4BTFA

Structure of mlkl
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
454
structure length
413
Chain Sequence
b'DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFILFHEVNEKLRDVWEELLLLLQVPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTASSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
publication title The Pseudokinase Mlkl Mediates Necroptosis Via a Molecular Switch Mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 145
structure length 413
sequence length 454
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btfA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 4btfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btfA03
1ZOGA 5AXIA 4U79A 2HIWA 1Q24A 4RIXB 4WT6A 2HY81 5CEQA 4BGGA 4NM3A 4J8NA 4OAVB 4O0SA 3NDMA 3CTJA 4W9XA 3TUDA 5EM6A 4TTHB 4PTGA 3MVLA 2PZ5A 2WOUA 4F7JA 4FVQA 3LHJA 2B54A 4IFGA 2YCRA 4K33A 2UZVA 4UYAA 1ZARA 5AUYA 4BKYA 3ZBXA 1ZWSA 2X8EA 4L68A 2QOOA 1KE5A 3BKBA 4QRCA 4ZAUA 3N9XA 4M7IA 3OCGA 3DFCB 1XBBA 2VTSA 3HA6A 4F9WA 3UIUA 3VQUA 1PRYA 1F5QA 4FEVA 5CSVA 4FKUA 4ANNA 4DGMA 1URCA 3WE4A 4IAIA 2WQEA 4PDYA 4IJ9A 4RLKA 4FSUA 1R3CA 1BMKA 3AQVA 5EHLA 4BL1A 1G8SA 2EVAA 5A4LA 4FV0A 3LLAA 3E8DA 4QT1A 1BL6A 5EFQA 3NYNA 4B0GA 2GQSA 4R8QA 5CSWA 2WO6A 2BILB 4MAOA 4U43A 3Q5IA 3F2RA 2XVDA 4EH9A 3PFQA 1CMKE 5HVKA 3RCJA 4L44A 4MXCA 4BCNA 2VWBA 5IH4A 4I92A 3NNVA 3G5DA 2OO8X 4I94A 3CGOA 5EI6A 5IG1A 1FVVA 2PHKA 2QHNA 3HMOA 5AV0A 2NP8A 4U6RA 3ODYX 3VNTA 5JKGA 3SVVA 3GEQA 5E90A 2WTKB 4ZLZA 3QRUA 3GC0A 4E8AA 1A9UA 1O6LA 4XOZA 3MN3A 5CSHA 4BDKA 2QOKA 4YC6A 2E9VA 5I0BA 4B9DA 3T8OA 4I4FA 2H6DA 3VIDA 5E1SA 3DY7A 4UN0C 5FEDA 2E9OA 3ZZEA 4BR3A 5CI7A 2XK7A 5D12A 5DPVA 4PL4A 5TOZA 3Q9YA 4E93A 1NA7A 4PPBA 1Y57A 4YBKA 1IEPA 2W96B 4M3QA 3S95A 2YCFA 2V0DA 4U0IA 2JKOA 2JBPA 5HKMA 1VZOA 2ESMA 5E8XA 3AD6A 3VJOA 3G6GA 2PUNA 3OZ6A 2X81A 3TJDA 3I60A 2UZBA 4PNKA 2C6LA 3HYHA 4CFNA 3F3UA 4IM0A 2CSNA 5FXQA 3AMAA 3UYSA 3DT1A 3ZDUA 2IW9A 3FZSA 3S0OA 5GINE 4G1WA 4LMNA 4R5SA 1KWPA 4CFFA 3O51A 3E8EA 4OR5A 4D2SA 4HZRA 3LFEA 4FE2A 3QD3A 5LVLA 2B1PA 4MWHA 5CVHA 2XIZA 4CRSA 3O96A 1FGIA 1U54B 2OW3A 4R1YA 4FTAA 5L6OA 1KE7A 3NCZA 4KAOA 2VTNA 5CLPA 4C4JA 4F6WA 4O27B 5IA0A 2W5BA 2VX0A 4O7RA 3WILA 4QP8A 4R1VA 1CKPA 3CPCA 3VN9A 4ANLA 1WBOA 1P4FA 2W4JA 1OUYA 4XCUA 1RQQA 5M53A 3BUMB 3LCSA 5AR5A 2C4GA 5HG5A 4D0WA 2AC5A 5IISA 1ERKA 3QA8A 3VJNA 3PZEA 2Q0BA 1ZYSA 3FI8A 1OL5A 5HQ0A 1S9IA 4JBPA 4P2KA 5AM7A 5CASA 3FMJA 1B39A 2E9NA 2XIKA 5E92A 4LV5A 4TN6A 4L01A 1YI6A 4RWLA 4O7ZA 1YXSA 2WPAA 2Y6MA 1H07A 4B6LA 2BPMA 4FKWA 4W4VA 3RK9A 3ZTXA 3MFRA 3PP0A 5CXZA 1YDRE 2JIVA 3GNIB 5KMOA 3P79A 4UEUA 4YJOA 4GYIA 4PL5A 4F1MA 5E7RA 4NM7A 3DOGA 5AR7A 3MVHA 5L6WL 5IZFA 5BUIA 3U6JA 2HWOA 2VO3A 3G6HA 5DR6A 4JG8A 3HV7A 5JGBA 5M57A 3T9IA 2C5YA 4IWQA 3GCQA 3FY2A 3PXFA 3OUNB 2J6MA 3WZJA 4NEUA 5B2KA 3QCYA 3R7VA 3VRRA 3OMVA 3OP0A 3QUEA 4QNYA 3OUKA 4DH5A 4HGSA 4JDHA 3BUXB 3GVUA 2PE0A 2OKRA 2EUFB 4I5HA 4Q9SA 4WIHA 1WVWA 3NUYA 4FZ7A 4AW2A 5H3QA 1YXUA 5HCZA 2P3GX 4JQEA 5B2LA 3MDYA 2JKQA 3T3UA 5HE0A 2R7BA 4BICA 3R22A 3C51A 3HP5A 5IA2A 1CDKA 4RX5A 3LQ3A 5T68A 3MSSA 3W1FA 1SZMA 4YJSA 5CU3A 4DGNA 2R5TA 5F94A 4YTHA 4DH7A 2C6MA 4W9WA 4YPDA 5IQHA 1UKHA 3DXQA 1YHVA 3MGYA 3UZTA 4D1SA 4G34A 3QQUA 4ZXTA 4EC9A 3R21A 3TM0A 4QTCA 4X6RA 5DN3A 4H1MA 3ZMMA 4ASXA 2BTRA 5I9UA 4G3DA 4AXAA 2CCHA 2WTDA 4ALWA 5FP5A 4J95A 4BF2A 1H4LA 4K8AA 3U4UA 1PY5A 1WZYA 1Y8GA 4K11A 5GZ9A 4DE4A 3FBVA 3ALNA 3F3TA 4MHAA 3FSKA 3UMXA 4C2WA 3IS5A 4K6ZA 4RMZA 5KBRA 1PKDA 1GIJA 4O0YA 5FWKK 3MH3A 3L9MA 4LUDA 2VV9A 3W33A 1KUTA 2QO2A 4QP6A 2PMLX 1KOBA 4O2ZA 3V5QA 3WOWA 1LEWA 4O38A 2ITTA 5EKNA 5HORA 4AX8A 4L3PA 3FLWA 4DFXE 5BQ0A 3UO5A 4FSTA 2QONA 1WBNA 3BHVA 3LJ1A 4WSYA 5M56A 5JFSA 2YCQA 3LJ2A 4Y46A 4HVDA 5LWNA 2LAVA 2V22A 4IDVA 4L67A 3VUKA 3QC4A 1Q8TA 2RL5A 4LRJA 4C4IA 5L8KA 4JR7A 4C2VA 5BVDA 2B0QA 3V5JA 3ATTA 3FZ1A 3SXFA 1GNGA 2RFDA 2IJMA 2WEIA 3PY3A 1UKIA 5CNOA 2ZV8A 3BGPA 4NIFB 5DYJA 3NW7A 3ORZA 3VBQA 5D41A 3OG7A 3R8UA 4FL2A 4PMMA 4F0GA 5BVKA 3PXZA 3VO3A 4WNOA 3QHWA 1LP4A 5ITAA 2XNPA 3ETAA 3QYWA 3GC8A 5B2MA 3MVMA 5FP6A 3C0HA 4DGGA 3UPZA 1OPKA 3HRCA 3RCDA 3C1XA 2QOBA 2CDZA 2ERKA 2GQGA 4IAZA 3VUHA 3ACJA 3FDNA 2HZ0A 1IRKA 2XK8A 1SVGA 5HG7A 1ZOHA 3PVUA 4FKQA 4D1ZA 3OT3A 4EZ7A 3A4PA 1JBPE 4HPUE 1T46A 4EH8A 5HKZA 4Y8DA 4KIKB 1PXNA 3EN7A 2W1EA 4S32A 5HBHA 4ZLYA 4X21A 3ATSA 2PZPA 3Q3BA 3W8LA 4EHVA 3NW6A 3DQWA 3JS2A 4UB7A 5CZIA 3TNIA 3OW3A 2UZLA 4F08A 5H9BA 4EJ7A 2W1GA 4JBQA 5AV1A 5FDPA 4CYIA 2VWYA 1YOJA 2HWPA 2J5EA 3MPAA 4QMVA 4YZBA 3CKWA 3RALA 3EQIA 3QCXA 4K1BA 3QHRA 1KE8A 3AG9A 4RWKA 3R8MA 3ZYAA 4DLJA 3Q60A 1FBNA 2BAKA 2YIWA 3ITZA 4CFXA 4MYGA 4BDDA 4EQUA 4YR8A 3OXZA 4AA0A 3IDBA 4I4EA 3VUTA 3PP1A 2V7OA 5A3XA 3LMGA 4N70A 3NZ0A 1XKKA 4NFMA 4UV0A 5D7VA 4F65A 3IW8A 4X3JA 3AGMA 4IX6A 5IA1A 3DDQA 2J4ZA 3W2SA 5BVOA 3UNZA 1ND4A 5M4CA 3OF0A 3ULIA 5AAGA 5J1VA 2GHGA 4R77A 2IO6A 3B8RA 4DC2A 3AXWA 3GU4A 3O8UA 1ZYDA 2XA4A 4FSRA 5C8KA 1QPJA 4OLIA 1Q8YA 4JX3A 1F3MC 4F7NA 4XP0A 3BGZA 4IC7A 3ZEWA 1OIRA 3OY3A 2JDVA 2XKDA 4XG7A 3H0ZA 1YRPA 1GJOA 2IW6A 3P4KA 2X9FA 4I3ZA 5HNGA 2W1CA 3HGKA 4FIGA 5BYZA 3UIMA 4ORKA 3R7OA 3L9LA 4O7WA 2VO0A 4JJRA 2RFEA 4TXCA 4DEAA 5AM6A 4LOPA 4TY1A 2GS2A 4AA4A 3TXOA 1M14A 3BPRA 1Y8YA 3LFCA 4IWPA 1R1WA 2QOFA 1JAMA 3NNUA 3NYXA 4CFUA 2RIOA 3DGKA 3ORMA 4WUAA 1W7HA 4U8ZA 2CKOA 4IBMA 4G6OA 3U9NA 4B8LA 4QMOA 3PUPA 4YLLA 3O50A 4TT7A 5C4LA 3R8ZA 4FSWA 2YJSA 2VGOA 4PMSA 1YXXA 3MV5A 4BI0A 5G1XA 2Y6OA 5I9WA 3FEGA 1K9AA 4XUFA 3MY0A 4I6QA 4DEDA 4WG5A 4D1XA 4EKKA 5ANGA 1A48A 3MBLA 4QP9A 4WA9A 3FL5A 3PE1A 2YM8A 3CQEA 3ORTA 4QMXA 1CKJA 5ETAA 4GT3A 2YDKA 1OIUA 3SRVB 3HRBA 3BHHA 5LOHA 4C35A 3R9DA 4XG6A 3BWJA 4FT7A 4YJNA 1OBDA 5BYYA 3FMMA 2RFSA 1FOTA 3EQRA 3JXWA 4LRKA 1SYKA 3F2AA 5DWRA 4EWHA 4YJRA 4CMOA 3EIDA 3EQFA 1XH6A 4DG0E 4HJOA 2VGPA 4G17A 1STCE 2BZKB 3QF9A 4FKRA 5E8WA 4EHGA 5TO8A 2FSTX 4CT1A 4HPTE 3GENA 2XUUA 4C4FA 1ZMVA 4XYFA 2HELA 4EBVA 4EOLA 4RC3A 3RAWA 4X3FC 3ROYA 1H25A 5JRSA 1UNGA 5T3QA 3K2LA 3KCFA 5HD4A 2ZB1A 2ONLA 4PWNA 5JFWA 1MRVA 4AT3A 2JITA 1ZZLA 1TQIA 3WIGA 3VHKA 2WB8A 3LCTA 4GJ3A 3ET7A 2W1ZA 3MYGA 4ZY4A 2XK9A 4K2RA 2O2UA 2GQRA 4H3QA 2UZOA 1YWRA 3FZPA 1GZNA 3FZTA 2BIYA 3AD4A 4I5PA 4C59A 3Q4ZA 4S30A 4B7TA 5BVWA 4CFVA 4C8BA 4KD1A 3EMGA 5E8YA 5KX8A 4M69A 2HAKA 4I0TA 3NYOA 3OD6X 3R1SA 5DR9A 4DEEA 3BUOB 2BFYA 2C5NA 2YM5A 4MXXA 5HCYA 3PSCA 3QKMA 4E73A 4RZVA 3DZOA 2BHEA 4ZSEA 4XMOA 4GU9A 4DA5A 5L2QA 3D94A 3H10A 3R8PA 5CF5A 4Q9ZA 5LMKC 2R0UA 4M69B 4LOOA 1YXVA 3D5WA 3MFTA 4XEYA 2I0HA 5IKWA 3HLLA 3COIA 3A2CA 4FTTA 3NS9A 2GMXA 5LMAA 5HU3A 3TKHA 4USEA 2XJ2A 3UNJA 5E8VA 3NUNA 4G31A 4PUZA 5LVOA 4QMQA 1Q3WA 2VRXA 3TCPA 3AMYA 3CIKA 1PXJA 1PXLA 2GNFA 2QR7A 3OVVA 4GUEA 1H0WA 4IX3A 4N4SA 3DNDA 3QTQA 3QZIA 4CFMA 5BNJA 2NNWB 2CGUA 3SV0A 1FBVA 2A1AB 2QI8A 3TWJA 2C1BA 4WRSA 3RPYA 5IU2A 2VTMA 3R02A 1XH5A 4F9CA 3BUWB 5GHVA 1G8AA 4TWOA 4GH2A 2R3KA 1G5SA 3C4EA 3I0OA 4HYHA 3C4WA 1UWHA 4ZP5A 3ZS5A 4CCBA 1HOWA 3DLZA 3HMPA 4I23A 2R3FA 5AV3A 3UDBA 3EN5A 4CZUA 2X9EA 4BTKA 4EHEA 5KMIA 3TNWA 3UOHA 1DI8A 4Z3VA 5AV2A 4QPAA 4A4LA 3E92A 2WXVA 4FTOA 1P4OA 2H9VA 2JC6A 1RJBA 1E9HA 4KRCA 5CZHA 4RIYA 4RJ3A 5EQEA 5CYIA 1UU9A 2Y8OA 3FXZA 3EQCA 2XKCA 1LR4A 4I24A 1SMHA 3EL7A 3QLGA 2UW3A 3FPQA 1WFCA 5AR2A 3IONA 2UW7A 4RWIA 1R0EA 5ETFA 2WAJA 4KBCA 2OK1A 5HNIX 4U9AA 4IVBA 4AN2A 2B53A 2XYNA 2YLFA 5DFPA 3UGCA 3ZRKA 2F2CB 4FX3A 3PZHA 4HCTA 2F7EE 4Q5HA 4G9RA 4JVGA 4LI5A 5CTPA 3QTXA 2YIXA 2OSCA 4IXPA 1I09A 2W0JA 4IW0A 2GTMA 5K4JA 4FI1A 3F5UA 5I3OA 2Y4PA 1H26A 4XX9A 4AGCA 4DGOA 5JGAA 5M09A 4BWPA 3AC1A 3FHIA 4JDKA 3GC7A 3HVCA 4AT4A 1NXKA 2XKEA 2WMRA 3DJ6A 4A9YA 4BTJA 4EH5A 4ENYA 3EL8A 2C5VA 4ACHA 2QVSE 1W98A 5EYMA 3UIBA 2X6DA 3MPMA 4FG8A 3CS9A 2PSQA 2O63A 3ZXZA 4W4YA 4DH8A 1J1BA 4CXAA 3CQUA 4LOQA 4GG7A 4O0UA 4E6DA 5HKWA 3FI4A 3EH9A 4R3CA 5G6VA 2QURA 3HZTA 4PDOA 5CEPA 4JQ7A 5IQBA 4IVDA 4FODA 3ZLYA 1Y6AA 1ZLTA 2UZEA 3KRLA 3KXNA 4NWMA 4XRJA 4XV1A 1Q62A 2GHMA 2R4BA 4QTEA 1SVHA 2GFCA 5ANKA 5EW8A 2PMNX 2QKRA 3IKAA 4DFNA 1YI3A 4BBFA 1PHKA 4N6YA 2H34A 2REIA 3QALE 3WI6A 4U45A 4L6QA 1YVJA 3EKNA 1JSVA 1JSUA 4TKSA 3Q2MA 2WMAA 3OCTA 4YJQA 3GCPA 5CVFA 4CSVA 4DG2E 2O64A 4FGRA 2VO6A 3MFSA 3KXGA 2NRUA 4NM0A 4K0YA 5L4QA 3ZUUA 3EWHA 4YURA 5M4IA 2BIKB 3MFUA 4TWCA 2CLXA 3A7IA 5DLSA 4BTMA 4IDTA 1JVPP 4NT4A 2A2AA 4GRBA 3ORXA 3MB7A 3R1NA 1J3HA 5AP4A 4JOAA 4IB0A 1VYWA 3MA6A 4AZEA 2WMXA 2BCJA 5DT3A 3C0IA 3ZNIA 4FSYA 3VUDA 4E4XA 5AEPA 2B55A 4CZTA 2R3NA 3TKUA 4ZK5A 3UMWA 5AP0A 1W83A 2F2UA 4JS8A 4BDFA 5IA4A 3QQKA 2ZVAA 4MNEA 1TKIA 3ZEPA 4CQGA 3UE4A 4EJNA 3Q4UA 4DFLA 5FDXA 3OEFX 2JD5A 3E62A 5T6KA 4G6NA 5TR6A 4YNEA 4CLIA 3BCEA 5CNNA 4JBOA 4ITHA 4BKZA 3EN6A 3Q04A 3RAIA 1ZYLA 3VRPA 3EJ1A 4D2VA 5JZNA 2ACXA 3F61A 3FYKX 3LCOA 4E3CA 3VC4A 4D2WA 1W82A 1Z5MA 3VS0A 4G16A 2YIYA 2PVLA 4J52A 5AAEA 4FIEA 5IQDA 2G1TA 4N0SA 5DBXA 3HX4A 4A06A 5KKRB 5CENA 4DINA 4NKAA 3R1YA 3P08A 3I0QA 4EQMA 1H1PA 4C33A 1FMOE 4IJPA 4E6QA 1OMWA 3PPZA 2C3KA 2RG5A 4EOSA 3P1AA 3QTIA 1YW2A 2J9MA 4O7YA 4OTQA 2ZV9A 5ACKA 3QTUA 4FT3A 4ALUA 3W18A 4EYMA 2UW4A 5DH3A 3RVGA 3KK8A 3U6HA 1XO2B 4TYEA 2XK4A 5F95A 2YERA 5IQGA 1SM2A 3L8PA 4Z55A 3ZRMA 4JL9A 5LJJA 4MCVA 3BI6A 4A4BA 1CTPE 3FKOA 4GVAA 1CKIA 1XH9A 3VS1A 2V55A 3V6RA 5HE1A 3RMFA 3D7TA 2YACA 2H8HA 2BZHB 3VS7A 4O22A 4EORA 2VZ6A 3WARA 5CAUA 2E9UA 4O7SA 3NWWA 1XBCA 2IZTA 5HO6A 3B8QA 5EKOA 1REKA 3DZQA 5A4TA 4X2JA 4C3RA 4CMTA 3DKGA 2FA2A 2UW6A 2YITA 3SD0A 3OWLA 4AF3A 5AUUA 3GBZA 3NUSA 3K3JA 3D7TB 3BGQA 4RJ4A 4TZRA 5H8BA 3WYXA 3SKCA 3FPMA 5LCJA 2A27A 3TEIA 2WD1A 4RZWA 2CCIA 3FLQA 2AUHA 5C27A 5M51A 1PKGA 3ANRA 3RP9A 4EOJA 4QOXA 3LKMA 3O23A 4L52A 1GOLA 1M7NA 3EQGA 5CU0A 3TTJA 2UVXA 4C4EA 1OGUA 4A9TA 4ASEA 3IECA 4D2TA 2CNQA 3W2RA 2OZOA 2WTCA 3BEAA 4OBOA 4JIAA 4D4SA 1J7UA 5ANDA 3VHEA 5EM8A 4BWXA 3BLHA 4PPCA 2ITQA 4YSMA 3SW4A 4NU1A 5JRQA 4ALVA 4BVUA 5FTGA 1UWJA 3NEWA 4KBKA 2BZJA 4FVRA 4G5JA 4EH7A 1WBTA 3V5PA 4BB4A 1YWNA 3AC3A 3R01A 4ITJA 4EOMA 3N4UA 3CY3A 4FOBA 4CV9A 1FPUA 4GSBA 4S34A 1OL1A 3F88A 3RAHA 3VW8A 3DB8A 4FEUA 4JRVA 5K0XA 1GAGA 1H24A 1JSTA 2J50A 5GNKA 3A61A 3TIYA 2EXCX 4MD7E 4NW5A 2WGJA 4BI2A 2BTSA 1R39A 5FM2A 2B9JA 3LXNA 3SOCA 3QZHA 4AS0A 2PU8A 3QFVA 2CN5A 1ZY5A 3UVRA 4MNFA 4AWIA 3COKA 4KWPA 1JWHA 5HX8A 5TKDA 4AZFA 3ZU7A 4R78A 2XKFA 2KULA 3CD3A 3OTUA 4GL9A 4EZ5A 3BE9A 4GMYA 3FMKA 3L8XA 3IPHA 3W2PA 4RIOA 3KXHA 2G2HA 4DF3A 2BZIB 5E8TA 3QUPA 4DEBA 1MQBA 4UZHA 3Q52A 4XLIA 3D2KA 3BHUA 1ZY4A 1OIQA 1H27A 4FV8A 5DT4A 3NRMA 3FWQA 2BFXA 1YHSA 5IQAA 5H2UA 4FV3A 2C6EA 4O1PA 2I0YA 3UOJA 3N4TA 5CWZA 1S9JA 5AP3A 4BDBA 2WQNA 2WU7A 3D4QA 5EDRA 4M0YA 5FTOA 5F20A 3UVQA 3VRQA 2ZM4A 4O84A 4I41A 2DWBA 2QODA 4O0XA 4EOIA 2QC6A 5HBEA 3WZDA 4F0IA 5FD2A 1Q4LA 1U54A 4RT7A 3ZSGA 5TF9A 2ETRA 3ALOA 2X1NA 3MB6A 5HTCA 2XNGA 5C8NA 3H9FA 5DIAA 4GUBA 4IHPA 4KRDA 3TZMA 3KRJA 4A9RA 3ORIA 4FIFA 4AOIA 4FTIA 3AOXA 1PF8A 3FZRA 4F6UA 3HAVA 3RWPA 2Y4IC 3HV5A 4I1ZA 1YKRA 4X2NA 4YGAA 3DLSA 4KS7A 4KS8A 1AD5A 4QTAA 1H28A 4XG9A 5IA3A 4ARKA 4ZMEA 4BZOA 3KCKA 5CX9A 5L6PA 2OH0E 3PLSA 4NFNA 2P2IA 4QQ5A 1OECA 2XZSA 4ANOA 4D2PA 2OBJA 3UQFA 2UW9A 1QL6A 5KUPA 5HEZA 3R8VA 3O7LD 4UMRA 4O81A 4H3BA 4YSJA 4YP8A 5KCVA 5LXMA 3F5XA 4YJPA 4FIJA 3OCBA 3G15A 5CU2A 3A60A 4Z7GA 2QHMA 4BN1A 4C02A 4PRJA 4MXOA 4V0GA 1NVSA 4YTCA 5I9XA 4EK3A 3ZBFA 3QKKA 5GJFA 2WOTA 4DCEA 1JQHA 1PXKA 2R3RA 2JFLA 3EN4A 4YUQA 1GY3A 5FM3A 4D28A 5DT0A 4BDHA 4ZTMA 4FUXA 3E7OA 3LQ8A 4G9CA 4C37A 1WBSA 4EI4A 3GU5A 1NVQA 4IAYA 3PJ8A 4FKVA 4RIWB 4DG3E 4U97A 1WAKA 4YPSA 3C13A 4AGDA 4DTKA 4CTCA 5DNRA 2JDSA 2OXDA 4F64A 4YJTA 3GC9A 5CVGA 1VJYA 2PZRA 3SW7A 4V0GB 2C0IA 3CE3A 1VYZA 3O7LB 4GT4A 3IOPA 4PV0A 4MX9A 4U80A 3PSBA 3A7JA 2Y1MA 1Q5KA 2YIQA 2HYYA 3FKNA 3PXRA 4M66A 3TUCA 3JY0A 3CLYA 5CQWA 2OJIA 4D4RA 4CKIA 3LM5A 5A4EA 4BBEA 2ZM3A 1WVYA 1W84A 1BYGA 3ZSHA 2WELA 4U3ZA 3MIYA 3A4OX 3W2OA 5LVPA 3JUHA 4ONAA 2R7IA 4HW7A 1OKWA 5GJDA 2ONLC 2OJFE 5A6OA 5KO1A 3E63A 4CZYB 4MH7A 2X8IA 3Q5ZA 3BX5A 1I44A 3ZDIA 3QBNA 2VTQA 4E4NA 4AN3A 3FMNA 1PXIA 5FGKA 4QMSA 4ZSGA 3PA5A 2YCSA 3BLQA 3LXPA 1GZOA 5CXHA 4ZTLA 4YZNA 2NRYA 3ROCA 2FB8A 4EL9A 4X7QA 2JAVA 3MY1A 2JFMA 3H0YA 5C1QB 2PK9A 3C0GA 5GJGA 4C0TA 2C68A 3UZRA 1ATPE 3IK3A 4NL0A 4FIIA 4OTFA 3NMUF 1IR3A 3R7UA 4EH2A 4F7SA 4Z9LA 3UNKA 3EHAA 3RPSA 2IW8A 1UVRA 4YZDA 3CC6A 3EFKA 5CANA 3A7GA 3LXKA 2PVMA 2WMVA 1IASA 2BR1A 5HE3A 3TNQB 5HVJA 3FI2A 4WNKA 4QP4A 5HCXA 2CHLA 4PQNA 3M1SA 5J7BA 3OROA 3I1AA 4JG6A 3ZFYA 1OM1A 3VRNA 3PJCA 4DITA 4M68A 2X39A 4FK3A 3ZLXA 4ZJVA 3IQ7A 3ORPA 2XNEA 3HV4A 5E8UA 5M55A 3UOLA 4NSTA 5AA8A 1Q3DA 4B4LA 4OW8A 3EQHA 3DAJA 4EOQA 4R7BA 4FUYA 4FBXA 3F7WA 4BWKA 3BYSA 4D55A 4A4CA 4CG8A 4FKPA 3R9RA 2UZUE 4M8TA 3VULA 5DVRA 3RJCA 4AACA 1ZMUA 3DS6A 3KVWA 4MQ1A 4FV7A 5JH6A 3DK6A 3PPKA 4NIFA 4DFBA 3HMMA 4R6VA 4BDCA 4FG9A 4C36A 2WZJA 3HL7A 3QUDA 3NIEA 4TNBA 2WU6A 3UP2A 4YC3A 2YWVA 3F5GA 2VWIA 2ETMA 3BU6A 4NCTC 4Q2AA 4C34A 2VAGA 3RK5A 4QP7A 3ORLA 5DG5A 2WQOA 4KKHA 2XNOA 2YHVA 5HE2A 4BTFA 4FKLA 5AR8A 5TT7A 2VUWA 3OP5A 4LGGA 4PP9A 1H00A 4ANQA 5EW9A 3N4VA 3W32A 3GCSA 4GK4A 3PWYA 3VF8A 3E3PA 3I5ZA 4PDPA 3R7EA 3LFAA 3FXWA 3WYYA 4ACCA 4BIBA 1ZOEA 4C61A 4KIKA 2QLQA 3NR9A 3U54A 2W5AA 3PLFB 1FVTA 2PVFA 3TJCA 5KZIA 2QNJA 2R3MA 2GS6A 4V05A 2ITYA 2J0KA 5EM7A 5JEBA 4ASZA 2B52A 4IZ5A 2VU3A 1OIYA 2CPKE 4BZDA 3MJ1A 3BV2A 3I81A 3D83A 3NSZA 2YAAA 2PE1A 4RX9A 2CN8A 2QOQA 3PYYA 3KXZA 3HNGA 4P5QA 3R73A 5L2SA 5I3RA 3L9PA 5HLNA 1SVEA 2BVAA 3ZHPC 3Q96A 3GCUA 4FYNA 3BE2A 1RE8A 4YMJA 2XYUA 3SA0A 2OWBA 4YTIA 3R30A 3G2FA 1ZMWA 4ZTRA 5AV4A 2P4IA 5LCKA 4YU2A 3E88A 4Z7HA 3C7QA 4ZJIA 2CNUA 4EKLA 3H30A 4IVCA 5AR3A 3UODA 3S1HA 3FJQE 2UW5A 2IVTA 2HCKA 2B9FA 3ELJA 3H9OA 3M11A 4FT0A 4HYIA 4MEDA 1AQ1A 4F9YA 4N57A 2PVYA 5IEXA 3RTPA 3EYGA 3NW5A 3P7AA 4CYJA 1PYXA 2F57A 3WE8A 5M44A 1HCLA 2R3GA 4Y73A 4L9IA 3LFFA 3DV3A 3M2WA 4J71A 4DFUA 4ANSA 3GUBA 1MUOA 2B4SB 3OCSA 4FR4A 4HNFA 4MXYA 5I9VA 2QCSA 4J98A 3PFVA 4OTHA 2OJGA 2CKEA 4J99A 4HVSA 3ANQA 3NAXA 4LGHA 5HIBA 2C47A 2J7TA 3OBGA 5D10A 2G9XA 3MS9A 3KXMA 3DXNA 2WTJA 4O7LA 4DAWA 2GHLA 4ACMA 4JI9A 1V0PA 1EH4A 3PSDA 5ETIA 2WMSA 5HICA 2CKQA 3FC2A 4D58A 3Q9XA 4D0XA 2A4LA 4XV2A 2YEXA 4EOOA 1DS5A 3GXLA 1TQMA 4W8DA 3R7GA 2HXQA 4DEGA 4QP3A 3A7HA 4F7LA 2XIRA 2Z2WA 3B2TA 3SRVA 2HW7A 2PVKA 3O8PA 2PL0A 2J0MB 5EDPA 3OB2B 3CD8A 3G33A 1YDSE 4D4VA 2XMYA 1GIIA 3AC2A 4TYJA 4Y5QA 1BI8A 5EK7A 3E7VA 4AW0A 4F6SA 5E8SA 4TYGA 4ENXA 4RFMA 4UXLA 3R71A 4P5ZA 4RRVA 2BDFA 3AC8A 1MRYA 1YOMA 2EB2A 1KV1A 2AC3A 3E8CA 4O0WA 5DA3A 5FEQA 2Y1NA 4AGWA 4E6AA 2CGWA 3AMBA 2Z02A 5FXRA 2C30A 4L42A 5EOLA 1JNKA 1W8CA 5JFXA 3QZGA 3QAME 4H58A 4FZAB 3PRFA 4KSPA 4KBAA 2I7QA 4PP7A 3SX9A 5DEWA 2XM9A 5CF4A 3RZFA 2XNMA 2ZDUA 4GJ2A 3EFJA 1DAYA 1DI9A 2ZAZA 3NIZA 3HUBA 4QMLA 5J7HA 1YOLA 1YWVA 2YDIA 3O2MA 4ZTSA 5BMMA 3W2QA 1QCFA 4E5AX 4PMTA 4YTFA 1U46A 4IEBA 4F9BA 3OWPA 3C5UA 4BDGA 5DE2A 3AC5A 2C0OA 2RGPA 4RX8A 2DUVA 1HCKA 4FICA 3LXLA 4Z16A 4W8EA 4L46A 3WBLA 3MESA 3K5UA 4WOVA 2O5KA 4G5PA 2V5QA 5HG9A 4ZSAA 2CKPA 4BCFA 3BUNB 3PXKA 1QPDA 4FGBA 4I6BA 4KKEA 3LFNA 3RHXA 1VEBA 1UNLA 4BCPA 4GS6A 2H96A 3OT8A 2WMTA 4FZ6A 4H39A 4J96A 5KMJA 2XS0A 1L8TA 3E93A 4QP1A 5FBOA 2ZMDA 4JX7A 2RSVA 4O91A 3QRJA 2C6OA 4JQ8A 5J79A 4UWYA 1ZZ2A 3GFEA 5EQPA 5CAPA 3L8VA 4RVMA 4UMUA 5E9EA 2X2MA 4MTAA 4U3YA 2UVYA 3TL8A 2R0IA 2PUUA 3OHTA 3BIZA 1YDTE 1KE6A 3KXXA 4ERWA 1XQZA 3C4FA 1P14A 2OG8A 4DFYA 5AP1A 2I0VA 5ANJA 4UZDA 2W17A 3CGFA 4MD9E 1AGWA 1PXOA 3KRXA 4QPSA 4R3RA 1X8BA 4TWPA 2QR8A 3FAAA 2PZYA 4CKRA 5CU4A 3NUXA 4L7SA 4JBVA 4HGTA 4ITIA 4U7ZA 3TV7A 4C58A 4JDJA 4NK9A 4OBQA 4J53A 4CNHA 3JVSA 3VUMA 3HDMA 4B8MA 4JLCA 2OIQA 5J1WA 3NUAA 2HZIA 5DOSA 5E1EA 2PYWA 2OIBA 3QRTA 4O1OA 3MWUA 3I6UA 4MF1A 4W4WA 4PF4A 5IF1A 2YZLA 5L8JA 4UX9A 3UG1A 3V8TA 1E1VA 4CRLA 4F63A 3ODZX 4AG8A 5J9LA 3CP9A 4XBUA 4EH3A 2QU5A 3FE3A 3MA3A 3EQBA 3HV6A 3UYTA 4IZAA 5BUEA 2GSFA 4XV3A 3FLSA 3UP7A 4ZSLA 5K0KA 5J8IA 3NVMB 1UNHA 4H1JA 4JDIA 1T45A 2J2IB 3N51A 4W4XA 4N6ZA 2WIHA 1GZKA 4AQCA 2WTKC 3MVJA 1U5QA 4E4LA 3EFWA 2JDRA 3FSFA 5HO8A 3D5UA 4ZTNA 4M97A 4BI1A 4O82A 2DS1A 3LIJA 2YM4A 2QLUA 3DTCA 4L3JA 5C03A 3LZBA 3HA8A 3DA6A 3Q4TA 1JKTA 2EXMA 4GU6A 4YJUA 3A8XA 4MKCA 2E2BA 4F09A 4A7CA 2QQ7A 2BRBA 2PVJA 4G3EA 2C6DA 2WTIA 3ACKA 3COMA 4JIKA 3ZC6A 3FUPA 3GB2A 4D9UA 4D5KA 1M7QA 2X7GA 2BMCA 4EH6A 1SNXA 1FINA 4APCA 4QYYA 4RQKA 3RGFA 3KB7A 4YNOA 4J7BA 1M2PA 4S31A 3RM6A 4BGQA 3SXSA 2HXLA 3TNPC 3D0EA 3FQEA 4I22A 4IANA 5AR4A 3V51A 3II5A 4QYEA 4RSSA 3ZRLA 3NGAA 3ZSIA 5IDPA 2QOIA 4EUUA 5IMEA 4O6LA 2W1DA 2FGIA 3VBWA 3ZM9A 2C5OA 1XWSA 5BYLA 5GZ8A 1PMVA 3OS3A 3KA0A 4IMYA 4IX5A 3U4WA 1BL7A 4UMPA 4O7TA 4I6HA 4WUNA 4F99A 3MPTA 2OF4A 4TPTA 2WMBA 4KIPA 4HZSA 3G90X 3D7ZA 2F49A 1O6KA 3ZFXA 4UYNA 1H8FA 2VTAA 4OTGA 5CI6A 5ANOA 2ZJWA 3G9NA 1W0XC 4C3PA 2VD5A 1SNUA 4RFZA 1KV2A 4MQ2A 4QD6A 4XG8A 3VQHA 1CSNA 3TNHA 4BZNA 3L1SA 2QG7A 5F4NA 2OH4A 4RC2A 4U44A 4DGLC 3D2IA 4BDIA 4RWJA 2Y0AA 2BRNA 3PXQA 4QTDA 2CBLA 1FQ1B 5FG8A 4KSQA 3GOKA 3CEKA 3FLNC 1O6YA 4OAUC 4B99A 4EQCA 3JVRA 2VWUA 4XOYA 3UJGA 3OOMA 2PZIA 3QQJA 4ZMFA 3VS6A 3K54A 3UO4A 1XH7A 2BUJA 4I5MA 4CD0A 3UQCA 2VWWA 3HP2A 4Y83A 4IB5A 3C50A 3NNXA 4OTRA 3RPVA 3DBDA 4E5BA 3ZLWA 3KMUA 3NCGA 3EYHA 4DTBA 2VX1A 5EM5A 4OT5A 3W16A 1R0PA 3VUIA 5JK3A 4HGLA 4QP2A 4QYGA 4G3FA 3DK3A 3Q9ZA 3D5XA 3LMHA 1G3NA 3P78A 2PWLA 1XJDA 2ZDTA 4EONA 4JG7A 4M84A 1PMUA 2QKWB 5C01A 3D9VA 1V1KA 3UZPA 4IWDA 2PUPA 1E1XA 4FNXA 4C4GA 3T3VA 3PA4A 5JN2A 3R2YA 5CEKA 3L8SA 5HKYA 2XEZA 3H4JA 4ZZNA 2FSMX 2XBAA 4Q5EA 2OU7A 5FQDC 3D14A 1B47A 5KMLA 3FHRA 4GK3A 4QMNA 4YZMA 1YVHA 2FUMA 3OFMA 3QQFA 3VRYA 5CAOA 3R00A 4USFA 5HBJA 3CCNA 4XG2A 5EW3A 4O83A 2X8DA 1APME 4WBOA 2R3HA 1JKKA 3CPBA 3NAYA 3OEZA 3R9HA 2UZNA 4BDJA 2X4ZA 4YHTA 1PW2A 3F3VA 4AP7A 3S00A 2LGCA 3PJ3A 5IUGA 2R3IA 1M2RA 3EOCA 4GIHA 4JXFA 2IG7A 3TG1A 3I6WA 1GZ8A 3K5VA 1DM2A 4D4YA 3FC1X 3KKVA 4IAFA 1OL2A 2YABA 1UU8A 4A4OA 1DAWA 5CF8A 4NTTA 5I4NA 5EH0A 4AOJA 3SDJA 4XG3A 5AUVA 3TI1A 1XBAA 2WFYA 5EQYA 2WTVA 3FQSA 2OI4X 4X3FA 4HNIA 2GCDA 4P90A 2SRCA 5GIPE 2O3PA 4R5YA 5FLFA 3IGGA 4OTWA 1WMKA 4GG5A 1PXMA 3A7FA 5DGZA 1Z57A 3DKFA 2W9FB 2XNBA 3GT8A 4XNEA 3GU8A 5EYDA 4EYJA 3ORKA 4IX4A 5AUWA 4AZTA 5J3XA 3PY0A 3QCSA 4BCJA 2RG6A 2UV2A 4RJ8A 4RJ7A 2QD9A 5F1ZA 4S33A 3SLSA 4I0SA 2G2FA 3WZKA 3TV6A 4X3FB 4XRLA 1PXPA 2ETKA 4O21A 3ERKA 5D7AA 3BLRA 3QKLA 5HTIA 5K4IA 1IA8A 4M0ZA 3FMHA 4P4CA 2IVSA 4QMWA 4AU8A 4XLVA 3SGCA 1Q97A 4J1RA 2BDWA 5ACBC 5EI8A 3BZ3A 1MQ4A 4QNAA 3WF7A 4XV9A 4AOTA 4L53A 4YJVA 3QQLA 3WF5A 3QZFA 4IQ6A 4FL3A 2EXEA 2OJ9A 4JRNA 3NUPA 4WSQA 5HOAA 3RNYA 4U42A 3ZZWA 4APPA 4I21A 5LMKA 2W05A 4F9AA 2OLCA 5AUXA 4H3PA 4NJ3A 2DQ7X 3EKKA 4RPVA 3V6SA 2BKKA 4BY9E 4QO9A 5AP5A 3BBWA 4FIHA 4OBPA 2YJRA 4NH1A 3SQQA 1K3AA 1URWA 2CGVA 2HOGA 4HVGA 3KQ7A 3LCDA 2BRGA 4BDEA 4MF0A 4CG9A 3VVHA 3Q6UA 3SC1A 1XHAA 1Y6BA 3F9NA 3HRFA 4UMQA 3WF6A 5FXSA 3PY1A 3H9RA 3V5TA 5KMMA 5M06A 2O8YA 2UZDA 5A4QA 4TNDA 4YLJA 3KF4A 3OWJA 4C57A 3HUCA 4JAJA 4BBMA 3QX2A 1RDQE 4NW6A 5EYCA 4ZLOA 5LQFA 3UBDA 3BQCA 3DBFA 3AT2A 3EFLA 4FC0A 4AT5A 1H0VA 4JAIA 4XHKB 4XJ0A 2XF0A 5J5TA 3DB6A 4FL1A 5EG3A 4L43A 4LQMA 3P5KA 4NM5A 3DKOA 4CV8A 4EEVA 5HESA 2XCKA 3JPVA 2E9PA 2XJ1A 4LV8A 4MD8E 5IA5A 2V7AA 3FMLA 4ID7A 3C4CA 3GU7A 2B9IA 2BAJA 2VTLA 4R7HA 3W10A 3CBLA 2C69A 3Q9WA 5F9EA 4FT9A 3KK9A 3PIZA 3IW5A 3PXYA 4IZ7A 4QQJA 3BBTB 5L2TA 2HK5A 4GIIA 3QU0A 5AWMA 3BV3A 3AC4A 4A07A 4DH3A 2XH5A 1OPLA 4A4XA 1M52A 4D2RA 1OL6A 5DR2A 5I9YA 4EUTA 3LJ0A 2DYLA 5BVFA 4F4PA 1H1QA 2HY0A 3RPRA 4BCOA 5KBQA 1LEZA 3I5NA 5HTBA 3TUBA 4BIDA 3EN9A 5CT0A 4AUAA 3PLAE 4YC8A 4G3GA 1L3RE 4D5HA 4KB8A 4UWBA 4F1OA 3PG1A 3I7BA 3IO7A 2EU9A 1VR2A 3RI1A 3VWAA 4FKJA 4HYUA 1PJKA 3S4QA 1H01A 2BROA 5BVEA 4PNIA 2W1HA 4BRXA 5C26A 1H1WA 5L3AA 4ZTQA 3DCVA 3VAPA 3U6IA 2XIXA 3WF9A 3VS5A 3EB0A 2VNYA 4CFWA 4GVJA 4U5JA 3P0MA 5M4FA 2XNNA 2I0EA 2X4FA 2EWAA 3JYAA 2VTIA 1YQJA 2OZAA 3FLZA 4NKSA 3RPOA 4E7WA 5A46A 3LFDA 3KC3A 4UWCA 3DAKA 5J9YA 1IG1A 1ZXEA 2QO7A 2XRUA 4Y5HA 3ZC5A 3PA3A 5C9CA 1M2QA 2GFSA 1PMNA 2R3LA 3UC4A 4EK8A 4DYMA 2UUEA 3V3VA 5AX9A 4RIWA 5J9ZA 5DHJA 4HYSA 5LVMA 5KE0A 2F9GA 3LCKA 4GFOA 4UY9A 1KSWA 3R83A 2C5XA 2W7XA 3GOPA 2W06A 2IVVA 3RAKA 3HEGA 2OZAB 4FTCA 4BHNA 3LAUA 1BI7A 1YHWA 2VWVA 4PTCA 1RW8A 1Q8UA 4FTLA 2YIRA 3AT4A 4AE9A 3RBWA 2JLDA 4FV6A 4RVTA 3RNIA 1UV5A 4GYGA 4BFMA 4HCUA 3ENHA 3F82A 2C6TA 2X7OA 4RLLA 4KIQA 5AMNA 2Z7LA 3MH0A 2G01A 3QQHA 4MXAA 3FZOA 4C38A 2CJMA 5IPJA 3M42A 3QX4A 1IAJA 3TT0A 3GP0A 3AGLA 1JLUE 3WIKA 3QCQA 3F3ZA 4NTSA 3BYUA 4F0FA 5CQUA 4MWIA 2XB7A 4F1TA 2XJ0A 5L8LA 2X2LA 1FMKA 5BMSA 3R9NA 3WF8A 4FYOA 2GDOA 4USDA 2CGXA 2Z60A 4UMTA 4QTBA 2C3IB 5EOBA 3LPBA 3KF7A 3TACA 1J91A 2ITXA 4UXQA 5AA9A 5CS6A 3EZRA 4RJ5A 4ZJJA 5CEIA 1YI4A 4L8MA 3UG2A 3KFAA 3PVWA 3PG3A 4K9YA 4AAAA 2ZYBA 3RINA 4AFEA 3QWJA 3PDTA 1Q41A 2J0LA 4FNZA 1JOWB 1OBGA 3DU8A 1F0QA 4KINA 2HZNA 3QD0A 4E6CA 3U9CA 5KHWA 3LFQA 4LM5A 3NUUA 1ZYJA 3MH1A 2GNGA 4O0RA 3PE2A 4XH6A 4ZIMA 3TZ7A 3VROA 4YBJA 2OGVA 5CEMA 2OIDA 3HECA 4DCAA 4BKJA 3NPCA 3VS2A 3TZ9A 3KMMA 2RKUA 2YM6A 3DBCA 1H08A 3P9JA 4QQTA 1ZRZA 2B7AA 1ZAOA 4O96A 3JY9A 3HMIA 4KKGA 4BYJA 3KMWA 2PULA 5KHXA 4BCGA 4WKQA 4J8MA 2BRHA 2WQBA 3P23A 4KA3A 3VF9A 2FO0A 4C7TA 5BX0A 4RJ6A 5A4CA 2ITUA 3O8TA 4YHJA 3LMIA 1UU7A 3ORNA 4FVPA 3D5VA 3FV8A 1U4DA 4FV9A 4R7IA 3KULA 3OY1A 2PUIA 2YWPA 2QOLA 5DI1A 3QTRA 4C3FA 3PJ1A 4FSMA 3TZ8A 3F7ZA 3QGYA 4FTRA 3DK7A 5AX3A 4O7VA 3F5PA 3V01A 1OI9A 4AZVA 1UA2A 3VBYA 2J0JA 4FEQA 4FG7A 2JDTA 5CAQA 1YXTA 5AUTA 3A62A 3F6XA 4RGJA 3HAMA 1B6CB 3QRKA 2IVUA 3GFWA 3QXOA 3V04A 4X0MA 5AFVA 3KULB 3PIYA 2X0GA 2JGZA 2JKMA 2R3QA 2BRMA 5AUZA 4QMPA 3SG9A 3CJFA 5K5NA 4IAAA 4BCKA 4LG4A 2VTOA 3HDNA 2YFXA 2PE2A 2WMQA 3LOKA 5DRDA 3REPA 1TQPA 4EK6A 2JKKA 2C3JA 3R28A 3FKLA 4AFJA 4RVKA 3CJGA 2GTNA 3A8WA 4KNBA 4BHZA 4OGRA 2WKMA 4IC8A 1NVRA 3GGFA 5CAVA 5EI2A 5IDNA 4FKGA 3SG8A 4ANBA 3HKOA 2QOCA 4X2FA 2P55A 2PMOX 3POOA 3F2NA 4LFIA 2A19B 3O71A 1BUHA 2P33A 2UZWE 5FBNC 3O0GA 1OKVA 3BELA 3PIXA 3R8LA 2O0UA 3ULZA 2JDOA 3SHEA 4EC8A 5JT2A 1JKLA 2G2IA 1IAHA 3QGWA 4X6QC 4WNMA 5H8GA 3VBVA 4ZZMA 3BQRA 3IW4A 4MBIA 5HU9A 1WVXA 3DAEA 2IZSA 3IW7A 2C6IA 5LVNA 2YM7A 3E5AA 3ID6C 4DN5A 2W1FA 2I6LA 3RK7A 1NW1A 1XH8A 3POZA 4RA4A 3VGOA 2XEYA 5LWMA 3CKXA 3K3IA 4NJDA 2VTHA 3VW6A 4NYEA 4G6LA 1Q61A 3P7BA 3S3IA 1Y91A 3OBJA 4WHZA 1REJA 4GFGA 4E20A 5IEYA 4DBXA 3QLFA 4YLKA 3QQGA 5JGDA 2YLEA 3CSVA 5CEOA 3R63A 2ITVA 2F7XE 4IWOA 4LMUA 1P5EA 4CT2A 3QD2B 3RM7A 2Y7JA 3FL4A 3RKBA 4LL5A 4FTNA 4L45A 3V5LA 4AZSA 5JSMA 3F66A 1ZYCA 1JKSA 2VX3A 5DRBA 5HLPA 3V8SA 2VWZA 3R0TA 5CSPA 4IACA 4MXZA 2RF9A 4FA2A 4O0TA 2C6KA 4DT8A 2WMWA 1MRUA 4Y95A 4BCHA 4ERKA 1CM8A 3BEGA 1KOAA 2XBJA 3NX8A 3QA0A 1OPJA 3B2WA 1R78A 3BHYA 5HZNA 2IZUA 2WMUA 4FOCA 5IH5A 4LUEA 3RZBA 4FMQA 4BC6A 4KIOA 4ZY6A 3HMNA 4HGEA 3ZFMA 3G0FA 4TL0A 3KN5A 2XK3A 1BKXA 2BDJA 3MIAA 2VTRA 4FF8A 3U51A 3V8WA 2F4JA 4UALA 4WBBB 5HD7A 5B7VA 2CMWA 5IQIA 5M08A 1OVEA 5E91A 3MTFA 4OT6A 4BDAA 3E64A 5KMKA 3CY2A 2IN6A 4M13A 4BCMA 4RVLA 1H1SA 3IW6A 2C0TA 2QOHA 3C4ZA 3E3BX 4L7FA 3KGAA 3BU5A 2CLQA 2F7ZE 3DJ5A 4XP3A 3CR0A 3DQXA 2Z7RA 3W55A 3ZO4A 1QPCA 3ZOSA 4BIEA 4IM2A 4YO6A 5J87A 4YZCA 3EQPA 2JAMA 4QMMA 4C4HA 1WCCA 3CTHA 3KRWA 5FTQA 5HHWA 3ENMA 2OXXA 2YZAA 5HVYA 3QTSA 3I7CA 4QMTA 2J90A 3ZH8A 3QTZA 4OTPA 4FV1A 4IAKA 4HVIA 1LUFA 5KKRC 4PMPA 1Q8ZA 2R3PA 4PX6A 2HENA 5BUJA 5JMSA 5CU6A 2VO7A 2Y4IB 2ZB0A 5I5ZA 2PVNA 4U81A 2GNJA 2YDJA 4Y72A 2Z7SA 3C4XA 5DEYA 1PYEA 2IZRA 5GIOE 4CVAA 2KTYA 3R9OA 4PDSA 4ZOGA 5HNBA 5LARA 4YZ9A 2XM8A 4ACGA 5JQ8A 5D1JA 3ZUTA 3NYVA 4M14A 1GIHA 1TVOA 2W4KA 5B0XA 4QMYA 4AW5A 3R7IA 5FUTA 5JFVA 1U5RA 1XR1A 4O0VA 4QPMA 1NT2A 1M17A 2W99B 3ZO3A 3WZUA 5J95A 5IH6A 3ZO1A 4F70A 5IQEA 5ETCA 4C62A 4IB1A 1JPAA 2W1IA 4FK6A 3KY2A 3Q6WA 4QMZA 2JEDA 1MP8A 2QG5A 4CQEA 5HO7A 2UZTA 2BAQA 4GEOA 4DT9A 2WTWA 3OB1B 3T9TA 4E5WA 3DPKA 2J5FA 5ANEA 4K18A 3KEXA 5C4KA 2OFUA 3TKIA 3FLYA 3GI3A 2VTTA 1OB3A 3DKCA 4FV2A 3FYJX 1PMEA 1K2PA 3KRRA 4FSQA 3MH2A 3GU6A 3OC1A 5A6NA 2JIIA 4DEIA 3DTWA 5K9IA 4EWQA 3GQIA 2NPQA 2B9HA 3UVPA 4EK5A 3ZO2A 1BLXA 5ICPA 3RHKA 3OXIA 1FGKA 3COHA 2Q83A 2FYSA 5D9HA 3WZEA 2X7FA 4E1ZA 3LE6A 4GCJA 4O2PA 4FV4A 3FQHA 4I20A 4X2KA 4G3CA 3Q4CA 5DMZA 4GT5A 3NNWA 2FH9A 4IE9A 1WBWA 5M07A 1Q8WA 4TRLA 2WEVA 4GKHA 5HX6A 3TIZA 3VS4A 4DEHA 1NY3A 3G9LX 3BYVA 5AIRA 4PY1A 2V62A 4V04A 4H36A 4MBJA 4AGUA 3QWKA 3PRIA 2CNVA 5J5SA 3IDPA 2W5HA 3DJ7A 2VWXA 5HI2A 3ZLSA 5BPYA 5H8EA 3U87A 3R1QA 3U55A 2EB3A 4P7EA 4NZWB 1V0BA 2VNWA 3R04A 3LFSA 4EOKA 1XH4A 4QQCA 4XBRA 4CKJA 2UW0A 5IUIA 3UQGA 5M4UA 2JBOA 2ZV2A 4IFCA 3SOAA 4FTMA 4ZS0A 3C9WA 2PPQA 2R3JA 4HCVA 5JQ5A 1A06A 3FXXA 3S2PA 4HVHA 1Q99A 2VTJA 3LQ5A 4PTEA 4WG4A 1J1CA 1V0OA 4CCUA 4NCTA 3FMDA 2IPXA 4FKSA 5AADA 4KABA 4FZFB 4I0RA 3DXPA 3Q2JA 4EHZA 5EDQA 4U41A 4YO4A 2I40A 5CALA 3AD5A 4GKIA 4LRMA 4I5CA 3F3WA 4A9UA 5TE0A 4BCIA 4D9TA 2R64A 4TYHA 3VS3A 2XCHA 3W8QA 2UVZA 2FSOX 4H05A 4S2ZA 3QC9A 2WNTA 4R3PA 5EHOA 4AE6A 4BYIA 5E4HA 3TDVA 4IIRA 2BHHA 4QYFA 5HLWA 4IZYA 5KNJA 4GPLB 2XRWA 3BHTA 4A9SA 3ZUVA 4KUJA 3E8NA 4O6EA 4OTIA 2OF2A 4FV5A 2AYPA 2ZM1A 3LM0A 4G2FA 3NVKI 4EOPA 4FTKA 2ZOQA 1J7IA 2PVRA 2BKZA 3PJ2A 4QYHA 4TYIA 3R2BA 2R3OA 4NUSA 4TYHB 4WRGA 2OICA 3P7CA 5E8ZA 5FRIA 3IG7A 4II5A 3CQWA 5C8MA 2ITOA 3G51A 3ZXTA 2ERZE 1P2AA 1OKYA 3IGOA 4RIYB 5KZ0A 3L9NA 3UO6A 4O86A 3EQDA 3OXTA 4DHFA 2ITZA 3QD4A 3MTLA 4M12A 5KMNA 3DNEA 4CGAA 4AZWA 4JNWA 3DBQA 4RBLA 4ZS4A 3MI9A 2J0IA 3I79A 3O17A 2O65A 2HW6A 3I4BA 4AN9A 4FNYA 5CF6A 2X2KA 5FEEA 4FTUA 4DH1A 2YM3A 3OTVA 1QPEA 3KN6A 3NLBA 4O7NA 2A0CX 2Y9QA 4XS2A 4EH4A 3V5WA 3TDWA 5IQFA 4IB3A 5L2IA 4AW1A 4RA5A 5HG8A 5K5XA 2GNLA 5A9UA 3G0EA 4M15A 2G15A 4JT3A 2GS7A 2R2PA 2P0CA 3H3CA 4EK4A 2YISA 3BWFA 4FSZA 2PVHA 4QMUA 4FKIA 4CTBA 4GW8A 3F69A 5D11A 5AAFA 2ITWA 4RQVA 2I1MA 2Q0NA 5HIDA 4FKOA 3VUGA 4E26A 1OL7A 1KE9A 5EYKA 1Z9XA 3OOGA 3KREA 2YAKA 3SXRA 4WG3A 4I93A 1UU3A 5JZJA 5EHYA 2ZMCA 2W9ZB 4MK0A 2OXYA 3VBTA 4J97A 3FI3A 3R6XA 4V01A 2W4OA 4EZ3A 2GNHA 3CTQA 2BALA 3C5IA 3QRIA 4X2GA 3LW0A 3RWQA 3OWKA 2YA9A 4K77A 4MVFA 5I9ZA 4RFYA 2HZ4A 2YN8A 3TV4A 5BVNA 4FZDB 4DBNA 3W2CA 5CY3A 3LVPA 2GNIA 2XIYA 4U40A 5AJQA 3DBEA 5IQCA 3Q53A 3QTWA 2RFNA 1BX6A 3SAYA 3QL8A 2QO9A 4HOKA 4FNWA 2Z8CA 3TTIA 4JR3A 3UTOA 2XK6A 4AA5A 2ITNA 2WHBA 2ITPA 2UW8A 2WIPA 5CSXA 4FSNA 3MW1A 4TW9A 3ZM4A 4FT5A 3P86A 1WBPA 5AP7A 3AT3A 3GQLA 4RC4A 1O9UA 2OJJA 2PY3A 5L2WA 4DFZE 4ZY5A 3CXWA 4ZZOA 2VTPA 2NO3A 5ANIA 4PL3A 4DLIA 4ANMA 5CT7A 1OZ1A 3KL8A 2OFVA 2PTKA 3PWDA 3PVBA 3DDPA 1OKZA 3HV3A 1B38A 3BYOA 4MNEB 3UC3A 4CLJA 3R7YA 4FEXA 4BGHA 2JIUA 2WQMA 3IDCA 2R9SA 3IOKA 3QXPA 3PVGA 3ZCLA 3BRBA 4RG0A 3UPXA 5IUHA 3DFAA 3BYMA 3MJ2A 4UBAA 2C1AA 2J51A 3QYZA 4WD5A 5A14A 3A99A 1OITA 2GU8A 2P2HA 3UIXA 5GZAA 4GFMA 2FVDA 4TWNA 4ZSJA 4BCQA 4WNPA 4IVAA 4ZTHA 3ZONA 4ACDA 4EBWA 2GPHA 3VRZA 2VN9A 4E4MA 3JR1A 4OUCA 3UOKA 3U8WA 1LPUA 2XP2A 5AP6A 3TN8A 1U59A 3PPJA 4ZEGA 1FVRA 4LL0A 2IWIA 3MY5A 4PPAA 2Z7QA 5K3YA 3THBA 4L00A 4IADA 3VBXA 4WO5A 3E87A 4XP2A 5IMXA 3D15A 4YHFA 2FSLX 5AIKA 3FY0A 4FTQA 1IA9A 3LFBA 4I6FA 1J7LA 3OW4A 4OTDA 4GK2A 3FMEA 4RIXA 3EZVA 4CMUA 3BU3A 5LMBA 3PTGA 5HIEA 3LLTA 3KVXA 4XG4A 2PMIA 4DTAA 3GCVA 3KU2A 4FKTA 4MBLA 2X6EA 2C3LA 4IH8A 4Y85A 1WBVA 4L3LA 4LYNA 5A54A 4GV1A 4M67A 1OUKA 4RX7A 1H1RA 4LGDA 5IEVA 2QU6A 3Q32A 4FTJA 5AP2A 4ASDA 4CEGA 2ZV7A 4FEWA 5HGIA 4IM3A 1QMZA
chains in the Genus database with same CATH superfamily
1ZOGA 3FECA 4U79A 5AXIA 2HIWA 1Q24A 4RIXB 4WT6A 2HY81 5CEQA 4BGGA 4NM3A 4J8NA 4OAVB 4O0SA 3NDMA 3CTJA 4W9XA 3TUDA 5EM6A 4TTHB 4PTGA 3MVLA 2PZ5A 2WOUA 4F7JA 4FVQA 3LHJA 2B54A 4IFGA 2YCRA 4K33A 2UZVA 4UYAA 1ZARA 5AUYA 3BI0A 4BKYA 3ZBXA 1ZWSA 2X8EA 4L68A 2QOOA 1KE5A 3BKBA 4QRCA 4ZAUA 3N9XA 4M7IA 3OCGA 3DFCB 1XBBA 2VTSA 3HA6A 4F9WA 3UIUA 3VQUA 1PRYA 1F5QA 4FEVA 5CSVA 4FKUA 4ANNA 4NGRA 3BL9A 4DGMA 2C6CA 2XEIA 1URCA 3WE4A 4IAIA 2WQEA 4PDYA 4IJ9A 4RLKA 4FSUA 1R3CA 1BMKA 3AQVA 5EHLA 4BL1A 1G8SA 2EVAA 4FJVA 5A4LA 4FV0A 2XAOA 3LLAA 3E8DA 4QT1A 1BL6A 5EFQA 3NYNA 4B0GA 2GQSA 4R8QA 5CSWA 2WO6A 2BILB 4MAOA 4U43A 3Q5IA 3F2RA 2XVDA 4EH9A 3PFQA 1CMKE 5HVKA 3RCJA 4L44A 4MXCA 4BCNA 2VWBA 5IH4A 4I92A 3NNVA 3G5DA 2OO8X 4I94A 3CGOA 5EI6A 5IG1A 1FVVA 2PHKA 2QHNA 3HMOA 5AV0A 2NP8A 4U6RA 3ODYX 3VNTA 5JKGA 3SVVA 3GEQA 5E90A 2WTKB 4ZLZA 3UDTA 3QRUA 3GC0A 4E8AA 1A9UA 1O6LA 4XOZA 3MN3A 5CSHA 4BDKA 2QOKA 4YC6A 2E9VA 5I0BA 4B9DA 3T8OA 4I4FA 2H6DA 3VIDA 5E1SA 3DY7A 4UN0C 4BJJB 5FEDA 2E9OA 3ZZEA 4BR3A 5CI7A 2XK7A 5D12A 5DPVA 4PL4A 5TOZA 3Q9YA 4E93A 1NA7A 4PPBA 1Y57A 4YBKA 1IEPA 2W96B 4M3QA 3S95A 3FEEA 2YCFA 2V0DA 4U0IA 2JKOA 2JBPA 5HKMA 1VZOA 2ESMA 5E8XA 3AD6A 3VJOA 3G6GA 2PUNA 3OZ6A 2X81A 3TJDA 3I60A 2UZBA 4PNKA 2C6LA 3HYHA 4CFNA 3F3UA 4IM0A 3KIOC 2CSNA 5FXQA 3AMAA 3UYSA 3DT1A 3ZDUA 2IW9A 3FZSA 3S0OA 5GINE 4G1WA 4LMNA 4R5SA 1KWPA 4CFFA 3O51A 3E8EA 4OR5A 4D2SA 4HZRA 3LFEA 4FE2A 3QD3A 5LVLA 2B1PA 4MWHA 5CVHA 2XIZA 4CRSA 3O96A 1FGIA 1U54B 2OW3A 4R1YA 4FTAA 5L6OA 1KE7A 3NCZA 4KAOA 2VTNA 5CLPA 4C4JA 4F6WA 4O27B 5IA0A 2W5BA 2VX0A 4O7RA 3WILA 4JMQA 3PFYA 4QP8A 4R1VA 1CKPA 3CPCA 3VN9A 4ANLA 1WBOA 1P4FA 2W4JA 1OUYA 4XCUA 4QEBA 1RQQA 5M53A 3BUMB 3LCSA 5AR5A 2C4GA 5HG5A 4D0WA 2AC5A 5IISA 1ERKA 3QA8A 3VJNA 3PZEA 2Q0BA 1ZYSA 3FI8A 4DHJA 1OL5A 5HQ0A 1S9IA 4JBPA 4P2KA 5AM7A 5CASA 3FMJA 1B39A 2E9NA 2XIKA 5E92A 4LV5A 4TN6A 4L01A 1YI6A 4RWLA 4O7ZA 1YXSA 2WPAA 2Y6MA 1H07A 4B6LA 2BPMA 4FKWA 4W4VA 3RK9A 3ZTXA 3MFRA 3PP0A 5CXZA 1YDRE 2JIVA 3GNIB 4JZ0A 3AKJA 5KMOA 3P79A 4UEUA 4YJOA 4GYIA 4PL5A 4P4EA 4F1MA 5E7RA 4NM7A 3DOGA 5AR7A 3MVHA 5L6WL 5IZFA 5BUIA 3U6JA 2HWOA 2VO3A 3G6HA 5DR6A 4JG8A 3HV7A 5JGBA 5M57A 3T9IA 2C5YA 4IWQA 3GCQA 3FY2A 3PXFA 3OUNB 2J6MA 3WZJA 4NEUA 5B2KA 3QCYA 3R7VA 3VRRA 3OMVA 3OP0A 3QUEA 4QNYA 3OUKA 4DH5A 4HGSA 4JDHA 3BUXB 3GVUA 2PE0A 2OKRA 2EUFB 4I5HA 4Q9SA 4WIHA 1WVWA 3NUYA 4FZ7A 4AW2A 5H3QA 1YXUA 5HCZA 2P3GX 4JQEA 5B2LA 3MDYA 2JKQA 3T3UA 5HE0A 2R7BA 4BICA 4O4EA 3R22A 3C51A 3HP5A 5IA2A 1CDKA 4RX5A 3LQ3A 5T68A 3MSSA 3W1FA 1SZMA 4YJSA 5CU3A 4DGNA 2R5TA 5F94A 4YTHA 4DH7A 2C6MA 4W9WA 4YPDA 5IQHA 1UKHA 3DXQA 1YHVA 3MGYA 3UZTA 4D1SA 4G34A 3QQUA 4ZXTA 4P4DA 4EC9A 3R21A 3TM0A 4QTCA 4X6RA 5DN3A 4H1MA 3ZMMA 4ASXA 3TMOA 2BTRA 5I9UA 4G3DA 4AXAA 2CCHA 2WTDA 4ALWA 5FP5A 4J95A 4BF2A 1H4LA 4K8AA 3U4UA 1PY5A 1WZYA 1Y8GA 4K11A 5GZ9A 4DE4A 3FBVA 3ALNA 3F3TA 4MHAA 3FSKA 3UMXA 4C2WA 3IS5A 4K6ZA 4RMZA 5KBRA 1PKDA 1GIJA 4O0YA 5FWKK 3MH3A 3L9MA 4LUDA 2VV9A 3W33A 1KUTA 2QO2A 4QP6A 2PMLX 1KOBA 4O2ZA 3V5QA 3WOWA 1LEWA 4O38A 2ITTA 5EKNA 5HORA 4AX8A 4L3PA 3FLWA 4DFXE 5BQ0A 3UO5A 4FSTA 2QONA 1WBNA 3BHVA 3LJ1A 4WSYA 5M56A 5JFSA 2YCQA 3LJ2A 4Y46A 4HVDA 5LWNA 2LAVA 2V22A 4IDVA 4L67A 3VUKA 3QC4A 5BV3A 1Q8TA 2RL5A 4LRJA 4C4IA 5L8KA 4JR7A 4C2VA 5BVDA 2B0QA 3V5JA 3ATTA 3FZ1A 3SXFA 1GNGA 2RFDA 2IJMA 2WEIA 3PY3A 1UKIA 5CNOA 2ZV8A 3BGPA 4NIFB 5DYJA 3NW7A 3ORZA 3VBQA 5D41A 4NGMA 3OG7A 3R8UA 4FL2A 4PMMA 4F0GA 5BVKA 3PXZA 3VO3A 4WNOA 3QHWA 1LP4A 5ITAA 2XNPA 3ETAA 3QYWA 3GC8A 5B2MA 3MVMA 5FP6A 3C0HA 4DGGA 2JBKA 3UPZA 2AEGA 1OPKA 3HRCA 3RCDA 3C1XA 2QOBA 2CDZA 2ERKA 2GQGA 4IAZA 3VUHA 3ACJA 3FDNA 2HZ0A 1IRKA 2XK8A 1SVGA 5HG7A 1ZOHA 3PVUA 4FKQA 4D1ZA 3OT3A 4EZ7A 3A4PA 1JBPE 4HPUE 1T46A 4EH8A 5HKZA 4Y8DA 4KIKB 1PXNA 3EN7A 2W1EA 4S32A 5HBHA 4ZLYA 4X21A 4NGTA 3ATSA 2PZPA 3Q3BA 3W8LA 4EHVA 3NW6A 3DQWA 3JS2A 4UB7A 5CZIA 3TNIA 3OW3A 2UZLA 3PT1A 4F08A 5H9BA 4EJ7A 4LV7A 2W1GA 4JBQA 5AV1A 5FDPA 4CYIA 2VWYA 1YOJA 2HWPA 2J5EA 3MPAA 4QMVA 4YZBA 3CKWA 3RALA 3EQIA 3QCXA 4K1BA 3QHRA 1KE8A 3AG9A 4RWKA 3R8MA 3ZYAA 4DLJA 3Q60A 1FBNA 2BAKA 2YIWA 3ITZA 4CFXA 4MYGA 4BDDA 4EQUA 4YR8A 3OXZA 4AA0A 3IDBA 4I4EA 4O4FA 3PP1A 2V7OA 5A3XA 3VUTA 3LMGA 4N70A 4P4FA 3NZ0A 1XKKA 4NFMA 4UV0A 5D7VA 4F65A 3IW8A 4X3JA 3AGMA 4IX6A 5IA1A 3DDQA 2J4ZA 3W2SA 5BVOA 3UNZA 1ND4A 5M4CA 3OF0A 3ULIA 5AAGA 5J1VA 2GHGA 4R77A 2IO6A 3B8RA 4DC2A 3AXWA 3GU4A 3O8UA 1ZYDA 2XA4A 4FSRA 5C8KA 1QPJA 4OLIA 1Q8YA 4JX3A 1F3MC 4F7NA 4XP0A 3BGZA 4IC7A 3ZEWA 1OIRA 3OY3A 2JDVA 2XKDA 4XG7A 3H0ZA 1YRPA 1GJOA 2IW6A 3P4KA 2X9FA 4I3ZA 5HNGA 1G8JA 2W1CA 3HGKA 4FIGA 5BYZA 3UIMA 4ORKA 3R7OA 3L9LA 4O7WA 2VO0A 4JJRA 2RFEA 4TXCA 1TZDA 4DEAA 5AM6A 4LOPA 4TY1A 2GS2A 4AA4A 3TXOA 1M14A 3BPRA 1Y8YA 3LFCA 4IWPA 1R1WA 2QOFA 1JAMA 3NNUA 3NYXA 4CFUA 2RIOA 3DGKA 3ORMA 4WUAA 1W7HA 4U8ZA 2CKOA 4IBMA 4G6OA 3U9NA 4B8LA 4QMOA 3PUPA 4YLLA 3O50A 4TT7A 5C4LA 3R8ZA 4FSWA 2YJSA 2VGOA 4PMSA 1YXXA 3MV5A 4BI0A 5G1XA 2Y6OA 5I9WA 3FEGA 1K9AA 4XUFA 3MY0A 4I6QA 4DEDA 4WG5A 4D1XA 2XARA 4EKKA 5ANGA 1A48A 3MBLA 4QP9A 4WA9A 3FL5A 3PE1A 2YM8A 3CQEA 3ORTA 4QMXA 1CKJA 5ETAA 3D7GA 4GT3A 2YDKA 1OIUA 3SRVB 3HRBA 3BHHA 5LOHA 4C35A 3R9DA 3NFFB 4XG6A 3BWJA 4FT7A 4YJNA 1OBDA 5BYYA 3FMMA 2RFSA 1FOTA 3EQRA 3JXWA 4LRKA 1SYKA 3F2AA 5DWRA 4EWHA 4YJRA 4CMOA 3EIDA 3EQFA 1XH6A 4DG0E 4OC0A 4HJOA 2VGPA 4G17A 1STCE 2BZKB 3QF9A 4FKRA 5E8WA 4EHGA 5TO8A 2FSTX 4CT1A 4HPTE 3GENA 2XUUA 4C4FA 1ZMVA 4XYFA 2HELA 4EBVA 4EOLA 4RC3A 3RAWA 4X3FC 3ROYA 1H25A 5JRSA 1UNGA 5T3QA 2XEFA 3K2LA 3KCFA 5HD4A 3AKLA 3W0PA 2ZB1A 2ONLA 4PWNA 5JFWA 1MRVA 4AT3A 2JITA 1ZZLA 1TQIA 3WIGA 3VHKA 2WB8A 3LCTA 4GJ3A 3ET7A 2W1ZA 3MYGA 4ZY4A 2XK9A 4K2RA 2O2UA 2GQRA 4H3QA 2UZOA 1YWRA 3FZPA 1GZNA 3FZTA 2BIYA 3AD4A 4I5PA 4C59A 3Q4ZA 4S30A 4B7TA 5BVWA 4CFVA 4C8BA 4KD1A 3EMGA 2X0QA 5E8YA 5KX8A 4M69A 2HAKA 4I0TA 3NYOA 3OD6X 3R1SA 5DR9A 3BI1A 4DEEA 3BUOB 2BFYA 2C5NA 2YM5A 4MXXA 5HCYA 3PSCA 3QKMA 4E73A 4RZVA 3DZOA 2BHEA 4ZSEA 4XMOA 4GU9A 4DA5A 5L2QA 3D94A 3H10A 3R8PA 5CF5A 4Q9ZA 5LMKC 2R0UA 4M69B 4LOOA 1YXVA 3D5WA 3MFTA 4XEYA 2I0HA 5IKWA 3HLLA 3COIA 4MCRA 3A2CA 4FTTA 3NS9A 2GMXA 5LMAA 5HU3A 3TKHA 4USEA 2XJ2A 3UNJA 5E8VA 2NYAA 3NUNA 4G31A 4PUZA 5LVOA 4QMQA 1Q3WA 2VRXA 3TCPA 3AMYA 3CIKA 1PXJA 1PXLA 2GNFA 2QR7A 3OVVA 4GUEA 1H0WA 4IX3A 4N4SA 3DNDA 3QTQA 3QZIA 4CFMA 5BNJA 2NNWB 2CGUA 3SV0A 1FBVA 2XPPA 2A1AB 2QI8A 3TWJA 2C1BA 4WRSA 3RPYA 5IU2A 5F09A 2VTMA 3R02A 1XH5A 4F9CA 3BUWB 5GHVA 1G8AA 4TWOA 4GH2A 2R3KA 1G5SA 3C4EA 3I0OA 4HYHA 3KASA 3C4WA 3TYKA 3W0RA 1UWHA 4ZP5A 3ZS5A 4CCBA 1HOWA 3DLZA 3HMPA 4I23A 2R3FA 5AV3A 3UDBA 3EN5A 4CZUA 2X9EA 4BTKA 4EHEA 5KMIA 3TNWA 3UOHA 1DI8A 4Z3VA 5AV2A 4QPAA 4A4LA 3E92A 2WXVA 4FTOA 1P4OA 2H9VA 2JC6A 1RJBA 1E9HA 4KRCA 5CZHA 4RIYA 4RJ3A 5EQEA 5CYIA 1UU9A 2Y8OA 3FXZA 3EQCA 4AAYA 2XKCA 1LR4A 4I24A 1SMHA 3EL7A 3QLGA 2UW3A 3FPQA 1WFCA 5AR2A 3IONA 2UW7A 4RWIA 1R0EA 5ETFA 2WAJA 4KBCA 2OK1A 5HNIX 4U9AA 1W2FA 4IVBA 4AN2A 4X3RA 2B53A 2XYNA 2YLFA 5DFPA 3UGCA 3ZRKA 2F2CB 4FX3A 3PZHA 4HCTA 2F7EE 4Q5HA 4G9RA 4JVGA 4LI5A 5CTPA 3QTXA 2YIXA 2OSCA 4IXPA 1I09A 2W0JA 4IW0A 2GTMA 5K4JA 4FI1A 3F5UA 5I3OA 2Y4PA 4P4BA 1H26A 4XX9A 4AGCA 4DGOA 5JGAA 5M09A 4BWPA 3AC1A 3FHIA 4JDKA 3GC7A 3HVCA 4AT4A 1NXKA 2XKEA 2WMRA 3DJ6A 4A9YA 4BTJA 4EH5A 4ENYA 3EL8A 2C5VA 4ACHA 2QVSE 1W98A 5EYMA 3UIBA 2X6DA 3MPMA 4FG8A 3CS9A 2PVVA 2PSQA 2O63A 3ZXZA 4W4YA 4DH8A 1J1BA 4CXAA 3CQUA 4LOQA 4GG7A 4O0UA 4E6DA 5HKWA 3FI4A 3EH9A 4R3CA 5G6VA 2QURA 3HZTA 4PDOA 5CEPA 4JQ7A 5IQBA 4IVDA 4FODA 3ZLYA 1Y6AA 1ZLTA 2UZEA 3KRLA 3KXNA 4NWMA 4XRJA 4DDGA 4XV1A 1Q62A 2GHMA 2R4BA 4QTEA 1SVHA 2GFCA 5ANKA 5EW8A 2PMNX 2QKRA 3IKAA 4DFNA 1YI3A 4BBFA 1PHKA 4N6YA 2H34A 2REIA 3QALE 3WI6A 4U45A 4L6QA 1YVJA 3EKNA 1JSVA 1JSUA 4TKSA 3Q2MA 2WMAA 3OCTA 4YJQA 3GCPA 5CVFA 4CSVA 4DG2E 2O64A 4FGRA 2VO6A 3MFSA 3KXGA 2NRUA 4NM0A 4K0YA 5L4QA 3ZUUA 3EWHA 4YURA 5M4IA 2BIKB 3MFUA 4TWCA 2CLXA 3A7IA 5DLSA 4BTMA 4IDTA 1JVPP 4NT4A 2A2AA 4GRBA 3ORXA 3MB7A 3R1NA 1J3HA 5AP4A 4JOAA 4IB0A 1VYWA 3MA6A 4AZEA 2WMXA 2BCJA 5DT3A 3C0IA 3ZNIA 4FSYA 3VUDA 4E4XA 5AEPA 2B55A 4CZTA 2R3NA 3TKUA 4ZK5A 3UMWA 5AP0A 1W83A 2F2UA 4JS8A 4BDFA 5IA4A 3QQKA 2ZVAA 4MNEA 1TKIA 3ZEPA 4CQGA 3UE4A 4EJNA 3Q4UA 4DFLA 1ST0A 5FDXA 3OEFX 2JD5A 3E62A 5T6KA 4G6NA 5TR6A 4YNEA 4CLIA 3BCEA 5CNNA 4JBOA 4ITHA 4BKZA 3EN6A 3Q04A 3RAIA 1ZYLA 3VRPA 3EJ1A 4D2VA 5JZNA 2ACXA 3F61A 3FYKX 3LCOA 4E3CA 3VC4A 4D2WA 1W82A 1Z5MA 3VS0A 4G16A 2YIYA 2PVLA 4J52A 5AAEA 4FIEA 5IQDA 2G1TA 4QDEA 4N0SA 5DBXA 3HX4A 4A06A 5KKRB 5CENA 4DINA 4NKAA 3R1YA 3P08A 3I0QA 4EQMA 1XMMA 1H1PA 4C33A 1FMOE 4IJPA 4E6QA 1OMWA 3PPZA 2C3KA 2RG5A 4EOSA 3P1AA 3QTIA 1YW2A 2J9MA 4O7YA 4OTQA 2ZV9A 5ACKA 3QTUA 4FT3A 4ALUA 3W18A 4EYMA 2XPLA 2UW4A 5DH3A 3RVGA 3KK8A 3U6HA 1XO2B 4TYEA 2XK4A 5F95A 2YERA 5IQGA 1SM2A 3L8PA 4Z55A 3ZRMA 4JL9A 5LJJA 4MCVA 3BI6A 4NGQA 4A4BA 1CTPE 3FKOA 4GVAA 1CKIA 1XH9A 3VS1A 2V55A 3V6RA 5HE1A 3RMFA 3D7TA 2YACA 2H8HA 2BZHB 3VS7A 4O22A 4EORA 2VZ6A 3WARA 5CAUA 2E9UA 4O7SA 3NWWA 1XBCA 2IZTA 5HO6A 3B8QA 5EKOA 1REKA 3DZQA 5A4TA 4X2JA 4C3RA 4CMTA 3DKGA 2FA2A 2UW6A 2YITA 3SD0A 3OWLA 4AF3A 5AUUA 3GBZA 2C6GA 3NUSA 3K3JA 3D7TB 3BGQA 4RJ4A 4TZRA 5H8BA 3WYXA 3SKCA 3FPMA 4P45A 5LCJA 2A27A 3TEIA 2WD1A 4RZWA 2CCIA 3FLQA 2AUHA 5C27A 5M51A 1PKGA 3ANRA 3RP9A 4EOJA 4QOXA 3LKMA 3O23A 4L52A 3F9KC 1GOLA 1M7NA 3EQGA 5CU0A 3TTJA 2UVXA 4C4EA 1OGUA 4A9TA 4ASEA 3IECA 4D2TA 2CNQA 3W2RA 2OZOA 3VONA 2WTCA 2X0OA 3BEAA 4OBOA 4JIAA 4D4SA 1J7UA 5ANDA 3VHEA 5EM8A 4BWXA 3BLHA 4PPCA 2ITQA 4YSMA 3SW4A 4NU1A 5JRQA 4ALVA 4BVUA 5FTGA 1UWJA 3NEWA 4KBKA 2BZJA 4FVRA 4MUQA 4G5JA 4EH7A 1WBTA 3V5PA 4BB4A 1YWNA 3AC3A 3R01A 4ITJA 4EOMA 3N4UA 3CY3A 4FOBA 4CV9A 1FPUA 4GSBA 4S34A 1OL1A 3F88A 3RAHA 3VW8A 3DB8A 4FEUA 4JRVA 5K0XA 1GAGA 1H24A 1JSTA 2J50A 5GNKA 3A61A 3TIYA 2EXCX 4MD7E 4NW5A 2WGJA 4BI2A 2BTSA 1R39A 5FM2A 2B9JA 3LXNA 3SOCA 3QZHA 4AS0A 2PU8A 3QFVA 2CN5A 1ZY5A 3UVRA 4MNFA 4AWIA 4BJJA 3COKA 4KWPA 1JWHA 5HX8A 5TKDA 4AZFA 3ZU7A 4R78A 2XKFA 2KULA 3CD3A 3OTUA 4GL9A 4EZ5A 3BE9A 4GMYA 3FMKA 3L8XA 3IPHA 3W2PA 4RIOA 3KXHA 2G2HA 4DF3A 2BZIB 5E8TA 3QUPA 4DEBA 1MQBA 4UZHA 3Q52A 4XLIA 3D2KA 3BHUA 1ZY4A 1OIQA 1H27A 4FV8A 5DT4A 3NRMA 3FWQA 2BFXA 1YHSA 3W0MA 5IQAA 5H2UA 4FV3A 2C6EA 4O1PA 2I0YA 3UOJA 3N4TA 5CWZA 1S9JA 5AP3A 4BDBA 2WQNA 2WU7A 3D4QA 5EDRA 4M0YA 5FTOA 5F20A 3UVQA 3VRQA 2ZM4A 4O84A 4I41A 2DWBA 2QODA 4O0XA 4EOIA 2QC6A 5HBEA 3WZDA 4F0IA 5FD2A 1Q4LA 1U54A 4RT7A 3ZSGA 5TF9A 2ETRA 3ALOA 2X1NA 3MB6A 5HTCA 2XNGA 5C8NA 3H9FA 5DIAA 4GUBA 4AXCA 4IHPA 4KRDA 3TZMA 2CIJA 3KRJA 4A9RA 3ORIA 4FIFA 4AOIA 4FTIA 4AXFA 3AOXA 1PF8A 3FZRA 4F6UA 4O7TA 3HAVA 3RWPA 2Y4IC 4NGNA 3HV5A 4I1ZA 1YKRA 4X2NA 1W2CA 4YGAA 3DLSA 2B4JC 4KS7A 4KS8A 1AD5A 4QTAA 1H28A 4XG9A 5IA3A 4ARKA 4ZMEA 4BZOA 3KCKA 5CX9A 5L6PA 2OH0E 3PLSA 4NFNA 2P2IA 4QQ5A 1OECA 2XZSA 4ANOA 4D2PA 2OBJA 3UQFA 2UW9A 1QL6A 5KUPA 5HEZA 3FF3A 3R8VA 3O7LD 4UMRA 4O81A 4H3BA 4YSJA 4YP8A 5KCVA 5LXMA 3F5XA 4YJPA 4FIJA 3OCBA 3G15A 5CU2A 3A60A 4Z7GA 2QHMA 4BN1A 4C02A 4PRJA 4MXOA 4V0GA 1NVSA 4YTCA 5I9XA 4EK3A 3ZBFA 3QKKA 5GJFA 2WOTA 4DCEA 1JQHA 1PXKA 2R3RA 1Z9EA 2JFLA 3EN4A 4YUQA 1GY3A 5FM3A 4D28A 5DT0A 4BDHA 4ZTMA 4FUXA 3E7OA 3LQ8A 4G9CA 4C37A 1WBSA 4EI4A 3GU5A 1NVQA 4IAYA 3PJ8A 4FKVA 4RIWB 4DG3E 4U97A 1WAKA 4YPSA 3C13A 4AGDA 4DTKA 4CTCA 5DNRA 2JDSA 2OXDA 4F64A 4YJTA 3GC9A 5CVGA 1VJYA 2PZRA 3SW7A 3SJEA 4V0GB 2C0IA 3CE3A 1VYZA 3O7LB 4GT4A 3IOPA 4PV0A 4MX9A 4U80A 3PSBA 3A7JA 2Y1MA 1Q5KA 2YIQA 2HYYA 3FKNA 3PXRA 4M66A 3O5AA 3TUCA 3JY0A 3CLYA 5CQWA 2OJIA 4D4RA 4CKIA 3LM5A 5A4EA 4BBEA 2ZM3A 4BPXB 1WVYA 1W84A 5DGZA 1BYGA 3ZSHA 2WELA 4U3ZA 3MIYA 3A4OX 3W2OA 5LVPA 3JUHA 4ONAA 2R7IA 4HW7A 1OKWA 5GJDA 2ONLC 2OJFE 5A6OA 5KO1A 1XMLA 3E63A 2IF8A 4CZYB 4MH7A 2X8IA 3Q5ZA 3BX5A 1I44A 3ZDIA 3QBNA 2VTQA 4E4NA 4AN3A 3FMNA 1PXIA 5FGKA 4QMSA 4ZSGA 3PA5A 2YCSA 3BLQA 3LXPA 1GZOA 5CXHA 4ZTLA 4YZNA 2NRYA 2JBJA 3ROCA 2FB8A 4EL9A 4X7QA 2JAVA 3MY1A 3W0QA 2JFMA 3H0YA 1CX8A 5C1QB 2PK9A 3C0GA 5GJGA 4C0TA 2C68A 4LDTA 3UZRA 1ATPE 3IK3A 4NL0A 4FIIA 4OTFA 3NMUF 1IR3A 3R7UA 4EH2A 4F7SA 4Z9LA 3UNKA 3EHAA 3RPSA 2IW8A 1UVRA 4YZDA 3CC6A 3EFKA 5CANA 3A7GA 3LXKA 2PVMA 2WMVA 1IASA 2BR1A 4O4DA 5HE3A 5HVJA 3TNQB 3FI2A 4WNKA 4QP4A 5HCXA 2CHLA 4PQNA 3M1SA 5J7BA 3OROA 3I1AA 4JG6A 3ZFYA 1OM1A 3VRNA 3PJCA 4DITA 4M68A 2X39A 4FK3A 3ZLXA 4ZJVA 3IQ7A 3ORPA 2XNEA 3HV4A 5E8UA 5M55A 3UOLA 4NSTA 5AA8A 1Q3DA 4B4LA 4OW8A 3EQHA 3DAJA 4EOQA 4R7BA 4FUYA 4FBXA 3F7WA 4BWKA 3BYSA 4D55A 3HPHE 4A4CA 4CG8A 4FKPA 3R9RA 2UZUE 4M8TA 3VULA 5DVRA 3RJCA 4AACA 1ZMUA 3DS6A 3KVWA 4MQ1A 4FV7A 5JH6A 3DK6A 3PPKA 4NIFA 4DFBA 3HMMA 4R6VA 4BDCA 4FG9A 4C36A 2WZJA 3HL7A 3QUDA 3NIEA 4TNBA 2WU6A 3UP2A 4YC3A 2YWVA 3F5GA 2VWIA 2ETMA 3BU6A 4NCTC 4Q2AA 4C34A 2VAGA 3RK5A 4QP7A 3ORLA 5DG5A 2WQOA 4KKHA 2XNOA 2YHVA 5HE2A 4BTFA 4FKLA 5AR8A 5TT7A 2VUWA 3OP5A 4LGGA 4PP9A 1H00A 4ANQA 5EW9A 3N4VA 3W32A 3GCSA 4GK4A 3PWYA 3VF8A 3E3PA 3I5ZA 4PDPA 3R7EA 3LFAA 3FXWA 3WYYA 4ACCA 4BIBA 1ZOEA 4C61A 4KIKA 2QLQA 3NR9A 3U54A 2W5AA 3PLFB 1FVTA 2PVFA 3TJCA 5KZIA 2QNJA 2R3MA 2GS6A 4V05A 2ITYA 2J0KA 5EM7A 5JEBA 4ASZA 2B52A 4IZ5A 2VU3A 1OIYA 2CPKE 4BZDA 3MJ1A 3BV2A 3I81A 3D83A 3NSZA 2YAAA 2PE1A 3HMJG 4RX9A 2CN8A 2QOQA 3PYYA 3KXZA 3HNGA 4P5QA 3R73A 5L2SA 5I3RA 3L9PA 5HLNA 1SVEA 2BVAA 3ZHPC 3Q96A 3GCUA 4FYNA 3BE2A 1RE8A 4YMJA 2XYUA 3SA0A 2OWBA 4YTIA 3R30A 3G2FA 1ZMWA 4ZTRA 4MCQA 5AV4A 2P4IA 5LCKA 4YU2A 3E88A 4Z7HA 3C7QA 4ZJIA 2CNUA 4EKLA 1OGYA 3H30A 4IVCA