FGIA 3DK7A 2FSTX 3G6GA 3E8EA 3HP5A 4KBKA 4BDGA 3PRFA 3DDQA 3DY7A 4FICA 5DGZA 3MN3A 3BHTA 3DJ7A 2UVZA 5ACKA 2E9NA 2VTLA 2OH4A 4CFFA 3VO3A 3W2OA 1OZ1A 5J1WA 4GH2A 5D10A 3R9OA 3RHKA 5CQUA 1KE9A 4D4SA 2I0VA 1H24A 1WVWA 3DFCB 5CI6A 3UQGA 4CVAA 3KY2A 4CV9A 5FXQA 2XVDA 4IB3A 4EBWA 3CGOA 1J7LA 3KMMA 3BWJA 2B9FA 4ZZNA 1AGWA 3QRJA 5AUWA 3U6JA 4ZS4A 4ZK5A 3VBTA 4LFIA 2EU9A 5FP5A 3WIKA 4D58A 1BYGA 3OP5A 5HO8A 2JKQA 2WTKC 4PX6A 4TPTA 4D2RA 1SVHA 4S30A 5JGDA 4X7QA 4JOAA 3KRWA 2Z60A 4NH1A 5ETAA 3TKUA 4HPTE 3PLFB 3A4PA 4ACMA 1PYEA 2QHNA 2WO6A 4M12A 4HZSA 4IANA 3CIKA 3LVPA 3RTPA 4TYEA 3QD4A 4JBPA 4JDJA 4RG0A 4CD0A 1URCA 2Z7SA 1UV5A 3V5LA 3B2WA 1ZARA 4LQMA 3DAKA 3ZEPA 3VRYA 4D9UA 4O7NA 4KKEA 4MBLA 5GJFA 2WMQA 4A4XA 2PMNX 5IQCA 1J1BA 1URWA 3UIXA 1FMOE 4G9CA 2GHLA 4HYHA 4GFMA 3G0FA 2CGWA 4KBAA 5JFSA 5L8KA 4AOJA 3R2BA 4ACCA 4F6UA 2OSCA 2UZLA 2XIYA 4BBMA 4N6YA 4FL3A 1OECA 1YWNA 2OIDA 2QOCA 3E7VA 5DPVA 3RNIA 2FSLX 2P2HA 3C4WA 4WG4A 4HVDA 5L2WA 2Y6MA 2X81A 3N9XA 1V0OA 1ZOHA 3F5UA 3LJ0A 4QQ5A 1CSNA 3M1SA 5FBNC 2FVDA 3T8OA 2PUUA 4ONAA 3WF7A 4OW8A 3ZO4A 3QYZA 3FLQA 1G8AA 3E93A 4YBJA 2VWXA 4QP3A 5J5TA 2XM9A 3HZTA 3HP2A 4FSZA 4PMMA 5FEDA 5FXRA 3V5QA 2A2AA 3KN6A 1P5EA 3TNIA 2BKKA 5FM3A 3VBYA 1JPAA 1AD5A 2FSOX 5L4QA 4P2KA 3VROA 1JKTA 3K5VA 2YLFA 4DGMA 2HAKA 2ETRA 4HGLA 4M97A 2JDSA 1UU8A 3O7LB 3ORNA 4KIKB 4PWNA 5IA3A 3DA6A 1O6KA 2ZJWA 2IVTA 3DDPA 4Y5HA 3KULA 4IAAA 2REIA 3CD3A 2VRXA 2CCHA 2B9JA 4MQ2A 4EOOA 4F7JA 3ZFXA 1OGUA 4AG8A 2O5KA 2F2CB 5BMMA 3GC8A 3T3UA 4J8MA 5E91A 2X4FA 3A2CA 4RIXB 5HU3A 4GU9A 3DBDA 3MIYA 4UX9A 2C6IA 2Z7RA 3C4ZA 2PMIA 2VWIA 3HDMA 5LARA 5KMMA 4J95A 4BDFA 3POOA 1JSVA 5LOHA 3AMYA 3HGKA 3PWDA 1KE7A 4O2ZA 4RVKA 2UW7A 4O2PA 1V1KA 2HOGA 5HX6A 1VR2A 3RK9A 3IDCA 3QKMA 4P5QA 3IGOA 3LE6A 3R7YA 3ZRKA 4ANSA 4XG8A 5LCJA 3UVPA 4EC9A 4GCJA 3OZ6A 3PXZA 2H9VA 4G5JA 4S34A 4DN5A 4K1BA 4G17A 4L6QA 4M69B 5K4JA 3P79A 4DFNA 4FSYA 3DXPA 3TKIA 3UQCA 3IKAA 4WRGA 3UBDA 3ZRMA 2X0GA 4PNKA 4XP3A 3PJ8A 4GPLB 3HAMA 4FKVA 3EHAA 3UZRA 4FV8A 4X3JA 5T68A 4FODA 1YHWA 1UKIA 3BE2A 4QP8A 4UWBA 2IG7A 4FSWA 4MWHA 4XLIA 4ZZMA 4FT9A 4FTLA 4HGEA 2E9PA 4JVGA 4RIYB 1WMKA 3ACJA 3H30A 4FSMA 3OXIA 4GIIA 4O38A 5AIRA 4DT9A 2WMSA 4PDSA 4QYHA 3O2MA 3VQUA 1CKIA 3WE4A 2CCIA 1Y8GA 3QTWA 3HECA 3NUXA 2C6EA 4ALUA 2CMWA 4QMXA 5DMZA 3RNYA 4XBRA 5L2QA 4LV5A 4NKAA 3S00A 2WEIA 5IQAA 2PVHA 4BIBA 4IVBA 3MJ1A 2Y1NA 2YCQA 4FGRA 3NR9A 3A7FA 3RM7A 1SNXA 4O7TA 3ZDIA 5IZFA 2R3FA 5EYDA 2BALA 4HYIA 2UZUE 4KBCA 4BR3A 4U8ZA 3UNZA 1H26A 2VX0A 1YOLA 3G2FA 3HVCA 4D1XA 2V7AA 5DH3A 5AP7A 3EL8A 5DT3A 3EZVA 4WO5A 4YPSA 5J95A 3V6SA 4QTCA 3S0OA 4K11A 2Y7JA 4QTEA 4XYFA 5HD4A 5AV3A 3TJDA 2X6EA 4FV5A 4FL1A 3KGAA 4X3FC 4YZNA 5HTBA 1B6CB 4GUBA 2WTJA 3VUKA 3PSDA 1MRUA 4RIWA 3U9NA 4BKJA 4QMSA 5KBRA 5AXIA 4N0SA 1IR3A 5HVYA 3UZTA 5IA2A 3K2LA 4UEUA 5AUUA 4K33A 4CT2A 1WBVA 2C0TA 4CCBA 3EOCA 4ZSJA 4ID7A 3LLTA 3PJ3A 2H6DA 4CYJA 4DLIA 4QO9A 2QLUA 4QP2A 4ZY5A 3U6HA 5EW9A 3SRVB 2A19B 2XNPA 4NW6A 4D2WA 4ANBA 2IZSA 3LFSA 3QQLA 3TJCA 1ZOEA 5KE0A 5F9EA 4FKTA 3FLWA 5L2SA 2B7AA 4WSQA 4BN1A 1MQ4A 3HL7A 4IVCA 2OW3A 2W99B 3T9IA 4GU6A 2JDOA 3A4OX 2UZTA 1WVXA 3VRPA 1RW8A 5J3XA 2P2IA 4BDKA 3R9DA 2QU5A 1WFCA 5EQYA 3R04A 3FMHA 4L7SA 3R1YA 5IU2A 4K18A 2VO6A 3UQFA 2AC5A 4RMZA 3D4QA 3ZNIA 3UC3A 4RQVA 2Z02A 1PXOA 4HYSA 4AZEA 1PXJA 4BZNA 5GZAA 4RWKA 1DS5A 3EFKA 4GMYA 4QMUA 2YLEA 5ETIA 5EG3A 5CAUA 5HZNA 5B7VA 4UZDA 5M51A 4MBIA 3CGFA 1XH8A 3Q52A 3HRBA 4BI2A 4O0RA 4FG8A 3JY9A 4OBOA 2WQMA 3D5UA 3IW8A 4I5HA 4MXCA 1REJA 5J87A 4ANMA 3HMIA 1S9IA 4UZHA 4JQ8A 3FI3A 4WNPA 5CAOA 4C4FA 2AYPA 4OBQA 3FQHA 5J9YA 4J99A 4IX4A 3FBVA 1LPUA 1Q8ZA 2LGCA 5JKGA 2X8EA 2F2UA 1H8FA 5FG8A 4ZSLA 1PMNA 5FTOA 3KVWA 3SXFA 3POZA 1KUTA 3R8MA 2HXLA 3WOWA 5M53A 4W4VA 2C5XA 5FLFA 5HCXA 1KE6A 4FOBA 2E2BA 2W1ZA 4CTBA 2VWUA 3IO7A 2OWBA 3NX8A 5A4LA 3QKLA 2R5TA 3N51A 5HKWA 1P2AA 4S33A 3ZS5A 1VYWA 2JBOA 3Q6WA 1P14A 2ITOA 4MK0A 5C03A 1J1CA 3VUDA 4FTMA 4V0GB 2YJRA 3ACKA 4UN0C 2A1AB 1Q4LA 3BEGA 1YRPA 3KKVA 3QL8A 3A61A 3FZSA 2C6KA 5ICPA 3GFWA 4PTGA 3F3VA 4GKHA 4O84A 2QOQA 3I0OA 5M55A 4R5YA 2CJMA 3R9NA 4HVHA 3GP0A 2XZSA 3RMFA 3S3IA 3TDWA 3AC3A 1YXUA 3EQIA 5IQBA 4NM3A 1FBNA 5BUEA 3DAEA 4BDEA 3UMWA 4M3QA 1JBPE 1GZOA 4Q5HA 5JSMA 1Y6BA 2GFSA 5AP2A 4BICA 3TN8A 1LEWA 3OHTA 4C57A 2OO8X 4E5WA 3V8TA 3VF9A 3PXRA 3NVKI 5IA4A 3LCDA 3O8PA 5DLSA 4D0XA 5GIOE 2O3PA 3N4TA 2C6MA 4AW1A 2ITPA 2UW9A 4U3ZA 3BHHA 3PA3A 5IA0A 3LQ3A 2WQBA 2Y9QA 2BPMA 4DTAA 3O51A 3A7HA 3GU5A 5IQFA 2V22A 5IG1A 5JRQA 3PPKA 4FA2A 3FXXA 4QMNA 3EKNA 2QU6A 3QHWA 4IQ6A 5HIBA 4EZ3A 3OB2B 5HEZA 5LXMA 4FNWA 3ZUTA 4N70A 2EXMA 3DT1A 3ZO3A 3G5DA 5EHYA 3LMIA 2W0JA 2JBPA 5HE3A 4FEQA 3ZFMA 3BGQA 3WF5A 2P4IA 3MB7A 4AA0A 4E6QA 3EN7A 4AN2A 4BL1A 2ZV9A 1Y8YA 4EH5A 4IH8A 4R77A 4CTCA 4YZ9A 4CV8A 2XCHA 3UOJA 2O8YA 4C34A 5JFXA 4NSTA 3ZOSA 4UB7A 2BRHA 4XV3A 4EH6A 5DI1A 1O6LA 4W9XA 1JSTA 3I0QA 3OEFX 5B2MA 3UO5A 4M0ZA 4U43A 4EH3A 1UNGA 2XCKA 1PMUA 5F4NA 1XBAA 2XH5A 5AAEA 3JS2A 2E9UA 3BV3A 4UMPA 5HE0A 5CWZA 4AS0A 3QC9A 2AC3A 2JIVA 4GYGA 3MA3A 4ZY6A 5AV4A 3QC4A 2VGPA 1Q5KA 2JKMA 3PVWA 5H8EA 4QMLA 3FPQA 3JXWA 2B53A 1YDSE 3R1QA 3SQQA 1OVEA 4CEGA 4RFYA 3W33A 2E9OA 3LMHA 4DFXE 2NPQA 4RJ7A 4D0WA 5I9VA 4O0UA 3NNUA 4RWIA 3ZDUA 3KRRA 4FKRA 4I5PA 1Q3DA 1UNHA 3KXNA 4JG6A 4BHNA 2OI4X 3BEAA 4WHZA 2VAGA 4IDTA 4YMJA 4IE9A 3OWLA 4CLIA 4A07A 3RPVA 4YSJA 4BGHA 4CQEA 4G9RA 2UZOA 5IH5A 5FM2A 2WTIA 1ZLTA 2W1FA 4WNKA 4IAIA 5E9EA 5F20A 5AUTA 3SX9A 2X2KA 3G15A 3DK3A 3DTWA 2ITXA 5CXZA 3ZSGA 1QPEA 4QPSA 4OR5A 3HA8A 3W2CA 3W1FA 1DAYA 1GZKA 2BIKB 4CFWA 1XQZA 1STCE 4QP9A 5CF4A 4JX7A 4EKKA 3AT4A 2FUMA 4JL9A 5EHOA 2BTRA 3ZSHA 4I0RA 3E7OA 5CEKA 1MRVA 3B8QA 2W9FB 4ACGA 4D2SA 4IM0A 3BX5A 2VTSA 3PXKA 2BCJA 5CAQA 4V05A 3D94A 2JD5A 2QO2A 3FLYA 3BYUA 3TV4A 1Q8WA 1YDRE 2JDRA 3FKNA 3R1SA 3TL8A 1Q62A 5CLPA 1M2QA 3ENMA 4U45A 4IVAA 2XK7A 2R2PA 1PKGA 2QD9A 2CKQA 4ZSGA 2B1PA 2HZNA 3EQPA 2H34A 3NCGA 3JVSA 5GNKA 4JIAA 4CRSA 3S1HA 3VBVA 4X6QC 3SDJA 4FSQA 3LPBA 3LW0A 3QD3A 2CNUA 1IRKA 4W4XA 2HXQA 3KF7A 4QOXA 4ZXTA 2X2MA 4QTBA 3ZC6A 2RG6A 3OW3A 2CN8A 1QCFA 4BKYA 5IQGA 3PZHA 2GQSA 4MF1A 3NUSA 4TT7A 5AP0A 4DFYA 4USFA 5L6PA 3KFAA 3I1AA 3LQ8A 3QLGA 4U0IA 2KULA 3D9VA 5IA5A 3ZLWA 4GKIA 4WSYA 3HMNA 3SLSA 4OAVB 4QD6A 2HCKA 3VS4A 4C3RA 5I5ZA 3C0HA 4YJPA 3G6HA 2VTQA 1PXIA 2VN9A 4G6OA 5K0KA 2OZAA 1LUFA 1QPDA 2HK5A 2XNBA 3F3WA 3IOKA 3VUGA 2YZAA 2R3QA 1CM8A 3MV5A 2R3NA 3MSSA 3F3UA 4GL9A 5E8TA 3I60A 3UNKA 4U41A 3MPMA 3PP1A 3TT0A 1V0PA 1U4DA 2QQ7A 3BHVA 3NW6A 1XR1A 3R21A 3CXWA 4CKJA 3R7IA 3CQUA 2OIBA 4OGRA 1OL5A 4JJRA 4Q9SA 4QRCA 4IWPA 4HGTA 3VQHA 2B55A 2PMOX 4G3FA 4XMOA 3OS3A 3ODZX 2BMCA 3KEXA 4XUFA 1Q41A 4CKRA 4RRVA 3T9TA 3FSKA 3W2SA 3RBWA 2BRNA 2YABA 3BGZA 4YJNA 4FTNA 5FTGA 3TZ7A 4FEWA 4DFUA 3WYXA 3EH9A 2R3GA 5CXHA 1L3RE 2UZVA 2WQNA 4Y46A 3Q4UA 2FO0A 2UW4A 5DBXA 5AADA 3MH1A 3QA0A 5FTQA 4RX9A 4FL2A 5I9UA 2X6DA 1OL2A 3VUIA 3VW6A 3VRRA 3WZKA 3FC1X 4LYNA 3GCVA 4GFOA 3UC4A 1J7UA 4TWNA 3H3CA 4K2RA 3A8XA 3HMPA 2WNTA 5JRSA 4H3QA 1W7HA 3FXZA 3L9NA 2OBJA 4F6SA 4LRKA 2C68A 3TNQB 5LCKA 2OJJA 4A9SA 4JDHA 2ZOQA 4DYMA 5HQ0A 4NIFA 3NIEA 3ORZA 5D41A 3KULB 2UVXA 4L7FA 4FZ6A 4O0YA 4GK3A 4M7IA 4P90A 4H3BA 4I0TA 3R6XA 1H1PA 3PP0A 5CQWA 4HYUA 3RVGA 4R3RA 5J79A 4GFGA 3R00A 3E87A 3H4JA 3ZRLA 3GQLA 4EK3A 1OBGA 4FVRA 3MH0A 3R1NA 3N4UA 1CTPE 4HPUE 3RALA 3ZM4A 4AUAA 3UYSA 3A8WA 3ORIA 4R7HA 3ZONA 3QCYA 4DINA 1UVRA 1H1SA 4CG8A 4I24A 5BPYA 2OH0E 2GS6A 3TV6A 4IDVA 3G33A 3KRJA 5E4HA 4OBPA 4FTJA 3FDNA 4QTDA 4OTHA 5AR3A 4BCPA 4XG9A 5JMSA 2ACXA 4QNAA 4KINA 3NEWA 4BDJA 1GAGA 4JDKA 5I3RA 4FVPA 2IVUA 3C50A 1R0EA 4O0VA 4C7TA 2W9ZB 5AFVA 1IG1A 4FIGA 4PP9A 2PWLA 5IMXA 2ZDTA 3P7CA 2HWOA 4J8NA 5AEPA 4EOKA 4WKQA 5EM8A 5LVLA 2WD1A 3O8UA 2QOKA 3EQRA 3F69A 3MVHA 4DAWA 5KKRB 2IPXA 4CRLA 1GOLA 2UW8A 2C3IB 2CSNA 1YVJA 4IAYA 3DQWA 4LGHA 4ZSAA 3TZ9A 2DS1A 1UU3A 2A4LA 4EOSA 3DCVA 2OLCA 4I4FA 4DEIA 4IZAA 2GPHA 4MQ1A 3R9HA 3NW5A 4BDBA 4C33A 5KX8A 4HNFA 5HG7A 4QMQA 5C4KA 3QCSA 3L8VA 3E3BX 3QYWA 4DH5A 1M14A 1PMEA 5CTPA 4BC6A 4IAFA 1KOAA 3HA6A 3G9LX 5BNJA 4UALA 4USDA 1FVTA 2C6OA 2P33A 3EMGA 5EHLA 3CQEA 4EJ7A 4Y83A 4DBXA 4TYIA 4F0GA 1UKHA 4FK3A 3NNWA 3JR1A 3EQGA 5HCZA 4F6WA 5FDXA 2PULA 4L68A 2FA2A 3C0GA 2J7TA 2GNGA 1H0WA 3HMOA 5EDQA 4XS2A 3NDMA 5BVNA 2G9XA 4G31A 4DEAA 3VF8A 3PYYA 3TCPA 4C4EA 1YI4A 1R0PA 4WIHA 4S31A 2W05A 3B8RA 3V04A 3PXFA 3R02A 5H8GA 4ZP5A 5M4CA 5IISA 4CLJA 4LL0A 4RIWB 4TXCA 1PRYA 2OFVA 2B52A 3E88A 2YERA 4RQKA 1WBWA 4H1JA 3GU6A 4I5MA 3LCSA 2WU7A 3CTJA 4UWYA 2PK9A 2DQ7X 2PVNA 2DYLA 2AUHA 3F2NA 3ANQA 4CXAA 3BQCA 3UYTA 3VUTA 2X4ZA 4M14A 3TUBA 2PUPA 4OTWA 5EQEA 4ZLOA 4HVSA 3L8PA 4X0MA 4PUZA 5E7RA 4LRMA 4AW2A 3PE1A 4B9DA 2ZM1A 3ZLSA 5EOLA 1LEZA 3ZUUA 1JWHA 1H00A 4EYJA 2J6MA 3DLZA 3VAPA 4BWPA 4QPAA 5CVGA 3ZU7A 4ZIMA 3GENA 2J5EA 4FKWA 2I0HA 4L43A 4USEA 2PU8A 4IZ5A 5CI7A 1ZZLA 2ITVA 2XKFA 3VULA 5I9ZA 2I7QA 3KVXA 3I79A 4A9TA 3IECA 2WMXA 3GOPA 4BBFA 4L3LA 4MWIA 4KKGA 4IMYA 1V0BA 1K2PA 3TUDA 4F63A 3MFSA 2JFLA 1NY3A 1YHVA 3FZPA 3F6XA 3IK3A 3NMUF 4F99A 2ZB0A 3HEGA 3FHIA 2Q0NA 2WELA 2EVAA 4K0YA 2GS2A 3DXNA 4C37A 5LVOA 4NCTA 3QUDA 4NTSA 1B39A 3G9NA 4IXPA 1U5QA 3FAAA 3PVBA 4RWLA 5ANKA 3DTCA 2R3MA 2O63A 3MGYA 1HCKA 1OL1A 5AMNA 4UY9A 4FV6A 4IWOA 3MFTA 3FL4A 4ZTHA 1O6YA 3H9RA 2QO7A 5CNNA 3FMEA 2UV2A 3HMMA 4H3PA 4BWKA 5I0BA 3ET7A 3KB7A 4FSTA 5HX8A 3UG2A 5CF5A 2R64A 2ERZE 3FZRA 3GCQA 4FIFA 3BYOA 4NFMA 4TWOA 1FGIA 2OZOA 3TKHA 3UOLA 3OW4A 3Q9WA 5DT0A 3VBQA 3W10A 1WBNA 4EK5A 2V7OA 3DBCA 3HRFA 1XWSA 2UUEA 3VUMA 3NPCA 1GY3A 3NYOA 4RIOA 5DT4A 3PVUA 4RT7A 3FI8A 3L1SA 2J0KA 3TEIA 3KCKA 4GT3A 1FGKA 2XB7A 4GG7A 4RC4A 1OIRA 5BYZA 4IB1A 4B7TA 4DG3E 3PJCA 4UXQA 4F4PA 4F64A 4FBXA 3P7AA 4BTFA 2YAAA 2PZYA 4NJ3A 4RLKA 5BQ0A 5FXSA 2HENA 5LMBA 3Q6UA 3DJ6A 4C2WA 4Y72A 2UZNA 1WAKA 4OLIA 3P1AA 4U97A 3CTHA 2C0IA 4C38A 1H28A 4C4IA 3QXPA 3OF0A 3K54A 4IB0A 4B4LA 2I0EA 1BI8A 3PFVA 2R3JA 5AR2A 2ITYA 3R73A 1NT2A 2RFEA 3FZTA 5H8BA 3EKKA 5JT2A 4QTAA 3LXPA 3U87A 4D4YA 2R3OA 5CU4A 2IW9A 3W32A 4Y5QA 5D12A 2J2IB 4NKSA 3QRTA 4O1PA 2XUUA 4GYIA 4UV0A 5EI6A 5ETFA 3REPA 5HG8A 1EH4A 2VTAA 2XK6A 4E20A 3LFEA 4YLLA 5DR2A 4EHVA 4DHFA 1CKJA 4IC8A 2EB2A 2YDJA 2W5BA 4GIHA 3ZO1A 3AXWA 4LV8A 3FQEA 3PRIA 3OBJA 4RSSA 3QXOA 2PZ5A 5E8WA 3V5PA 1XH9A 2GTMA 4I6BA 2HW7A 3UVRA 3FMNA 2XEYA 5IPJA 4DCAA 5M08A 1KV2A 4CGAA 3OT3A 3DU8A 3WE8A 3FMMA 4D2TA 1L8TA 3TZ8A 1ND4A 3SD0A 5IEYA 3PA4A 3FKOA 4E93A 4XV2A 3DGKA 4G3GA 5B2LA 5C01A 4UMTA 3D5XA 2QG5A 3NAYA 2WEVA 3VUHA 3BPRA 4BDCA 1TKIA 3MH2A 2ONLC 2WKMA 4KNBA 4D2VA 3ATTA 3Q4CA 3D5WA 5BVOA 5AV1A 2VO3A 5K9IA 2PTKA 3UPZA 3JPVA 3BUWB 4YTHA 3ROCA 2V0DA 3DXQA 3O7LD 2VNWA 3LKMA 4AOTA 5KZ0A 4L3PA 4D55A 2DUVA 4RC2A 3I81A 4IWQA 1H4LA 3QCXA 3H10A 5EYKA 4YTFA 3DBEA 1P4FA 2EXCX 2PL0A 3F82A 4PMPA 4O6EA 3OT8A 3SOCA 3AQVA 4KD1A 3DNEA 1H1QA 3PY1A 4LM5A 3D83A 3MVMA 2QOBA 1JQHA 4LRJA 3C4XA 1XKKA 3VNTA 4AZFA 2JKOA 4OTPA 3ID6C 4O7SA 3D0EA 5LQFA 2BRMA 4FT5A 4MXXA 3MH3A 4QYFA 5KMLA 3MESA 2W17A 5HO6A 2GNLA 2VV9A 4EK8A 3GC9A 5L2IA 4NTTA 4GVAA 3TTIA 3LMGA 3D2IA 3LJ1A 5D7VA 5LVNA 3IW7A 1M7QA 4EBVA 5IUIA 3GEQA 5C27A 4ZLYA 5EI2A 4A06A 1SNUA 3R8UA 2I1MA 3SXRA 3EN4A 4Z7GA 4MXAA 4D4RA 5K4IA 1GIIA 3PDTA 3FMJA 4J53A 2ZMCA 2BUJA 3R7GA 5HVKA 5JGAA 3BYMA 3I7CA 3QRIA 5EYMA 1G8SA 3NLBA 4DFZE 2JDTA 3QTUA 2WIHA 2HYYA 2YM6A 5CSWA 4XP2A 4PRJA 2RIOA 4YO6A 4WRSA 4M8TA 1LP4A 3SW4A 5CEIA 4CFXA 4PP7A 5KCVA 1GIJA 3PIZA 3ZH8A 5BMSA 4DCEA 1YDTE 2YIYA 3MW1A 3FLNC 2VTTA 3LFQA 3PXQA 4ZTSA 4FSRA 2B54A 4Y73A 4Q9ZA 4J98A 4BCJA 2ZVAA 5HLPA 2Y8OA 2XNGA 3KN5A 2CDZA 4O7WA 1W98A 5EKNA 3PG3A 2BDJA 4TRLA 3F3TA 4BYIA 5LVMA 2O0UA 4TWCA 3FYKX 5JZJA 2XEZA 3R7EA 4IC7A 1PKDA 3OD6X 4EOLA 4O82A 3PY0A 2GU8A 3DB6A 2FH9A 1A06A 3MY0A 3PZEA 2WOUA 4AE6A 1RQQA 1TVOA 3RINA 1GJOA 3FY0A 3WF9A 4AN9A 5CU6A 3QRUA 4WG5A 4PQNA 2WFYA 3VBWA 5HORA 2J5FA 4G16A 2WXVA 4A4OA 4BI0A 2F9GA 4AFJA 3P08A 4BFMA 5M4UA 1IASA 1P4OA 2W1IA 4TYGA 2UZDA 5ANOA 5DN3A 2OZAB 3OY3A 4EH8A 1YWVA 3QZIA 2KTYA 2R3HA 1IEPA 3MS9A 5CYIA 4L00A 5FWKK 4CMOA 4F70A 2C3JA 3Q5IA 2IN6A 1VEBA 5D1JA 1WCCA 3LAUA 3I7BA 4DG2E 3R9RA 3GUBA 3BLRA 3D2KA 3ERKA 2OU7A 2WTVA 2WQOA 4AA4A 3VHEA 3WF8A 3LJ2A 2GFCA 4BIDA 1YXSA 4E1ZA 4PNIA 5AP4A 3RHXA 3VWAA 3KXXA 3CD8A 3H9OA 3DK6A 4BCMA 5HI2A 3ETAA 3NNVA 1NVQA 4K8AA 3FY2A 3QX4A 4IFGA 3EYGA 4U44A 1WBPA 2H96A 5I3OA 4A7CA 5FQDC 2F4JA 4DH7A 5DYJA 2IJMA 1K9AA 4X2GA 2Y0AA 1M52A 3VS3A 3SGCA 1OMWA 2WMRA 1PHKA 5DOSA 5AR4A 3V5JA 2R3IA 3P78A 4LOOA 3GI3A 5CZHA 2C69A 3BHYA 4GSBA 5TE0A 3GVUA 4QMTA 4DH8A 1M2RA 3OMVA 3MA6A 2IVVA 4KWPA 3TNHA 3L8XA 5I9YA 5LWNA 3QD2B 4H1MA 1UWJA 4QQJA 2HY0A 1YOJA 1RJBA 3E8DA 4GT4A 3VJNA 4ERWA 1E9HA 1YWRA 2WMTA 3RAIA 2GHMA 5H9BA 2W5HA 3UMXA 3UP7A 4B8LA 3H0YA 4NW5A 5HBJA 3ORMA 4NM5A 2I0YA 4L45A 4L42A 2XBAA 2P55A 1OITA 2R4BA 4XRJA 3ZC5A 3QTIA 1OPJA 4HNIA 5JGBA 1FBVA 3IW5A 4NIFB 5CX9A 3RJCA 1YHSA 3L9LA 5GIPE 4X3FA 5IUGA 1BMKA 4GV1A 2CGUA 3QBNA 1FVVA 3ZO2A 2PE1A 2Z8CA 3UTOA 1UNLA 1SVEA 3ULZA 3ZFYA 2IVSA 2R3PA 4BTKA 4I1ZA 3QTXA 2A0CX 3AD5A 4O27B 1G3NA 3RZFA 3FSFA 2IW6A 4B99A 3ZSIA 2YCFA 4KAOA 4C3FA 4NWMA 2RF9A 4R6VA 4P4CA 3B2TA 4F1MA 3CJGA 4E3CA 4F0IA 2YFXA 5FD2A 5M57A 2GHGA 2SRCA 4KIKA 4NT4A 3AGMA 4MYGA 3V5TA 2J51A 4RX8A 4EONA 3HAVA 4KKHA 2BAJA 2ESMA 3F5PA 3P86A 5A54A 4C62A 2R7IA 2OXXA 1K3AA 4AF3A 3ROYA 4OTIA 5GJDA 3BLHA 4XV9A 4AXAA 5LJJA 4HOKA 4A4BA 2OXDA 4AGDA 4CCUA 4AE9A 3ZXZA 3EWHA 3GNIB 1QPCA 5FUTA 3LCKA 1DM2A 4WBOA 5EM6A 5AP3A 4DF3A 4AQCA 3ZYAA 4DEBA 3SOAA 2HY81 4NU1A 4WUAA 5KHWA 3QQFA 2XRWA 4YURA 2BAQA 5ITAA 3BIZA 3PIYA 4LMNA 4TNDA 4L9IA 2FB8A 4RJ3A 2G1TA 1KSWA 1W82A 3DKGA 5AUZA 3PIXA 1FQ1B 3VS1A 2BTSA 2F57A 4YO4A 1OKWA 2J4ZA 5M44A 3GCUA 3V6RA 4DA5A 4ENYA 3P7BA 2YM8A 4FGBA 3EN6A 3EB0A 5BVEA 4FUYA 5BVDA 2JIIA 1SVGA 2O2UA 3D14A 3F9NA 4O22A 4JBVA 5TT7A 1XH6A 4PV0A 4G1WA 4XEYA 5JEBA 2GQRA 3QTRA 5L2TA 3GU8A 5HLWA 5M56A 3MWUA 2VX3A 3ZUVA 4D5KA 3AOXA 2XIRA 5TKDA
chains in the Genus database with same CATH superfamily
3ZLXA 3NSZA 4I21A 2UW6A 2UW5A 4F9BA 4I22A 2GNHA 3HV5A 4GRBA 5BX0A 2I40A 5DR9A 1YXXA 2XK4A 1ZRZA 4UMUA 4MVFA 4EQUA 2LAVA 2WGJA 3U9CA 1OUYA 2CKPA 3VJOA 4M13A 4MD7E 1JNKA 1ATPE 4XV1A 3RK5A 5CALA 4DLJA 3OVVA 4C4JA 4RFZA 2XJ0A 3ZTXA 4FG7A 2XK8A 5DHJA 5AUXA 4XNEA 1JKKA 3SAYA 5L8LA 1TQPA 3W16A 4EQMA 4WNMA 4GS6A 3CE3A 2OGVA 4II5A 5IQHA 3Q5ZA 3O8ZA 1T46A 2PYWA 1LR4A 2WMAA 5HKYA 4KS8A 2ZMDA 5C4LA 3UNJA 1H07A 3L9MA 5KO1A 3EIDA 3VS7A 4DGOA 3V01A 4JX3A 3NWWA 4Z9LA 3R8PA 2ITTA 4ASXA 3ORTA 2BR1A 4I5CA 1W0XC 3R22A 4JYWA 4GVJA 4XG4A 4PPAA 3QTZA 3GB2A 4CMUA 4YBKA 5DG5A 4EC8A 5A4CA 3T3VA 4ZTNA 5DRDA 4K77A 3UVQA 3DNDA 3S9MA 3WZEA 1OIQA 4ITJA 4ZTMA 2X2LA 2Z7LA 3BRBA 3MPTA 3F9KC 2BZHB 3CPBA 4PPBA 5BYYA 5KMJA 2VWVA 3DZOA 4EHEA 3F88A 4U42A 4EKLA 3NFFB 3AGLA 3RBUA 2QOLA 3SA0A 2YN8A 4G3EA 4IJ9A 4BF2A 2VTNA 3QGWA 4U3YA 5J5SA 4OAUC 5IDPA 2VTHA 3FEGA 4BTJA 1Y57A 3WARA 4LDTA 1E1VA 3LFCA 2WTCA 4TN6A 3CS9A 4UMQA 4BGGA 4R1YA 3IONA 3GGFA 3VS2A 2PUNA 5EQPA 2RFSA 3OTVA 3F7WA 1Z9EA 4YZDA 4FX3A 3JYAA 3NIZA 1O9UA 4OUCA 4AX8A 2IWIA 5ETCA 4DH3A 1TFFA 4J96A 4Z16A 4FNYA 3QLFA 4OTRA 2VZ6A 4YPDA 3TYKA 3OCTA 3U4WA 3AD4A 2VU3A 3OXTA 4D4VA 3CJFA 1E1XA 2X0PA 4LGGA 3ZM9A 1B38A 4FTRA 2RG5A 3CKXA 1ZMWA 5AX3A 5L6WL 4IZYA 3QZHA 3TNPC 3ZCLA 3Q9XA 3S4QA 4N6ZA 4MCRA 4ZLZA 3R63A 4DTKA 1ZXEA 2NNWB 4E6AA 2C6TA 4XJ0A 2WB8A 2PSQA 5HO7A 5JQ8A 4ZMEA 5E8ZA 4ASZA 2PZIA 5HE2A 5EM5A 3O17A 5EW8A 2XBJA 1Q8UA 3ITZA 4JR7A 2G15A 1PY5A 4CMTA 4EL9A 5IH6A 3LIJA 3DBFA 3SV0A 4NGTA 4Q2AA 3V51A 4M84A 4M68A 4ACDA 2XJ1A 3R0TA 4BCKA 4C59A 3O23A 3A7JA 3WYYA 4TWPA 2F7EE 3K5UA 1OKVA 4NK9A 1NA7A 1OL7A 2C0OA 4YZMA 3BLQA 2B9HA 2QHMA 4AW0A 5LMKC 4NGMA 2ETKA 4KSPA 3LXNA 3ULIA 1IAHA 3CLYA 3DZQA 4BY9E 4MTAA 5KMIA 3SVVA 3NCZA 4EUUA 4PMTA 4CZYB 1QPJA 4AT3A 4RJ5A 4EK4A 2XIKA 5AP1A 4AA5A 4FEVA 3BCEA 3DJ5A 4GUEA 5E8VA 4BJJA 3QQJA 4G2FA 1WBTA 4C0TA 1Q8TA 4ZAUA 5M07A 4UYNA 3Q4ZA 4ZTLA 1R39A 3UIBA 1XH5A 4E26A 3TACA 3PPJA 4PL5A 3FQSA 5E8UA 4NGRA 5HNGA 1FINA 4FKOA 5EDPA 3FLSA 4HCVA 1W84A 1XHAA 2C6DA 5HTIA 3R01A 2JBJA 4IWDA 3TZMA 2WMVA 3MJ2A 4AXEA 4CNHA 1PF8A 3P5KA 4GK2A 5DIAA 3Q3BA 4JS8A 3W0RA 5I4NA 3GBZA 1REKA 1U46A 1BUHA 2YISA 3GU7A 4U79A 4FIEA 2BZKB 3D5VA 4C58A 2NRYA 2W4KA 2PPQA 3UOHA 5IQDA 4DBNA 4J52A 5G6VA 3C4FA 2WTDA 4YC8A 2EB3A 4BCIA 3N4VA 4R1VA 4QMOA 2YJSA 2UZWE 4MX9A 1IAJA 3E5AA 3NUNA 1YI3A 1XBBA 5A3XA 5J1VA 2BILB 4O7YA 3KA0A 2GNIA 4FMQA 4FKQA 4UBAA 1Q24A 3DOGA 5HKMA 2JLDA 3F2RA 3OCBA 5AX9A 3UIUA 4G6NA 2HELA 2W1EA 3DKCA 3FJQE 4BTMA 4F9YA 3OY1A 3D7ZA 4FTOA 2HIWA 2FSMX 3LOKA 3ZHPC 4O0XA 4N57A 4AAAA 2R7BA 2HWPA 4O1OA 4YJUA 5J7BA 3CP9A 4S32A 4BHZA 2QURA 1DI9A 2WTKB 2QOIA 4WUNA 4CZTA 2OFUA 5ACBC 3NW7A 3WZDA 3DKFA 3QALE 4U5JA 5TO8A 3PUFC 1W2DA 4GT5A 1R3CA 4QP6A 3U54A 4GJ3A 4JMQA 1SYKA 5HG5A 5IUHA 3AC5A 2CGXA 4LL5A 5M4IA 2ITNA 3D15A 5L3AA 3OAKA 4J97A 3MY5A 4EUTA 4F7SA 3AT2A 3MBLA 2VO7A 3OWJA 4RX7A 4FIHA 2OJGA 3QD0A 4L67A 3THBA 3SJEA 3SJGA 2QG7A 4PPCA 4XX9A 5CVHA 4NEUA 3KXHA 2Y6OA 3RAHA 2OG8A 1PW2A 3EQDA 1OB3A 4IX6A 5EFQA 3RPYA 5CT0A 4ZJIA 2ZV8A 4TYJA 2ZV7A 4TNBA 1UWHA 2BHHA 5HBEA 3BU6A 2CLQA 1JKLA 4JG7A 2ITQA 3WI6A 5HKZA 4FV0A 3TIZA 4I94A 1QMZA 5HG9A 3IDPA 4KIQA 3UP2A 2VGOA 4IADA 3CTQA 4FK6A 1H27A 3RK7A 3C5IA 4FSNA 4E4MA 2UV8G 2C5VA 5I9WA 3EQHA 2C6LA 4QP7A 1VJYA 4XOYA 3RZBA 1BL7A 2VO0A 3KREA 4L46A 5CSPA 2WU6A 3UZPA 3D7HA 5FBOA 5L8JA 2Y4PA 2CKOA 3BBWA 3UDTA 1TQMA 4R3CA 2XK9A 1J3HA 2A27A 3O8TA 3FWQA 4MH7A 4MXOA 2X0OA 4AT5A 4UMRA 2J0IA 1ZY4A 4YJOA 5HGIA 4U7ZA 1R78A 4D1SA 4O81A 3E92A 4FR4A 5ANGA 5AAGA 3FECA 2X0QA 3FMDA 4Y8DA 1M7NA 5G1XA 3DB8A 4JRVA 3QHRA 4YTIA 4JBOA 2JAMA 3IS5A 4ZTRA 3LFDA 4Y85A 2XS0A 3BE9A 3KCFA 4E8AA 4P5ZA 3BYVA 2QLQA 2R0UA 3GC0A 5KHXA 4IIRA 2WHBA 1ST4A 4YU2A 3MFUA 4ZY4A 4MAOA 3I5ZA 3UG1A 1XH4A 4FRFA 4JR3A 5F94A 3RPRA 4S2ZA 3U8WA 4EOMA 3VGOA 3I5NA 5LMAA 2PVYA 4CKIA 5HTCA 2XJ2A 3RAWA 4RZVA 3VVHA 1R1WA 3BZ3A 3LFNA 3VN9A 5CEOA 2XAMA 5T3QA 1X8BA 2ETMA 4JXFA 2X7GA 2VTMA 4Z55A 2PMLX 2VTPA 3KMUA 5A46A 3Q60A 5CU3A 4GJ2A 3W8QA 1KWPA 2NP8A 2OF2A 4FKJA 1G5SA 4FV2A 4FKUA 4O0WA 4V01A 3FLZA 3JVRA 3FV8A 1I09A 5AP6A 4BCHA 1Z8LA 4FYNA 4JIKA 5DA3A 4R5SA 4IAKA 3QQKA 4FEXA 4IVDA 2W1CA 3VS6A 4E7WA 5KKRC 2PE0A 3ZXTA 3MTFA 5AR7A 5FDPA 1QL6A 5CY3A 3VS5A 4CFMA 4MEDA 3QKKA 2W7XA 4YZBA 1KV1A 3C1XA 4ANQA 3WIGA 3H9FA 3EL7A 4I92A 4JDIA 4JQ7A 3ALOA 3C0IA 2XKCA 3EQFA 4EH9A 2Y1MA 4IAZA 4TKSA 4RX5A 4YTCA 3Q9ZA 3BQRA 2Y4IB 3ALNA 5EKOA 4AACA 4DG0E 4FTKA 4R78A 4HJOA 3HX4A 3UO4A 3F5GA 3F5XA 4IBMA 5JH6A 3OBGA 4O7RA 1OPKA 1YKRA 3PG1A 2OK1A 4DGNA 3FMKA 4RGJA 3D7TA 2DWBA 4C2VA 3NGAA 3KIOC 4MNEA 5A6NA 2O65A 2Q0BA 5AM6A 1BX6A 2GNJA 3E3PA 4UYAA 4Y95A 4E4LA 3HV7A 4APCA 5CU0A 3HRCA 2XKEA 5IEVA 2QONA 2XYUA 4NFNA 3V3VA 4IEBA 1PJKA 4OC2A 4ERKA 2ZYBA 4FEUA 2GQGA 4XRLA 1ZY5A 4DTBA 3U4UA 4AU8A 5KBQA 3PWYA 3DLSA 4I6QA 4G6LA 3VRNA 4W8DA 4FTQA 4TTHB 3BLAA 1KE8A 2OIQA 4EWQA 4TYHA 5DVRA 4FTUA 4G5PA 2OKRA 3GOKA 4OT5A 4CSVA 2J0JA 2UW3A 4X3FB 1A9UA 1JLUE 3AC4A 4BCFA 4ANNA 3LFAA 2QNJA 4R3PA 2JEDA 1B47A 3PUPA 5I9XA 1SZMA 4R7IA 2EUFB 2RFNA 2W06A 4P45A 2BFYA 4DHZA 1U54A 3SG8A 2OJIA 4RFMA 2W1DA 3FHRA 3LFBA 3TWJA 3TTJA 5HNIX 4QEBA 4EZ5A 1ST0A 4KIOA 4I6HA 1BLXA 3QTQA 4FKSA 4EQCA 3MVLA 2BIYA 4RA4A 3PA5A 2PVFA 3PSBA 5K3YA 5FRIA 3DS6A 3C7QA 2OJFE 4QYYA 5CENA 2J50A 2YA9A 5AUYA 3M11A 5FEEA 3NVMB 2CGVA 5DEWA 4PY1A 5DR6A 4E4XA 2XYNA 4LMUA 2BZIB 5GJGA 4YSMA 2R3RA 1M2PA 4AGCA 5CF8A 2RFDA 2NRUA 4EH7A 3G90X 3ANRA 4X21A 3UDBA 2VUWA 5C8KA 1OIUA 4FTAA 4FZDB 2BDWA 4LG4A 3O71A 4PL4A 4O21A 3Q04A 4IACA 5C26A 1YVHA 4RZWA 4WOVA 1BI7A 4QT1A 4DT8A 4ZZOA 3FZOA 4BWXA 4D2PA 1DI8A 4FT3A 4BYJA 5IH4A 3SG9A 4P7EA 5C8NA 2HZ4A 3NUUA 3R8LA 3W18A 2BROA 5EK7A 4ANLA 4RJ8A 2O64A 5ELYA 3QCQA 3R71A 4JZ0A 2C5YA 4M66A 4D9TA 3KQ7A 4HCTA 5DNRA 3BWFA 4K9YA 3R2YA 5F1ZA 4FNZA 1JVPP 2V55A 4O7ZA 5BYLA 3MYGA 3HV4A 4XBUA 5ANEA 4AZWA 2VWBA 2PVMA 3QF9A 1SMHA 4EOJA 4RVMA 3DAJA 5CAVA 4QMPA 1S9JA 4DEHA 2XNMA 3FL5A 2XIXA 4A4LA 2C5NA 2Y4IC 3E8NA 5CZIA 4EHZA 1DAWA 2JITA 4D5HA 3OWPA 3W0MA 3CY3A 2ZM3A 4AN3A 4UXLA 4XP0A 5ANDA 4F08A 2JBKA 5E90A 3OCSA 2YM5A 3E62A 2CNQA 2QOHA 4W4WA 5F95A 5AAFA 3M2WA 3HUBA 3QQUA 4MKCA 3LCTA 3HV6A 2ZB1A 3MFRA 3KF4A 3QUPA 4FTTA 5CEMA 4YHFA 3Q9YA 4YJRA 5CT7A 5AA9A 3LLAA 1ZYCA 2GMXA 3OWKA 4FV1A 2OOTA 2F49A 3A62A 2C4GA 3FXWA 1ZWSA 4FV3A 1ZYLA 2YM3A 3GU4A 2W4JA 3QTSA 4IB5A 5DFPA 4C3PA 5IEXA 3MDYA 4HCUA 1Y91A 4C02A 3H0ZA 2X7OA 5BV3A 4MCVA 4AGUA 3R7VA 4IHPA 5AWMA 2GCDA 2F7XE 3G51A 5IKWA 4M15A 2VX1A 3W8LA 3EYHA 3UJGA 3QGYA 1PXKA 4EWHA 4KS7A 4FZ7A 4QYGA 1FVRA 4QMYA 2EXEA 3NZ0A 4AWIA 4YHJA 2BRBA 3VRZA 3RCJA 1ZYSA 3I4BA 4RVLA 1CKPA 3Q96A 4G3CA 4HZRA 3EJ1A 3GCPA 3BUMB 3ZMMA 2ZV2A 4KB8A 3ZLYA 4F9CA 2JDVA 3IQ7A 4J1RA 2YDIA 1OGYA 2R3KA 4F9AA 3E63A 2CBLA 2IW8A 2BFXA 3AC1A 2J0MB 4IFCA 3MTLA 4MHAA 4FNXA 2ITZA 1U5RA 1KOBA 3EFWA 3OEZA 3I6WA 5J8IA 1U59A 4ASEA 3PVGA 2X8IA 5A9UA 3I6UA 4JLCA 4MCSA 1H25A 4FKLA 2JC6A 2VWWA 2XM8A 3FI4A 3MVJA 3KXMA 4PTEA 4YR8A 3BHUA 4N4SA 3II5A 1SM2A 4QMWA 2XNEA 5AV2A 1OM1A 3C4CA 5CASA 3NYNA 3QWJA 3RKBA 4FTIA 5KNJA 2R9SA 2WPAA 4OTFA 4FI1A 4JG8A 3COHA 3RWPA 4B8MA 4DFLA 4JAIA 5HCYA 1GZ8A 3A60A 3UPXA 4BIEA 1WBSA 3GQIA 4KSQA 5C9CA 3TV7A 3ATSA 4DGLC 4L52A 5HICA 4HW7A 2X9EA 3KK8A 4NJDA 4AZSA 4GEOA 4O96A 1YOMA 1PYXA 3BELA 3OUNB 3DFAA 5CSHA 4ORKA 1W8CA 2W4OA 3PSCA 2OF4A 5C8MA 4BDDA 2VWZA 4X6RA 3Q4TA 4I6FA 3RAKA 3VIDA 2GSFA 2ONLA 3VW8A 4FOCA 2ZDUA 4FZAB 3JUHA 5D7AA 4FJVA 4DC2A 2YIWA 2ZAZA 4BB4A 5EH0A 3CQWA 4BI1A 4QPMA 4DGGA 3FKLA 2PVRA 2QR8A 3CR0A 4G3DA 3MI9A 3U55A 2YEXA 4K6ZA 3MIAA 3JY0A 4JI9A 4EJNA 3BUNB 5IQIA 1JOWB 1H1RA 3MB6A 4IJPA 1HCLA 4BKZA 3LFFA 5M06A 1G8JA 3KRXA 3KU2A 4YP8A 1CDKA 3PT1A 3PPZA 4BCNA 4W4YA 1PXPA 2G2FA 2G2HA 3DPKA 4W8EA 4OTGA 5D11A 5C1QB 2YZLA 5ANIA 4U80A 4BCGA 2XP2A 3R83A 1XBCA 3S2PA 3HDNA 4FYOA 4E5BA 5KMKA 4YNOA 5IDNA 2PE2A 4F09A 3L9PA 1ZOGA 4YJVA 4F1TA 5DE2A 2QVSE 2GS7A 5JFVA 5J7HA 4FV7A 2QOFA 1OKYA 4C35A 4O4CA 4FV4A 3ORXA 3P9JA 1MRYA 5A14A 3BU5A 4AT4A 1FMKA 4D28A 3UGCA 1Q61A 2X39A 3K3JA 4YUQA 4MUQA 1RDQE 4I4EA 3UO6A 4BJJB 3HNGA 4KIPA 2PUIA 2PZPA 2W96B 2X7FA 4LUDA 3HPHE 4CZUA 4QQTA 1Q97A 3IPHA 4E5AX 5A6OA 2B9IA 3QX2A 4IM3A 1ERKA 1OI9A 3PLAE 5CF6A 3HUCA 3W2PA 2BDFA 3WF6A 4EHGA 5JQ5A 1M17A 1PXNA 4TZRA 4FKGA 2BRGA 3QUEA 2G01A 4YJTA 5CNOA 5TF9A 5AR8A 4ZMFA 3NFQA 3BUXB 2J90A 4B0GA 3K3IA 4IX5A 4V04A 5K5NA 3IOPA 1KE5A 3OCGA 3BYSA 3SKCA 2QR7A 3KC3A 4J7BA 4MNFA 1ZZ2A 2BAKA 2PVKA 5E8SA 4CYIA 3EFJA 4IZ7A 4WNOA 2Z2WA 4M0YA 4A9YA 2HW6A 4L01A 3TNWA 4MBJA 3E64A 2C30A 2YACA 2CNVA 1GNGA 3IG7A 2X1NA 3AMBA 3S95A 3RGFA 3OTUA 5EW3A 3BKBA 2WMUA 5EDRA 5BUJA 1H08A 1HOWA 3ORKA 4C8BA 3EN9A 3SXSA 2YM4A 1BL6A 4RIXA 3CPCA 1YI6A 5TR6A 3BV2A 3ZEWA 2IZUA 1GZNA 3A7IA 4YGAA 4DH1A 4O86A 5CANA 4EEVA 5HESA 3D7FA 1F0QA 4XG7A 4ZS0A 4DFBA 4AGWA 4RA5A 2VD5A 2QCSA 4ZJVA 1WZYA 3PJ2A 3RI1A 3V8WA 2XEGA 1J7IA 5AV0A 5AIKA 4CFNA 3DQXA 2YAKA 2PVJA 3ENHA 3QAME 4GK4A 3HLLA 3OROA 4MD8E 4TW9A 2I6LA 2B0QA 2YCSA 5BUIA 2F7ZE 3NS9A 4AZVA 1WBOA 3FUPA 4M69A 1YQJA 3A99A 2W5AA 3TM0A 1JSUA 1WVYA 2G2IA 3COIA 5T6KA 4A9RA 4DEEA 4AP7A 5GZ8A 3CSVA 3FYJX 1Q8YA 3QA8A 1YXTA 2GNFA 5IF1A 4R8QA 4XG3A 1FPUA 5CSXA 4ZSEA 1F3MC 4PDPA 3PTGA 4APPA 4ACHA 3QZFA 3VBXA 2BHEA 3OOGA 4WT6A 4F0FA 2WMBA 4RIYA 4LI5A 5HOAA 2GDOA 3NUPA 4WA9A 1H1WA 1ZYJA 3W2QA 5CAPA 4IM2A 4NL0A 1FOTA 1MQBA 3ELJA 2BZJA 1RE8A 5DWRA 3ZBFA 1XMMA 2PY3A 3S9LA 3KXGA 4I20A 4WG3A 2XRUA 4CQGA 3R7OA 4BBEA 2XEIA 1ZMVA 5JZNA 5EM7A 1XMLA 5J9LA 3Q2JA 1NVRA 1OIYA 2FYSA 2J9MA 3FE3A 5L6OA 3ORLA 2WQEA 2PHKA 2IEWA 1NW1A 3CKWA 2BVAA 4H05A 3CEKA 2CKEA 4H39A 5KZIA 5EI8A 4FSUA 5HHWA 4EK6A 5CEPA 4I23A 1J91A 1H01A 3KK9A 3TI1A 3BGPA 4JAJA 4XG6A 5AJQA 2OXYA 1CMKE 2CN5A 4CFUA 4DDGA 4BCOA 4BDAA 2WMWA 4ZJJA 5A4EA 4C61A 5EOBA 4EZ7A 4WD5A 2XNNA 4PMSA 5DEYA 4AOIA 4J71A 3OOMA 4I93A 4KRDA 5E1EA 3TIYA 3ODYX 4FE2A 4C36A 2YM7A 3NFGB 4Z7HA 1GIHA 2IZTA 3OUKA 4WBBB 2ZM4A 3PXYA 4ALWA 3EFLA 4F65A 2P0CA 3RM6A 2PZRA 3SJXA 4RPVA 2C47A 2YDKA 3CY2A 3MPAA 4QYEA 1F5QA 4ENXA 3NUAA 4KUJA 3Q2MA 2Q83A 2JIUA 4R7BA 3Q53A 3BI6A 4M67A 4YC6A 2RSVA 3OG7A 5GHVA 1OKZA 4Q5EA 3EZRA 3R8ZA 4NGNA 2VTRA 4XH6A 2RL5A 1APME 4FZFB 4FF8A 4RC3A 1UU7A 3BI1A 3GT8A 4O83A 3SRVA 5KUPA 1ZMUA 3PY3A 4TL0A 4FTCA 4LUEA 5AP5A 5A4QA 3IW4A 4LOPA 3W2RA 2CLXA 2C1AA 5CU2A 2HZ0A 3IGGA 4PL3A 2JAVA 4XCUA 4MCPA 2JGZA 2P3GX 2XNOA 4O0SA 2ITUA 3EQCA 4RJ4A 5IQEA 3ZBXA 4ASDA 1ZYDA 3BBTB 3WBLA 4B6LA 4PF4A 5E92A 1XH7A 1MUOA 2B4SB 2JKKA 5CSVA 3UE4A 4CFVA 3LXKA 1IA8A 4FT7A 4KABA 3QWKA 3AG9A 3KXZA 3FC2A 5JK3A 3AKLA 3NNXA 2OJ9A 3ZZEA 5CVFA 1Q3WA 3PJ1A 4HVGA 2WIPA 5K5XA 5HD7A 4O6LA 5LWMA 4RLLA 1BKXA 3FI2A 2JFMA 4ARKA 3CCNA 2VTJA 3SW7A 4BGQA 3NYVA 4YJQA 3OP0A 2N3AB 1VLRA 4RJ6A 2WZJA 3VC4A 3DV3A 4HVIA 2ERKA 3NRMA 2VWYA 3RP9A 5IMEA 4C4HA 1UA2A 2EWAA 3AD6A 3BUOB 3EQBA 3W55A 3UODA 3GCSA 3O0GA 4NYEA 4YNEA 3UIMA 3D7TB 5AUVA 4BZDA 3CBLA 1AQ1A 4O7LA 4I0SA 4FIIA 4I3ZA 3EN5A 4EH4A 1NXKA 2X9FA 2QC6A 2VTIA 2WTWA 3AMAA 4MNEB 4QMVA 4X2JA 4NM7A 4QMZA 5FEQA 5H2UA 2IZRA 5EYCA 5H3QA 4FT0A 4L53A 5JN2A 4DE4A 4GG5A 1XO2B 2W1HA 4QQCA 2V62A 4U9AA 3U6IA 2YWVA 4GW8A 4AXFA 2YIQA 4BDHA 5HIEA 4YZCA 1Z5MA 3OFMA 5BVKA 4PTCA 2QO9A 5HE1A 3GFEA 3WZUA 2Z7QA 3WILA 4L3JA 4NUSA 5ANJA 1YXVA 4C4GA 4JQEA 2C3LA 3O96A 4BVUA 4PDYA 3TXOA 3RPOA 3KL8A 2XF0A 4XLVA 3C5UA 3P23A 4L8MA 4NZWB 5BVFA 4ZTQA 5HLNA 4TYHB 3AC8A 2R3LA 3HKOA 1WJTA 4EOPA 5BVWA 1I44A 4FKPA 2YITA 4E6CA 4FIJA 3TMOA 4LOQA 3C51A 4L44A 5B0XA 4V0GA 2QODA 2XMYA 3SHEA 1XJDA 4JRNA 2QKWB 3HYHA 2W1GA 2XKDA 3F3ZA 1U54B 3LZBA 3LHJA 2VTOA 4XHKB 4E73A 5LVPA 1Q99A 2UVYA 4BZOA 4X2KA 3FMLA 4HGSA 4U6RA 3U51A 4KA3A 2GTNA 3PFYA 3IDBA 1Y6AA 4FV9A 1Z57A 4ITHA 4MF0A 5E1SA 5CS6A 4AFEA 2B4JC 2YHVA 3R7UA 3SC1A 3IW6A 4RBLA 2C5OA 4F9WA 4BDIA 4ALVA 4BCQA 5M4FA 4A4CA 4OTQA 3DKOA 4DEDA 4ITIA 3COMA 3RPSA 2XA4A 3FPMA 5A4TA 3Q32A 2QI8A 3AT3A 4H36A 4OTDA 4O7VA 4O4FA 3G0EA 5IA1A 4H58A 1VZOA 1MP8A 5AA8A 4MD9E 4O0TA 1H0VA 2XK3A 2HZIA 4AW5A 5HU9A 1JAMA 2IO6A 4YJSA 3C9WA 5CEQA 3DBQA 3COKA 3BU3A 5FGKA 5HVJA 4NCTC 2X8DA 2CHLA 3F61A 3O50A 4MXZA 2RGPA 2UZEA 2J0LA 1IA9A 5M09A 1TQIA 3R28A 4RWJA 1UU9A 4W9WA 4XG2A 2NO3A 5D9HA 4QP1A 3NAXA 4CG9A 1JKSA 3P4KA 4RVTA 2YWPA 4EOIA 3F66A 5AR5A 4P4JA 2PVLA 2YIRA 1W83A 3KMWA 4FG9A 3CC6A 3NUYA 2OICA 1EO0A 3RWQA 4IW0A 4TY1A 4NM0A 3LCOA 3AC2A 5GINE 3C13A 4U40A 3LM0A 3E8CA 5HNBA 4EI4A 2ITWA 4EH2A 4EOQA 3OXZA 2DLAA 2H8HA 3PLSA 5JFWA 4QMMA 5TOZA 3WZJA 4DEGA 3UOKA 4FVQA 1YW2A 4A9UA 3ZZWA 4D1ZA 3R30A 3QZGA 2R0IA 3UDSA 2V5QA 3LXLA 3VRQA 4QP4A 3V8SA 4F7NA 4MXYA 4AZTA 3ORPA 4I41A 3QU0A 4O91A 3OB1B 4LGDA 3NYXA 1OUKA 2ZFYA 2XIZA 3L8SA 4E4NA 1Z9XA 3RCDA 1OPLA 4KRCA 2BKZA 5B2KA 3LM5A 2C1BA 4PDOA 4YLKA 3A7GA 3QRKA 5E8YA 5KMOA 4OT6A 1PXMA 2C3KA 1OL6A 2CPKE 2QKRA 5FP6A 3OC1A 4CT1A 4EYMA 3W0SA 4UWCA 4X2NA 3TG1A 3V5WA 4F1OA 2WOTA 4F7LA 1PMVA 4IX3A 3M42A 4FUXA 3P0MA 4X2FA 5GZ9A 4YHTA 5HIDA 1ZAOA 4XOZA 4BRXA 4E6DA 4FKIA 4DITA 5LMKA 4YC3A 4ANOA 2QOOA 3KRLA 3QQGA 3PE2A 4Z3VA 5KMNA 3TUCA 1A48A 5AM7A 4FC0A 3TDVA 2VNYA 3HV3A 5J9ZA 1OBDA 4JBQA 1T45A 3F7ZA 4JNWA 1NVSA 3QFVA 5DRBA 3GC7A 3GXLA 2YIXA 4U81A 4ZEGA 4EORA 4QNYA 2UZBA 3C4EA 4YLJA 5HBHA 5K0XA 1PXLA 4JT3A 3LQ5A 2WAJA 2YCRA 3F2AA 2E9VA 3QQHA 3VS0A 3MY1A 4ZOGA 1VYZA 2RKUA 3FZ1A 3R8VA 2UW0A 5E8XA 3VHKA 3PFQA 4G34A 2FGIA 4OC3A 3DK7A 2FSTX 3G6GA 3E8EA 3HP5A 3W0PA 4KBKA 4BDGA 3PRFA 3DDQA 3DY7A 4FICA 5DGZA 3MN3A 3BHTA 3DJ7A 2UVZA 5ACKA 2E9NA 2VTLA 2OH4A 4CFFA 3VO3A 3W2OA 1OZ1A 2XPOA 5J1WA 2C6PA 4GH2A 5D10A 3R9OA 3RHKA 5CQUA 1KE9A 4D4SA 4NGPA 2I0VA 1H24A