4BTFA

Structure of mlkl
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
454
structure length
413
Chain Sequence
DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFILFHEVNEKLRDVWEELLLLLQVPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTASSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
publication title The Pseudokinase Mlkl Mediates Necroptosis Via a Molecular Switch Mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 145
structure length 413
sequence length 454
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btfA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 4btfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btfA03
2ZYBA 2C6MA 1FVRA 2VN9A 1STCE 4X6RA 4FK3A 3LCOA 3OW4A 3QD2B 3KK8A 5LVOA 2Z8CA 2UW0A 4TYHB 1XH7A 2WFYA 3RPSA 2JAMA 4GK3A 3RALA 1U46A 4ZJJA 1UU7A 4HCTA 1IASA 3KK9A 1U4DA 4L3JA 4YO4A 3NRMA 4KIPA 1ZARA 4FV9A 3C9WA 2RGPA 3DFAA 2UZLA 3CKWA 3G6HA 3QRTA 4YLLA 3Q5IA 3R8LA 1OIYA 1ZAOA 4NCTA 5A4TA 4L01A 2XS0A 4UXQA 3QTZA 5C9CA 3PLSA 4FZAB 2JIVA 3GC9A 4E3CA 4NT4A 3CY3A 1XQZA 3VRYA 4GSBA 3VBVA 3BUWB 1E9HA 3ZO3A 4C2VA 1PXIA 4IFGA 2G2FA 5T6KA 3I5NA 2R3GA 4OTHA 3H10A 4S33A 4YO6A 4R3PA 3BWFA 3E8CA 5LMKC 4ACCA 4NJ3A 2GPHA 3BEGA 3DLSA 4P5ZA 4U42A 3N51A 4X2JA 1FGIA 4WG4A 3GC7A 3GUBA 4FIIA 2XNEA 2OK1A 3FWQA 5CEIA 2YM3A 4B8LA 3Q60A 4LGDA 4ZY5A 4V01A 4FODA 4ID7A 4ZJIA 4EHVA 1KV2A 3ALNA 5A9UA 3SGCA 2ZM3A 5K4JA 2JKOA 3DCVA 3OWPA 3CGFA 4IBMA 5EW9A 3TACA 2C6EA 4ENYA 4E93A 4G6LA 3HKOA 4V0GA 2JIIA 2ZB0A 2CMWA 4MF0A 2JAVA 2YDIA 3EQHA 2FSMX 2OJ9A 3NUUA 4IEBA 2R7BA 2BRHA 4XOYA 1BL6A 4KBCA 3KEXA 3R7GA 3BCEA 3WF9A 3KFAA 2CGWA 4YBKA 5EDPA 2WMSA 4DEHA 2WMBA 3R9NA 2A4LA 2WELA 4IQ6A 2WMTA 3QQUA 4TYGA 3BU6A 1U59A 2YJSA 4YPSA 2OZAB 5K5NA 5KHWA 2QR8A 3D5WA 4LUDA 1K2PA 2X7OA 3BQCA 3G90X 2FUMA 5CSXA 2C1BA 3SHEA 4IX4A 1LEZA 4EHZA 4TW9A 2WAJA 3K5UA 5FDXA 3R1YA 2C3JA 2DYLA 1P5EA 4JIAA 4RA4A 2OF2A 4W4YA 3ZXTA 3FKLA 4DLJA 2UZVA 2FVDA 2XCHA 2Y0AA 3GC0A 1YXUA 3R9OA 1JVPP 2HAKA 5I9XA 3H3CA 5CVHA 1ZZ2A 2QOQA 4KIKB 4QO9A 2OJJA 2EXCX 2CGXA 5IDPA 2EXMA 2B0QA 4EC8A 4KSPA 5DT3A 5AP5A 4EOIA 1M52A 5JQ8A 2OZOA 3DZQA 3I6WA 2H34A 4YJUA 3GCSA 5D7AA 3VBXA 4D9TA 1YRPA 3M1SA 4JNWA 2WQOA 3V5QA 4C2WA 3CQWA 4RX5A 5BUJA 4Q9ZA 4RPVA 3WE4A 1BYGA 1KE9A 3VN9A 5J9YA 3A61A 3CD3A 4MBLA 4ZTQA 2QKWB 4I5PA 4UY9A 4F9WA 5EM6A 3W32A 3UOKA 4X2GA 2PZ5A 2OF4A 3O71A 3QTUA 4FR4A 4BCNA 4FTTA 3OOGA 4LMNA 3ACJA 1TVOA 3E7OA 4I6QA 4TWPA 2YISA 4R7BA 4HGLA 3F3VA 3FAAA 4HGSA 4K0YA 5BPYA 1ZOHA 4AN3A 1BMKA 2XJ0A 3F2AA 3HL7A 1UWHA 4WBOA 5BYLA 4QMZA 1URWA 4CV9A 3VS7A 2E9PA 1TKIA 2WTKB 5IA1A 4M68A 2JKMA 3WIGA 4AA0A 1YXSA 1RW8A 4JXFA 1W0XC 5JFXA 4IWDA 4DLIA 3BPRA 2VO6A 3G33A 3QKKA 2LAVA 2F57A 3FYKX 4C8BA 4M8TA 2XM9A 4ALUA 4HGEA 2B9HA 2XMYA 1H25A 4QP9A 3A7GA 5CVGA 2QU6A 1JQHA 2DWBA 4FV2A 5BVFA 3R8UA 4F70A 3TJDA 3UVRA 1JOWB 4FKWA 2C6TA 4NK9A 3K3IA 2R4BA 4II5A 4UXLA 5DVRA 2X2KA 4U5JA 2WTCA 4BWXA 2BTSA 3G15A 5IQFA 2QOOA 1P4FA 3DFCB 3CSVA 5CU0A 2WTKC 2CJMA 3DBEA 3EQRA 4QD6A 1ZMVA 5IEYA 4FG9A 4IM3A 4MQ2A 5AX3A 2PE0A 3IDPA 4FKGA 1KUTA 4RIXA 4R6VA 5JRSA 2PL0A 4PY1A 3RP9A 4D9UA 2GS7A 3ORKA 1V0OA 4IZ5A 1OL7A 3KRRA 4K2RA 4UMTA 1YDRE 4J52A 5LVNA 4OT6A 3DQWA 3FPQA 3R6XA 3U51A 5IISA 2Z02A 3SXRA 1YKRA 2PE2A 1A48A 3CY2A 5CU4A 1OKWA 2XIZA 3P1AA 5D41A 3HVCA 4CFMA 4BKJA 5HGIA 1XBCA 4DTBA 3WF5A 3MY5A 4IC8A 1MRVA 5CTPA 2C6DA 2R0IA 5IMEA 2PPQA 3H0YA 2XZSA 2YM4A 3A4OX 4E6AA 1YDTE 4ANNA 4DFYA 3GCUA 2CKEA 4HOKA 3PIXA 3IG7A 3SW4A 2ACXA 1T46A 3HMPA 4NJDA 4FTKA 4R1VA 3T9TA 4FTLA 3UP2A 5AR7A 2WU6A 4AACA 2CSNA 1F5QA 2XBAA 1J91A 2VTPA 1JWHA 3OT8A 3D7TA 2CNVA 4BCQA 3TNHA 5AAGA 4U41A 4E4LA 2JDSA 3D4QA 3I7BA 3BX5A 4I5HA 5FDPA 4M69B 4XP2A 3HP2A 5B2KA 4AA5A 2VTOA 2WHBA 5BYZA 5AV4A 2UVXA 2I40A 2W0JA 2ZMCA 3QLGA 5DH3A 3R71A 3RI1A 3ROYA 5FLFA 5HVYA 3BHTA 4UBAA 3R9RA 4TPTA 3ULZA 5KCVA 5ANDA 3WYXA 3HV7A 2RSVA 2ITXA 3JXWA 3O8PA 4IVAA 4NM5A 1B6CB 4FTCA 4WBBB 4EH6A 4EZ5A 1OPJA 4M66A 4OT5A 2VRXA 4WUNA 5CVFA 3D5UA 4FG8A 5CF4A 1FBVA 4CLIA 4D2SA 2W05A 4PQNA 3E64A 4IW0A 2B9JA 1J7LA 3LQ5A 5ANGA 1AGWA 4IX6A 3P0MA 1GJOA 2XNNA 2O8YA 2VX1A 5I5ZA 3I4BA 1G8SA 2XRWA 3I7CA 3I0OA 2VU3A 3AMBA 4WHZA 5AR4A 3RZFA 4OAVB 1E1XA 2WTJA 3EN7A 1YVHA 1FMKA 4BGGA 3AD4A 4L7FA 3AMYA 4JRVA 4G5JA 3T3UA 2UW9A 1NXKA 2GFCA 4DH5A 4GV1A 1BL7A 4CXAA 1ZLTA 4IWPA 4O0YA 4E6CA 1WBTA 3G5DA 4PMMA 3F7WA 3C4FA 3HV6A 1R78A 3QUDA 4KRCA 5HE3A 3KA0A 1OL2A 3IDBA 3IGOA 3KXGA 4EH2A 5AR8A 5K4IA 4D55A 1M7QA 2Q0NA 3ALOA 3C4XA 4H3BA 3VBTA 5CANA 5JFWA 3NUAA 4XUFA 4ZSLA 3FZSA 4R3CA 2UZOA 1M7NA 4DEGA 4W8DA 2P33A 3DK6A 3ENMA 3BYSA 3MH0A 4AGCA 4GMYA 2J90A 3MFUA 2IVUA 2HW7A 5AUUA 3CLYA 3FMLA 4QQCA 4MHAA 3U6JA 2QG5A 4FV6A 5HOAA 5I9YA 3VHEA 4ASEA 5EW8A 1PXJA 4F6WA 5CQUA 5I9VA 2YZLA 1KE6A 3AOXA 3FZTA 4IZYA 4FL3A 4WUAA 2VWZA 2NNWB 4XG6A 3NWWA 4EK6A 3QYZA 5A4LA 4UN0C 2R3OA 4CLJA 4O86A 1QCFA 3EB0A 3BKBA 5IA2A 4ITHA 2BHEA 3LPBA 2WXVA 3U9CA 3IOKA 4O81A 4X2NA 4QQJA 5FEDA 4B99A 4EH4A 3PJ2A 3U4UA 3EQBA 1H0WA 3ZOSA 2EUFB 5JEBA 5JFSA 4K18A 4KWPA 2WMXA 3B2TA 1JSUA 5A14A 1WAKA 4IAIA 3CCNA 4HVSA 2C5YA 3UYSA 4FKSA 5CXHA 3FXZA 3W10A 3ZRKA 4TN6A 1YOMA 3CJFA 4FICA 3QTXA 4YLKA 3F5PA 2C0IA 1JKKA 1XO2B 4GEOA 1JSTA 3U9NA 3V8WA 4KIQA 1OBGA 1L3RE 2VD5A 3L9PA 2ZV2A 4G31A 4FE2A 2JFMA 2Y4PA 1PMNA 3JY9A 4QNAA 3RPRA 3ZSIA 5KKRB 2CKOA 3NSZA 2Y1MA 2JEDA 3PSBA 4ITJA 2GNIA 3RJCA 3BHYA 5CF8A 2GTNA 3KCKA 4LOQA 2YIYA 4DG3E 4LM5A 4EBVA 2OIDA 5C1QB 1Q97A 2YWVA 1ND4A 5AFVA 5IQEA 5AP4A 3DNEA 2VTHA 3EZRA 4M15A 4XG9A 5CSWA 3LFFA 4DYMA 5AXIA 3MA6A 3QRUA 5B2LA 1Q41A 4E26A 2BILB 4YC8A 4AZFA 3FLSA 4XG7A 5HO8A 5JFVA 4HYSA 3RHXA 2VX3A 3BWJA 3HX4A 4O0UA 4QMQA 3BUMB 3TNQB 3MVHA 2V0DA 2C0TA 4RGJA 2B55A 4AW0A 2OO8X 3BBTB 3T9IA 4O7VA 4FTJA 4W9WA 1W7HA 3JY0A 4FT5A 2BDWA 5CYIA 2UW3A 5EH0A 2PE1A 4MAOA 5KKRC 4CFVA 3OBGA 3CTQA 4Z7HA 3ZO2A 3EQFA 2UZTA 1R0PA 3QLFA 4X7QA 1VJYA 3GENA 2O3PA 3LW0A 2IVVA 4FIHA 4DFNA 4AT3A 1OBDA 2W4KA 4YSJA 1REKA 3R21A 1GOLA 4O6EA 2PY3A 5DIAA 5IEXA 4D1XA 3T8OA 2X1NA 3Q32A 1XWSA 3DBDA 4G3CA 2XNPA 4G3EA 3O8UA 3H9FA 3O0GA 4MXYA 3EYGA 2F7ZE 5CAVA 1PY5A 5GIPE 4ZOGA 3PY3A 3PJ1A 2YIXA 3FI4A 4HNFA 2IZSA 5ANIA 5KBRA 2XYUA 1V0PA 3TN8A 3QU0A 1BKXA 4BY9E 5LWMA 2CNUA 2G9XA 5L2IA 4U0IA 2WOTA 2BCJA 3NYNA 2BUJA 4F63A 3FL4A 2AC5A 4CFWA 2YAKA 3NUNA 3EMGA 4RQKA 2YDKA 3QZGA 5DWRA 5HVKA 3PXQA 5BVOA 2OXYA 2C1AA 3DOGA 2ITUA 3V3VA 4LYNA 4OAUC 4FVPA 1KOBA 2RL5A 4IE9A 3RMFA 2PZRA 5HX8A 3EH9A 2IW9A 5AP2A 4FOCA 1BI7A 1M17A 3FC2A 4RLKA 4C4HA 3FPMA 3JPVA 3E92A 4EUUA 4LOOA 4RWIA 3ZC5A 4G2FA 2R5TA 3VBQA 4JQEA 3VUIA 2VWUA 2E9NA 3AT4A 3ZM4A 4MNEB 5EI6A 3CD8A 4QMWA 4YJOA 1OB3A 3HMMA 3FMJA 5LARA 4YTHA 4BCFA 3NNWA 5FG8A 3JVSA 1PXPA 4O22A 3KB7A 2VWVA 2C6KA 3VGOA 4J8NA 4FZ6A 4CD0A 5L6OA 1WVYA 3BU3A 2BZIB 3FDNA 4YBJA 4AOTA 4CRLA 4O7NA 4BF2A 3IGGA 5DA3A 3W2CA 3LCSA 4XHKB 2IVSA 4C4FA 2Y4IB 4DG2E 4GFOA 4ZTRA 4PUZA 1LPUA 1S9IA 3R22A 4QP3A 5IQAA 3WOWA 3QHRA 3QCQA 5AUTA 2PUUA 2Z2WA 4F64A 3DV3A 2YABA 3LCTA 4C4JA 3DJ5A 5F20A 4AS0A 4QMUA 4BYJA 5HIDA 2YJRA 4FKQA 5DOSA 4USFA 4CTCA 3RWQA 1U54A 4ONAA 4DFZE 4EQMA 4GS6A 3UNJA 4AW1A 4B8MA 2NP8A 1XHAA 4IANA 5FEQA 4FKVA 3TTJA 4WSQA 3MPMA 5LMKA 5KZIA 4BKYA 4OBOA 3ELJA 4BKZA 4M13A 5BNJA 3OWKA 4BI1A 5CF5A 3QC9A 4ZMEA 4Q2AA 3DPKA 3HA8A 3TG1A 1UU9A 2ITYA 4DAWA 2Y4IC 4JL9A 3G9NA 4I92A 2JDTA 4H36A 3C0GA 2X39A 4ZTLA 2Q83A 4YGAA 3JS2A 4DC2A 4I0SA 2J5FA 3OWJA 2IN6A 5EM7A 4HJOA 4Q9SA 3TT0A 3UIXA 2V62A 4PNIA 5E8XA 3FQHA 4ZZNA 3BYOA 5KBQA 5HO7A 5ANKA 1Q5KA 2ZV7A 3PXKA 3GNIB 4AF3A 3TCPA 1CM8A 3L8PA 4CKJA 4AZSA 1OL5A 1H27A 5A54A 3AC3A 5AUYA 4IB3A 4KB8A 4RT7A 3ATTA 2ETRA 3NCZA 3UC3A 5CEKA 5EM5A 5KMIA 4TRLA 1UNHA 3L8VA 3L9LA 4BDHA 4UYAA 5ANJA 3UVQA 1BX6A 2B52A 4YJTA 2R3LA 4FL1A 3TKIA 3TUCA 3ANQA 3SXFA 4A9RA 4BDEA 3VS2A 3F5XA 4FEVA 2C0OA 3C4WA 5BQ0A 4NZWB 4F6SA 1SMHA 2UZEA 4G9CA 4BWKA 1H24A 5L2TA 1OL6A 3L8SA 4ZSAA 2UZUE 4RG0A 4KKGA 3UNKA 4CMTA 3LOKA 2XIXA 3MN3A 4G6OA 1O9UA 2O65A 3PTGA 5HNBA 4F08A 4D2PA 5AAFA 4IM2A 3PDTA 4N70A 3QCSA 1LR4A 4PMPA 2QONA 2YIRA 4TL0A 1PW2A 2XYNA 5M55A 2YACA 4A4LA 3FLNC 3WZDA 3QTSA 4A06A 3VVHA 4QYYA 3F66A 4FTNA 5DGZA 2C4GA 3FMMA 3C50A 3RINA 3V51A 4IIRA 4KSQA 4MXOA 2RF9A 4DA5A 4O83A 2F7EE 2PVRA 4LRKA 4XYFA 5HO6A 3SOCA 3PG3A 1PMVA 3LKMA 2BAKA 3FYJX 1YVJA 3KCFA 4O38A 3AMAA 4EUTA 4IVCA 4J98A 4RQVA 1G5SA 4O21A 2IPXA 2VO3A 1ZWSA 1MRYA 5IQHA 3D7ZA 4DTKA 4USDA 4D2TA 4ARKA 5J7HA 5HE0A 1XH6A 4FT7A 2HCKA 3NIZA 1JLUE 2B9IA 3DKGA 3PVUA 3QRKA 1J3HA 3CJGA 3VS4A 3C13A 5HBEA 5AUWA 3LM0A 2JKKA 2V22A 4FBXA 3EOCA 3UNZA 4HVDA 4E8AA 4AGWA 2GQRA 4BCKA 3NAYA 1FBNA 4X3JA 1RDQE 1OPKA 4QP8A 1XBBA 5A6NA 3HMNA 3Q9YA 5CZHA 4P4CA 2R0UA 5CZIA 3S95A 3KXNA 1ZRZA 1H28A 5CAOA 1VR2A 4H05A 3ZFYA 4G3DA 4KS8A 3C5IA 3HGKA 1H4LA 1CKPA 1X8BA 2GS6A 3FL5A 1NVQA 4XNEA 4AUAA 5EYCA 3MY0A 4YTCA 1H07A 2XNGA 3LFSA 4GUBA 4DF3A 3PXRA 4FIJA 3ZHPC 1HCLA 1XJDA 3SRVB 3C51A 3VUTA 2BALA 2UVZA 3Q4ZA 2WD1A 2W1ZA 4GK2A 4LGHA 3OD6X 3RNYA 4CCBA 4NW5A 5H2UA 4GJ2A 2WMRA 1DAWA 3NW5A 3W8QA 4RA5A 5I3OA 4MBJA 3GQLA 4GU9A 5AM7A 3WF8A 5IDNA 5FTGA 5FXQA 3UZTA 3L9MA 1Z9XA 4L00A 1SZMA 2HXQA 5H9BA 5IQIA 3LJ1A 2XRUA 4RWJA 4XMOA 3MTFA 3V8SA 2NRYA 3TWJA 1Q8WA 1Y8YA 4KBAA 5IH4A 1F3MC 4M97A 4XLVA 4BDGA 2WZJA 4L7SA 2J6MA 1BI8A 2XNOA 4R7HA 1MQBA 4KNBA 4XG3A 5EYMA 4M0ZA 4FTMA 3V6RA 4D0XA 5HIBA 2HYYA 1WBSA 4Y5HA 2BDFA 3G2FA 2ITTA 1Q3DA 3FBVA 4FUYA 4M67A 3W55A 4BDBA 4ANMA 5KZ0A 2QVSE 1ZXEA 4WRGA 4AU8A 3ZUTA 1Y6BA 4XV3A 4MXZA 4BGHA 3ORMA 4U40A 3U8WA 5M08A 5JRQA 5H8EA 4U6RA 3MY1A 2JDVA 3R30A 1ERKA 4DBNA 4WOVA 5AM6A 5JGBA 3RM6A 3WZEA 3NNUA 2EVAA 3A8XA 4ZXTA 5TOZA 3VNTA 3K3JA 3ORIA 2PUPA 3MB6A 4PDOA 5L2QA 4EK3A 2BRMA 2XKCA 4EORA 2F7XE 3GU8A 3VUKA 1CKIA 3OB1B 1GZKA 5GIOE 1KSWA 4MEDA 2HXLA 5EI8A 1URCA 4FTIA 1P14A 3NPCA 4XRJA 4CTBA 5AR2A 3ZZWA 4JQ8A 4JX7A 3DB8A 4M0YA 4FKJA 4OTFA 5G1XA 2PVFA 4XBUA 4YR8A 3T3VA 2OIBA 2WQBA 4RIOA 3RPVA 3TTIA 4JDIA 4EI4A 2ZV9A 3KULA 2HW6A 4GYGA 4U97A 3QGYA 1FVTA 5HVJA 2ITWA 3QA0A 4QMLA 5C01A 5I3RA 2HWPA 4J95A 5J5TA 3L9NA 3CPBA 1V1KA 3F3TA 2YITA 5FBNC 4QTAA 3EN5A 3P86A 1ZYLA 4PMTA 2G1TA 4X2KA 3MV5A 2X4FA 3MPAA 2R3JA 4TT7A 5M06A 1WMKA 3F3UA 4FTUA 4D4SA 4EYMA 4BWPA 3UPZA 4CGAA 2OU7A 2ONLA 4TWCA 4Y46A 4F7JA 4YZCA 3R0TA 3D9VA 5AV1A 4IB5A 4X3FA 4QYEA 2LGCA 3C7QA 3I79A 4EK8A 4L52A 1KE8A 3KGAA 3TKHA 5K0XA 4JR3A 2FO0A 2XKFA 3VBWA 2CCIA 2OXDA 3AC2A 3ZMMA 5IH6A 1BLXA 1HCKA 3ZSGA 3P23A 4FT0A 4C62A 3BHVA 3MGYA 3PA4A 1WZYA 5BVKA 4B4LA 1MUOA 3LE6A 5HKMA 5DYJA 1YHSA 5GHVA 3LHJA 3LXKA 5AWMA 1SVEA 4E20A 2W4JA 5LCJA 3FMKA 2YLFA 3GOKA 4RC2A 2RG6A 3WF7A 3DKFA 1CDKA 2QOIA 4LGGA 3LLAA 2JLDA 1JNKA 5TKDA 3MI9A 3OCSA 4O2ZA 4WNMA 1M2QA 1OIRA 3Q9WA 4YZNA 4RJ5A 2VGOA 3MIAA 4YLJA 4CKIA 5LQFA 4FSWA 3W18A 3SA0A 1NW1A 5AMNA 1ZYDA 2QLUA 3G9LX 3PZHA 3FHIA 4YU2A 5L8LA 4FEQA 2HENA 4ZS0A 3NEWA 5J9LA 1H26A 3DBCA 4L43A 5CI6A 4N57A 4QYFA 3VQHA 3OOMA 5CNNA 3FLZA 2C47A 3EHAA 4QMXA 4RJ4A 5HEZA 1FMOE 3QCXA 4AW2A 2GHGA 2RFDA 2Y6OA 3DDQA 4EOMA 4E4MA 3C4ZA 4H58A 3HLLA 3OZ6A 3K54A 4MK0A 1S9JA 2PMOX 3NR9A 1A9UA 5H3QA 2KTYA 2YIQA 3UQCA 3F2RA 2H9VA 3QHWA 4NM7A 2AYPA 4QP6A 5C27A 4GVAA 2R3QA 2HZNA 4FKPA 3UE4A 3GT8A 3IQ7A 4K1BA 4RWLA 1OI9A 3PPJA 5CT7A 4O7YA 4FNYA 3NUSA 3FI2A 3ZH8A 4EOKA 2WTDA 2W1HA 4I23A 4AA4A 5BVEA 4BCOA 2X6DA 1FPUA 3QFVA 4IM0A 4UZHA 4XX9A 3UOLA 4EONA 2W1EA 2OSCA 4QYGA 2UUEA 2W9ZB 3CBLA 4J71A 5I9ZA 3LJ2A 4GYIA 3GBZA 3E8DA 4A07A 4ASDA 3RAWA 4KIOA 3H0ZA 3SLSA 4U81A 4FV7A 2W1FA 2R64A 3OVVA 3W16A 3RAHA 4A9SA 4MTAA 4O7ZA 3Q9ZA 5CT0A 4B6LA 4BCHA 4PL4A 2PZYA 2E9OA 5E1EA 4QP4A 2F4JA 3D5VA 3QQFA 1PXMA 3U6HA 3QKLA 5CU2A 1WBVA 3QTRA 4DT9A 3B8RA 3PXZA 3QL8A 1CKJA 4IH8A 5E90A 3C5UA 4WNKA 5FM2A 5M57A 4QTBA 4EL9A 3HV4A 3COHA 1GZ8A 2QURA 3SV0A 2XNMA 3FY2A 3AD6A 4ZP5A 1H1PA 4CKRA 3JUHA 2OJGA 3TEIA 4FG7A 3P78A 1KV1A 1WBPA 2XK3A 4IC7A 5I9WA 4IZAA 3TIYA 4K77A 4QQTA 5CI7A 5KUPA 3IECA 4HNIA 2BRNA 4MD9E 1YOLA 4PTCA 3AG9A 4IMYA 2JDRA 4YNEA 5K3YA 1W82A 2J0KA 3PUPA 4G9RA 5HG8A 1Y6AA 2F2UA 5H8GA 5HG9A 3ULIA 3ZM9A 5IUIA 4FVQA 3NYOA 4D2WA 1Q8UA 4JS8A 2J0JA 3ZCLA 2BTRA 2H6DA 3OC1A 4FV3A 3PLAE 1YWNA 2VGPA 2QOCA 3KU2A 4E4NA 1IAHA 5A46A 4BFMA 5E1SA 3PIYA 2E9VA 1J7IA 3FKNA 1Q8ZA 4KAOA 4OTQA 5M56A 2R2PA 3BGQA 2GDOA 3MFSA 1DM2A 3UYTA 5AA8A 4CYIA 2P2HA 4ZTNA 5F94A 2PUNA 3A7IA 3HMOA 5IZFA 3BLRA 1YHVA 3QQLA 4XLIA 5DEYA 4ZIMA 5ACKA 1IAJA 3I6UA 4IVDA 1UKHA 5T3QA 3RK9A 3KF4A 4DCAA 1GZNA 2QO7A 4GT5A 2J2IB 1YHWA 1I09A 3UMXA 4FNXA 4NTTA 4BRXA 5HORA 3SVVA 3QC4A 4BHNA 4CQEA 1YDSE 4RZWA 3GU5A 3W2OA 4NL0A 3F69A 4YURA 5AEPA 3QTQA 5EQEA 1W8CA 4AFEA 2QHNA 2BZHB 3R1QA 3IDCA 2GNHA 3B8QA 1DI8A 2ZM4A 5GZ9A 2XVDA 3U4WA 3UDBA 3F2NA 5AIRA 4BI0A 1SNUA 3OXIA 2WPAA 4BDIA 4KINA 5JZJA 4E5AX 4FKRA 3QUPA 1OZ1A 3U6IA 2I1MA 4JI9A 3KQ7A 2GTMA 1Q62A 3OCGA 3CS9A 3W2RA 2P0CA 3SG9A 3IO7A 3R28A 2J9MA 4AFJA 3A7JA 3GXLA 2G2IA 2IZTA 3CTHA 3EZVA 4USEA 4FTQA 5CSHA 3TNPC 4DE4A 2QO2A 5CALA 4NCTC 1K9AA 1ZY5A 3ZLXA 4BIEA 4XV1A 5IKWA 3ZLWA 4AZWA 4LFIA 4ZJVA 4IADA 5DPVA 4FSZA 4FSMA 3R01A 3P08A 5IA5A 5HNGA 3VRPA 4RX8A 4NM0A 3R83A 3ZBFA 2EB2A 3Q2JA 3FMDA 4DGNA 4IB0A 4CCUA 4ENXA 3EN6A 5E4HA 4DG0E 1JSVA 3MWUA 5FXSA 1SVHA 2ZM1A 4FTOA 4IJ9A 1OIQA 4DTAA 1ZYSA 3ZBXA 2FSLX 3VRQA 3RVGA 3ODZX 5EQYA 2HZ4A 3ZZEA 1IEPA 4OTPA 4GFGA 3OG7A 4FZDB 2C68A 4K11A 4IX3A 4UX9A 5ANEA 4AXAA 2UZWE 4D4VA 4D4YA 4HVHA 5LOHA 1YI6A 1Z5MA 5TR6A 2FB8A 4DEIA 2IVTA 4WKQA 4ZSGA 2W06A 1DS5A 3GCQA 3GI3A 5HTCA 5A4EA 4V04A 1KOAA 4FSRA 4L3LA 5L3AA 1PJKA 3ET7A 4F1MA 2Y7JA 5AR3A 5HG7A 3OW3A 4QOXA 4F9AA 4HGTA 3UMWA 2IW6A 3TZ9A 3EN4A 4OLIA 4DCEA 3UZRA 3A8WA 5A3XA 4RIYA 3MTLA 3IW8A 1OGUA 3I0QA 2C69A 4IDVA 3OEFX 4S34A 3VJOA 4F9BA 2BKKA 2X0GA 4O91A 4FNWA 3ID6C 3EKNA 2V7OA 5ACBC 3HAVA 2QOHA 3PFQA 4A9YA 4UWBA 5J1VA 3BV3A 4GPLB 3SXSA 3UBDA 4DH7A 2J0MB 3RAIA 3QF9A 4O0XA 3VRRA 3PVGA 4FGRA 1GIHA 3SOAA 2RG5A 2I6LA 5EKOA 5JZNA 5AV3A 4KKHA 2UV2A 5AAEA 5EI2A 4DITA 2UVYA 3W2SA 4ZLZA 4I24A 1Y91A 5C8NA 5CXZA 3OUNB 3CXWA 2RKUA 1WVWA 3D15A 2PK9A 3GGFA 2R3FA 4GIHA 1R3CA 4BDAA 2VTLA 4DEDA 2Z7RA 2YM5A 4ACHA 5JGAA 4U45A 4JR7A 4O7TA 2C3IB 4PWNA 4ZK5A 3EJ1A 1WCCA 4BCGA 1IR3A 5EQPA 3S3IA 4ANOA 5C8KA 3R1SA 4RC3A 5E8WA 4AX8A 4C38A 3PYYA 4H1JA 4J96A 3NIEA 1K3AA 3AC8A 2OFVA 4PP9A 2WO6A 4EEVA 4O96A 4Z3VA 3DBFA 3QQJA 4EOSA 5BUEA 2O2UA 5IA4A 2PU8A 4XG4A 4L42A 4XH6A 4PP7A 4ZMFA 1OKZA 1PMEA 1YXTA 4JG6A 4UMPA 5BYYA 5BUIA 2AC3A 3QCYA 4A7CA 4ERKA 4N6ZA 3MH3A 3Q4TA 2P2IA 5E8SA 2GSFA 5LCKA 4ZY4A 4U3YA 3RPYA 4JVGA 4YJRA 3UQGA 5KMMA 5DRDA 5FQDC 4PDYA 4YHTA 3EFWA 3OBJA 3MSSA 5HESA 4O7SA 3E8EA 4HPTE 2F49A 1ZY4A 5GINE 3R8ZA 3Q2MA 4FUXA 3TXOA 3PZEA 4NEUA 2WMQA 5EHOA 2WOUA 4AE6A 4RIXB 3ORPA 4XS2A 4AG8A 5M4FA 5GZAA 3KMUA 1J7UA 4NYEA 2VV9A 3A60A 3MA3A 3DA6A 3BLHA 3FLYA 3ZRLA 1SYKA 5K5XA 5DRBA 3NZ0A 4FVRA 2VTSA 3QRIA 3R02A 3KN5A 4OGRA 5AUVA 1I44A 4AQCA 1YI3A 3QZIA 4L3PA 3UOHA 3V5TA 3PY1A 4JBQA 4I94A 3DNDA 4G34A 4I6FA 3UP7A 3EQDA 3UO6A 4F9YA 3KY2A 4WSYA 3CIKA 4GCJA 3A2CA 4CQGA 4IAFA 4MH7A 5IH5A 4HYIA 3D7TB 2V5QA 3ACKA 2C30A 3KMWA 1VYWA 4JLCA 3UO4A 4PPCA 4RC4A 5CWZA 3PLFB 1OM1A 1CMKE 2WMWA 3P4KA 4FT3A 4NWMA 4YPDA 4EHGA 5LXMA 2FYSA 4FIGA 3VUHA 3BUOB 3MESA 4ITIA 3AC5A 4K9YA 3ZXZA 3BYMA 2C3KA 4BDKA 2IWIA 4CRSA 2CLQA 3Q5ZA 4GJ3A 4BDJA 3OTUA 4RX7A 1DAYA 4AGUA 5EHYA 4JRNA 3OEZA 2PVHA 4KABA 5CSPA 3LXPA 4O7LA 3QQKA 4L45A 2W5AA 4XG8A 4XP3A 3WYYA 5HLNA 3PA3A 3RKBA 4FI1A 1OPLA 2V7AA 3BE2A 2CKQA 1JKSA 1JPAA 5CASA 4F0IA 3TDWA 4EOLA 3S00A 4J1RA 3NW7A 3ZFMA 3HRBA 3UPXA 4AP7A 3BE9A 5EDQA 4Q5HA 3DY7A 2W9FB 4EYJA 1Q3WA 2J5EA 4YC6A 3GQIA 3QWKA 2WQNA 3ZSHA 4DEAA 1H1QA 3NAXA 1B39A 4FC0A 2X9EA 4C4GA 3R8VA 5AUXA 4EH9A 2W1IA 1Q4LA 5FWKK 4YUQA 2ZOQA 5TT7A 3VS5A 3AD5A 2W17A 4I4EA 4D1ZA 1FOTA 4BZOA 4EH3A 2WQMA 3DLZA 1Q99A 5EM8A 4E6QA 4ANLA 4A9UA 4CSVA 4F9CA 3NUXA 1B38A 4D1SA 1PKGA 5HHWA 4FSTA 3NW6A 3PJCA 3WZUA 5HQ0A 4EKLA 3IK3A 5J8IA 4EBWA 2PMIA 3R7EA 5A4QA 3TM0A 4K6ZA 4QNYA 1ZOGA 4TYHA 3G51A 2A27A 2FSTX 4GU6A 5EFQA 4ZAUA 2A0CX 2XEYA 3FMNA 4CV8A 5HLWA 4CMUA 5CEPA 5E8UA 4PL5A 4FX3A 4G16A 4JG8A 3TZMA 4ZZMA 3H9RA 3UO5A 2YLEA 5DLSA 4E5BA 3S1HA 3LFBA 4ACGA 3MPTA 1WFCA 2R3RA 1GY3A 3KXHA 4N6YA 5DT0A 5JN2A 5EYKA 1ZOEA 3OB2B 4CT2A 1E1VA 2WGJA 3HNGA 1Y57A 4JX3A 3HAMA 2CGVA 3VS6A 3CP9A 3F3ZA 2ZB1A 3UVPA 5J9ZA 5EW3A 4E7WA 4EH5A 5CAPA 2VTQA 2CPKE 4OW8A 3EIDA 3VUMA 1UWJA 2X8DA 4WG3A 3W2QA 3W33A 2XNBA 1GAGA 4E5WA 3BYVA 3LFDA 3V01A 4CEGA 1H1SA 2CLXA 3AXWA 3PE2A 3PSDA 2QR7A 2ZVAA 5HG5A 5B2MA 4RFYA 4FOBA 3NS9A 4EWHA 3F6XA 3GU7A 2ITOA 4FYNA 4YMJA 3SKCA 2GNLA 2J50A 3AT3A 2GNFA 4C35A 3KRWA 4F09A 5IF1A 3PP1A 5HIEA 2WNTA 3DXNA 3QZHA 3KXMA 4IXPA 2ERKA 3RCDA 4APPA 2WB8A 2YM7A 3K2LA 5BMMA 1PYEA 3FV8A 3S4QA 4DEEA 3VIDA 4EH7A 2X7FA 3R73A 5E9EA 3ROCA 2QQ7A 3NGAA 5AP1A 4F65A 3WBLA 2XIRA 1UNLA 5C8MA 1YXXA 2EB3A 3DTWA 4KRDA 4C3FA 4C7TA 4E6DA 3HV5A 4FKTA 4C4EA 3ZFXA 3V04A 1IA8A 3F3WA 4FGBA 2AUHA 3LFCA 4IJPA 4XOZA 2R3KA 4RBLA 2GFSA 1ZZLA 3E62A 4A9TA 4S30A 3NNVA 2OZAA 1NVRA 1XBAA 4GFMA 3VBYA 4U43A 4BBEA 4XV2A 3WE8A 4MCVA 4AE9A 3ZUVA 3V5JA 4BBFA 3TUBA 2OJIA 3N9XA 5KHXA 2A19B 3FE3A 3NUPA 5CF6A 3S2PA 4D58A 2ZAZA 4MD7E 5K0KA 4R7IA 2NPQA 4M3QA 4IDTA 3ATSA 4P2KA 4KIKA 1YXVA 3DU8A 3FQEA 4AOJA 2YA9A 2OKRA 4RSSA 4RJ8A 3UOJA 1U5QA 3FLQA 3VF8A 4F7LA 4WNPA 4BN1A 1NT2A 3E93A 4IAKA 5HCXA 4YZBA 2ESMA 3RWPA 4NIFB 4ANSA 5HX6A 5FUTA 3ORNA 4AT5A 4RIWB 3VRNA 4C36A 2ZDUA 2YEXA 3MH1A 2VX0A 3DJ7A 3MIYA 5M4CA 2B1PA 2WTIA 4ZTMA 3PPKA 4IZ7A 3GCPA 3WARA 3UIMA 5JT2A 1TQIA 3PIZA 3HDMA 2DUVA 3R7OA 2Y6MA 3DAKA 3GU4A 3SDJA 4HVIA 4LRJA 5EK7A 3O8TA 4PTGA 3QAME 3EL7A 3BI6A 2R3IA 3AC4A 1YOJA 3DAEA 4LI5A 4H3QA 4LV8A 1QL6A 4L67A 4RVTA 5CU6A 1QPCA 5TO8A 3KVWA 3D2KA 5JH6A 3VO3A 2GCDA 4G6NA 5DR6A 3P7AA 4GH2A 4C59A 4DGLC 3NYXA 3RTPA 2R7IA 4KKEA 1Q8YA 2XEZA 4EOQA 3LCKA 4JDHA 3PP0A 2DS1A 4I1ZA 3I81A 2X7GA 4NSTA 4WD5A 1W83A 3V5WA 2CKPA 2HK5A 5KNJA 3COKA 2FA2A 3QTIA 4I6HA 5M51A 3PG1A 2VAGA 4O1OA 4Y83A 2XCKA 1XH4A 4D2RA 4W4XA 3D2IA 2O5KA 1UKIA 5CAUA 4RFZA 4H3PA 4L9IA 5F4NA 2I0HA 4BVUA 2CN5A 5LWNA 4APCA 2IZUA 3DK3A 3ODYX 2P4IA 3WILA 1R0EA 4W4VA 4TXCA 2OW3A 3A99A 4FYOA 3FI3A 5AV0A 5IG1A 2OWBA 4FV1A 3P7BA 2REIA 5F95A 4ZEGA 3U55A 4WRSA 5A4CA 4EHEA 5E8YA 3ANRA 1VYZA 5D12A 1QMZA 5GJFA 2SRCA 5AA9A 3ORZA 4GT3A 3RNIA 4EZ7A 3ORLA 4IAZA 4A4XA 4JQ7A 4A4OA 1B47A 1UU3A 4RVMA 4Z7GA 4D0WA 3O96A 2PVLA 5EYDA 2WEVA 4OTGA 4PTEA 2RIOA 4CNHA 4OTDA 2BRGA 3PRFA 5E92A 4GKIA 1WVXA 1Z57A 4TYIA 5J5SA 3Q6WA 3OY1A 3EWHA 3ZO4A 3HEGA 3VUGA 2CCHA 1M2PA 2YN8A 3MVLA 2BFYA 4UB7A 3LCDA 2JD5A 4TWNA 4CZUA 3ZDUA 3R63A 3A7FA 4IFCA 1UA2A 4MF1A 4BTKA 3E3PA 5KX8A 2WEIA 4FSUA 2R3PA 3HUBA 2WIPA 1U54B 2W99B 3DB6A 5FEEA 3SW7A 2YM8A 3A4PA 3F5GA 4OTWA 5IQDA 5DE2A 2UZNA 1SM2A 1YW2A 4M84A 3OROA 5KMOA 3DBQA 3QA8A 4ZSEA 5HE1A 3M42A 4I21A 3R8MA 3AQVA 3PA5A 3QQHA 5HCYA 2BPMA 3VUDA 4FKOA 4BBMA 4EOJA 5HKYA 4FEUA 5DFPA 4D28A 4O84A 3KF7A 3COMA 4WNOA 4RJ3A 3R7UA 4GG5A 5AIKA 3PSCA 4HCVA 4PDPA 4W8EA 3SAYA 2BKZA 2PVNA 5D10A 4NFNA 2E2BA 2R3NA 2R9SA 4YJVA 3BLQA 4YJPA 4L53A 4PMSA 3ZS5A 1NA7A 4YZMA 4M69A 3FZOA 3CEKA 4NKSA 3VULA 2C5OA 1G8AA 3MVMA 4BTJA 4GKHA 3PVBA 1BUHA 3MVJA 2QI8A 4UWCA 5CX9A 4GUEA 1MQ4A 3TV7A 4IAAA 2W5BA 3DS6A 5CY3A 4MXAA 4BC6A 2GHLA 2ITPA 3QD4A 4I0RA 2J0IA 3LFQA 4L44A 5CENA 3R7VA 4FKIA 2HY0A 5D7VA 3RK7A 2GMXA 3VW6A 4BTMA 3ZDIA 4F1OA 2FH9A 4C34A 2WIHA 4IWQA 4FV0A 4KA3A 5GJGA 4F0GA 2XP2A 3HV3A 4EZ3A 3OP0A 4R5SA 4BYIA 5B0XA 3OHTA 2A2AA 3QBNA 3TKUA 3PPZA 3GFWA 1OITA 2UW5A 4QMNA 3NVKI 3OUKA 2QOBA 3O50A 1G3NA 2P55A 5CQWA 5ETIA 3QWJA 4P5QA 4AW5A 1OVEA 3R9HA 2J4ZA 3WZKA 4I20A 1QPJA 5HU9A 1U5RA 3QQGA 4S32A 2I0VA 3UTOA 3VRZA 4ACMA 2XF0A 3TDVA 1PHKA 1ZYCA 2G01A 4UEUA 3DKOA 2CNQA 4DGOA 4DGMA 2YERA 5L8JA 3B2WA 3DKCA 4EH8A 5CEOA 1ZMUA 3NCGA 3GCVA 5FTQA 3MH2A 5JMSA 2OBJA 4D2VA 3UC4A 3PRIA 3MJ1A 4JG7A 4BZNA 3GP0A 3LQ8A 3SC1A 2OG8A 2CDZA 2QODA 3QX4A 5DN3A 4BZDA 3A7HA 4EC9A 3LMIA 4ORKA 4QRCA 3W2PA 2VNWA 3FZ1A 5L6WL 4O82A 4LL5A 3KRLA 5M4IA 3DZOA 2BRBA 1APME 2CN8A 4M7IA 4AZEA 3R04A 4OUCA 2EXEA 4U80A 2UW8A 4JAJA 4UYNA 4QQ5A 1FQ1B 5L2SA 1SVGA 3IONA 3N4VA 3Q53A 5E8TA 4Y5QA 1YI4A 3EQCA 5CSVA 5DT4A 3H30A 2VTNA 3RBWA 3RPOA 4CT1A 3Q4UA 4PNKA 4F0FA 4NTSA 5HCZA 2PULA 1T45A 3QX2A 3Q3BA 5JGDA 3C0IA 2W5HA 3CGOA 1XH9A 4MVFA 5JKGA 3CC6A 4FK6A 3EYHA 5LMBA 4A4CA 1VZOA 1KE5A 2OH4A 5FGKA 5AP7A 3OF0A 1ZMWA 3OP5A 1JKLA 2NO3A 3L8XA 4CFXA 2PUIA 2BZKB 2IG7A 2BFXA 1UVRA 4X2FA 1Y8GA 1RQQA 2OGVA 5KE0A 4EQCA 3NVMB 1LP4A 4LL0A 4TNDA 4UMQA 4ZTHA 4DFUA 4G17A 3E3BX 4JDKA 4HYHA 4PF4A 4L46A 3M2WA 1IRKA 2WMUA 5LVLA 4WO5A 2YWPA 2BIKB 3R9DA 5ANOA 3SG8A 1Q8TA 2XB7A 5E91A 2W1GA 3E8NA 3LIJA 3U87A 5HICA 3WZJA 2JGZA 3FZRA 3KXXA 4QMPA 3POZA 3PJ3A 4FZ7A 3EFKA 3GEQA 4Y73A 4UWYA 4QTDA 1WBNA 4BDCA 1GIJA 2JBPA 1RJBA 4DINA 2PZIA 3QYWA 5HTBA 4FSYA 5IPJA 5EDRA 2PVMA 4I93A 4NKAA 4YNOA 3KMMA 2VWWA 5LVPA 3MB7A 1OKYA 4O0SA 3VQUA 3VC4A 3UQFA 3QGWA 3TIZA 3BV2A 4YZ9A 2XBJA 3TJCA 3UIUA 4CMOA 5IQGA 5EOLA 3TV6A 4BCJA 4FEWA 3NNXA 4U3ZA 5ICPA 3I1AA 2CBLA 2OXXA 4WT6A 4FA2A 4AAAA 4DFLA 4BIDA 2C6OA 3BUXB 1RE8A 2X4ZA 2A1AB 3MW1A 3EN9A 2HIWA 5J87A 5L2WA 4GK4A 4AN9A 2Y8OA 3Q9XA 2ETMA 3O23A 1V0BA 4EQUA 5A6OA 5LJJA 2I0EA 4FEXA 2C5XA 3PXFA 5HNIX 2C6IA 4AZVA 4EKKA 4IX5A 2PSQA 4GG7A 2QNJA 2Y9QA 3Q04A 2H96A 2Z7QA 2OICA 2QC6A 2YFXA 4UZDA 3UJGA 3JR1A 1DI9A 2WU7A 4C37A 5C4KA 3G6GA 4U8ZA 3EKKA 4N0SA 3RAKA 2YCRA 3Q4CA 5F1ZA 2XK4A 4BB4A 4HYUA 3LXLA 4L68A 3VS3A 4LOPA 3LFEA 4L6QA 4XP0A 2F2CB 3BGZA 3CTJA 2VTJA 2ITVA 2XIYA 3KULB 3UGCA 3DQXA 1CSNA 3K5VA 4BGQA 4JDJA 5HI2A 2VTRA 5JSMA 3TZ7A 2RFNA 5FP5A 4G5PA 1J1BA 4BTFA 4C4IA 3A62A 4AZTA 1JKTA 2OIQA 3CQUA 2YZAA 4N4SA 2PMLX 4MYGA 4TKSA 3I60A 3F88A 4QMVA 4Y72A 5DI1A 3UIBA 3IW5A 3ZONA 2X8EA 4QMOA 4XEYA 4IHPA 5AV2A 3GB2A 1TQMA 4QMMA 2X2LA 4Z55A 1SNXA 3FEGA 3FQSA 3JYAA 3RCJA 4V0GB 4X3FB 2PVKA 4LMUA 4XCUA 5J95A 1IA9A 5EHLA 5BVWA 4U7ZA 3G0FA 5E8VA 2UZDA 2PVYA 4MNEA 2QG7A 3HA6A 3ZYAA 5F9EA 5K9IA 3W1FA 4MX9A 2IO6A 5KMJA 4RMZA 1WBOA 3FSFA 2C5VA 3SQQA 3OFMA 5DHJA 2O64A 4HPUE 4FSNA 3QD3A 5CU3A 3VS0A 5CEMA 3KKVA 4FTRA 3ZLYA 3LJ0A 2Z7LA 4FT9A 2XK9A 2IJMA 3IPHA 4IACA 4BCMA 4PDSA 5E7RA 3FJQE 4MD8E 4BDDA 3QUEA 3P9JA 3MDYA 3R1NA 4I3ZA 1Q24A 5IUHA 4D5KA 4LUEA 2ONLC 1QPDA 4TZRA 4I5CA 4U44A 2ZV8A 4X3FC 3ZNIA 1OMWA 2RFEA 5D11A 4Z9LA 2W1CA 3F9NA 5FD2A 2B53A 5CLPA 3OS3A 3BEAA 3THBA 3L1SA 3R2BA 2BMCA 3E5AA 4FV4A 5ETAA 4AGDA 2OI4X 3GFEA 5FXRA 2W4OA 3MFRA 2HZ0A 2YAAA 3HUCA 1H08A 4GT4A 4KS7A 1CTPE 1EH4A 4JT3A 3ZU7A 2B9FA 3ZO1A 4FL2A 3ENHA 3PFVA 5CNOA 4DGGA 4ZS4A 1FGKA 3KN6A 2O63A 3NDMA 4XG2A 5IA0A 4GRBA 2XJ1A 3Q6UA 4I5MA 2EU9A 2GQSA 2UZBA 3KRXA 2GS2A 3GC8A 4PX6A 5AJQA 4QP1A 2VUWA 5DR2A 5AR5A 4B7TA 5ETCA 5LVMA 2PWLA 3FSKA 4GW8A 2W96B 2HWOA 5KMLA 4QPMA 4YHFA 3OY3A 3PVWA 3VAPA 4EWQA 4B9DA 2GNJA 1KWPA 2YDJA 3ZUUA 4RX9A 4ALVA 5B7VA 3TUDA 4F4PA 1UNGA 2ITZA 3E7VA 4OTIA 2O0UA 4PL3A 4CFUA 2BR1A 3DK7A 2QD9A 3BU5A 2HELA 3LVPA 2PTKA 4CG9A 4ALWA 5KMKA 3D0EA 5HKWA 4BR3A 4HCUA 2RFSA 3KRJA 5FBOA 5GJDA 4F99A 4P7EA 4A4BA 3PE1A 4YJSA 1R1WA 4YZDA 4FMQA 5HZNA 2BAQA 1PXNA 2H8HA 3GVUA 5D9HA 2V55A 4MNFA 1JAMA 3TZ8A 4UALA 5IA3A 2JDOA 4ERWA 3E88A 1FVVA 4DBXA 2XH5A 2ZDTA 2X9FA 2JIUA 2UW7A 3C4EA 3BELA 3QD0A 4GVJA 1O6KA 3WF6A 4ACDA 2KULA 2C5NA 4G3GA 3DGKA 4IAYA 4RRVA 4Z16A 4QPAA 3BGPA 4KBKA 1IG1A 2YCQA 3NUYA 1UV5A 2QCSA 4FSQA 4F7SA 3POOA 3C0HA 4S31A 3O2MA 3R8PA 2J51A 2VWXA 5AP6A 4LG4A 4J53A 4NUSA 5E8ZA 3NYVA 3QKMA 3DXQA 4Y95A 3DAJA 1NY3A 1GIIA 1A06A 5DEWA 3EFLA 5DNRA 5EG3A 5FTOA 2ITNA 2WMAA 5BVNA 4PRJA 3N4TA 3ERKA 3IW7A 3R7IA 1XH5A 3S0OA 2OH0E 5AX9A 5HLPA 4IWOA 4QMYA 4D5HA 3OTVA 1PF8A 4HVGA 2B4SB 3KC3A 3LZBA 4H1MA 4LV5A 4R5YA 3BIZA 5JQ5A 3VW8A 2B54A 4R1YA 4MWHA 4DHFA 5IMXA 3FUPA 3FMEA 3ORXA 1ATPE 1WBWA 3ZTXA 5HBHA 1R39A 2WMVA 3D14A 4RZVA 4DH8A 3VWAA 1O6LA 3SD0A 4F6UA 2EWAA 2Q0BA 5LMAA 1H01A 2WQEA 4EOPA 3N4UA 3C1XA 3AC1A 3DTCA 4NIFA 2B7AA 2I7QA 4YJQA 1P4OA 1Q61A 2BZJA 4RIWA 1H1WA 4C61A 4EJNA 1ZYJA 2QO9A 4M14A 2XUUA 4YP8A 3F7ZA 5M44A 3F82A 2PHKA 2YHVA 4X21A 1REJA 3AGMA 4W9XA 3LMGA 3LFAA 4HZRA 1F0QA 4U9AA 4R3RA 4TWOA 4FKLA 5M4UA 3EQGA 1NVSA 2G15A 3QZFA 4FF8A 2VWBA 5CEQA 1J1CA 4I4FA 4ASXA 4CZYB 5EKNA 3BHHA 3SRVA 1OUKA 3MBLA 3Q96A 1H00A 5FRIA 5L8KA 3HZTA 4H39A 3LMHA 3LLTA 2UW4A 3P79A 2JC6A 2R3HA 4QP7A 4WA9A 3RHKA 4G3FA 2BDJA 1OKVA 2QKRA 4RVKA 1OIUA 2FGIA 4FTAA 1AQ1A 2VTTA 4FKUA 3TL8A 3NMUF 4DN5A 3EL8A 4XRLA 4OR5A 3IW6A 4NU1A 2E9UA 4CZTA 5TE0A 5AP0A 4KUJA 3RZBA 4I0TA 4O1PA 2QLQA 3EQIA 2ITQA 3BZ3A 5AADA 3OWLA 3O17A 1JBPE 4AWIA 4WIHA 3HECA 4DH1A 5L6PA 5J1WA 2XK8A 3D5XA 4C02A 5M53A 2ETKA 3DT1A 3IW4A 4FNZA 2I0YA 4TYJA 4MQ1A 1YWVA 3QRJA 2W7XA 2VWYA 3FLWA 4MBIA 3C4CA 3GU6A 1H1RA 4XV9A 5H8BA 4C57A 3LQ3A 3AT2A 3OCTA 3COIA 2X81A 2G2HA 4O2PA 3RM7A 5J7BA 4MXCA 4CYJA 3ZLSA 2HOGA 3UG2A 2GQGA 3VHKA 4M12A 2XJ2A 4X6QC 5HBJA 3DXPA 5L4QA 4EK4A 3TI1A 4RLLA 2J0LA 4S2ZA 4I41A 1W84A 4RWKA 3FY0A 2VTAA 4QTCA 4DFXE 3AGLA 4I22A 4B0GA 5M09A 4I6BA 4OBPA 1OECA 2ZJWA 4X0MA 1H0VA 3PWDA 4PPBA 4P90A 5HU3A 2BVAA 3FC1X 2PMNX 4TYEA 4AOIA 5BX0A 2QHMA 1PXOA 5GZ8A 5M07A 3CKXA 4Y85A 2BROA 5I9UA 4RIYB 2PZPA 2VO7A 2XIKA 2UW6A 3UODA 4C3RA 5GNKA 4F1TA 2Z7SA 3NX8A 2JKQA 4BL1A 4J7BA 4RJ6A 4IB1A 2JBOA 3CPCA 4FV8A 5CAQA 5J79A 2YCSA 3E87A 4YC3A 5FM3A 5C03A 3BRBA 4ZY6A 5EOBA 2X2MA 2ERZE 3KREA 5DMZA 4UMUA 2QOLA 5IEVA 3F5UA 4YTIA 3ORTA 1LUFA 2XKEA 3TNIA 1OL1A 3LAUA 2XA4A 3WI6A 4RFMA 2VTIA 3OMVA 4F7NA 4C33A 4MKCA 5IQBA 4ZTSA 1P2AA 2VNYA 2WTWA 4BICA 2Z60A 1W98A 3M11A 2Y1NA 2F9GA 2VWIA 3DJ6A 3F61A 4RVLA 4E73A 4QMSA 5HE2A 1PXLA 5AUZA 1L8TA 4C58A 4HW7A 2P3GX 4O0WA 4NH1A 4YTFA 3I5ZA 2OLCA 4FV5A 4O27B 3G0EA 4PPAA 3E63A 4U79A 4GIIA 4QTEA 2BAJA 3FZPA 3O7LB 2IZRA 4JAIA 4V05A 4ASZA 1GNGA 4QYHA 3R7YA 3V8TA 3MFTA 4O0TA 3GOPA 3QALE 4QT1A 1MRUA 3DDPA 4ZLOA 3V5LA 4DT8A 5TF9A 3RK5A 1TQPA 4EK5A 3HRFA 4O7WA 1AD5A 3UG1A 2YCFA 3HRCA 4C0TA 3FXWA 2VZ6A 4CFFA 1KE7A 4KD1A 4WG5A 3VROA 2CGUA 4OTRA 5IQCA 3BUNB 1MP8A 4JBPA 3QTWA 5CS6A 3VJNA 3MJ2A 3PWYA 3FHRA 3LFNA 3LXNA 2C6LA 4FIEA 4MWIA 2JFLA 5C26A 4NW6A 4JBVA 4LQMA 1M2RA 2XK7A 4O0VA 4BCPA 2C3LA 3IKAA 5DBXA 4NM3A 3BYUA 3FXXA 4OBQA 4UV0A 4UMRA 4ANQA 1OUYA 4O0RA 3W8LA 3KXZA 4BCIA 5G6VA 1H8FA 1PKDA 2QOKA 5AP3A 4DEBA 2J7TA 5ITAA 1HOWA 3WIKA 3IOPA 4TNBA 3H4JA 3KVXA 2R3MA 4XJ0A 2VTMA 3REPA 5HKZA 4C3PA 2GHMA 2NRUA 5KMNA 3CQEA 4CVAA 3TV4A 4EJ7A 4QPSA 3OXZA 5I4NA 2PVJA 4AT4A 4DH3A 3P5KA 1FINA 2HZIA 2IW8A 3Q52A 3JVRA 2GU8A 1XKKA 4JBOA 3U54A 4YJNA 3RGFA 3II5A 5IUGA 3SX9A 3ETAA 5HD4A 4YHJA 1O6YA 2WKMA 1PXKA 4NFMA 4BI2A 5T68A 4ZZOA 4DFBA 3QXOA 5D1JA 4Y8DA 1PRYA 2OFUA 3BBWA 3CE3A 2BHHA 1GZOA 3D94A 2XM8A 4R78A 4R8QA 1VEBA 3EQPA 4ANBA 3CR0A 4CFNA 5JK3A 3HDNA 3HMIA 3R00A 4JOAA 4R77A 2OJFE 5DR9A 4O7RA 4BIBA 2XKDA 3ITZA 3OXTA 4W4WA 4FIFA 3O51A 4ZSJA 3ZEWA 4L8MA 5BVDA 4PV0A 4JJRA 4LRMA 5ETFA 1M14A 3PJ8A 5IU2A 3HP5A 4O6LA 4BHZA 3PY0A 3V6SA 4J97A 3LM5A 4FZFB 1XR1A 2BIYA 3UZPA 3HYHA 1UU8A 4YSMA 3ZEPA 3PXYA 4K33A 2QU5A 4G1WA 3IS5A 4HZSA 4TTHB 5KO1A 2YM6A 4XBRA 2PYWA 5J3XA 3FI8A 3O7LD 4EOOA 3H9OA 4TY1A 4QP2A 1YWRA 5C4LA 2FSOX 2X6EA 4IVBA 3D83A 1YQJA 4RJ7A 4J8MA 3P7CA 1PYXA 3EFJA 4MXXA 3FMHA 5HD7A 4E1ZA 2ZMDA 4CG8A 1LEWA 5BMSA 5I0BA 2X8IA 2JITA 1QPEA 2QOFA 2CHLA 2YIWA 3VS1A 1PMUA 2W1DA 3V5PA 4QMTA 3TNWA 4ZLYA 4BDFA 3MS9A 3KL8A 3FKOA 1XH8A 2XK6A 3OT3A 2WTVA 3MYGA 3QXPA 4GL9A 5DG5A 3R2YA 4AN2A 5HTIA 5FP6A 3ZRMA 3VF9A 4J99A 3BQRA 2GNGA 3NLBA 2VO0A 4JIKA 3BHUA 2HY81 2DQ7X 4K8AA 3ZC6A 4E4XA 4D4RA 4Q5EA 3OCBA
chains in the Genus database with same CATH superfamily
2ZYBA 2C6MA 1FVRA 2VN9A 1STCE 4X6RA 4FK3A 3LCOA 3OW4A 3QD2B 3KK8A 5LVOA 2Z8CA 1DE4C 2UW0A 4TYHB 1XH7A 2WFYA 3RPSA 2JAMA 4GK3A 3RALA 1U46A 4ZJJA 1UU7A 4HCTA 1IASA 3KK9A 1U4DA 4L3JA 4YO4A 3NRMA 4KIPA 1OGYA 1ZARA 4FV9A 3C9WA 2RGPA 3DFAA 2UZLA 3CKWA 3G6HA 3QRTA 4YLLA 3Q5IA 3R8LA 1OIYA 1ZAOA 4NCTA 5A4TA 4L01A 2XS0A 4UXQA 3QTZA 3IWWA 5C9CA 3PLSA 4FZAB 2JIVA 3GC9A 4E3CA 4NT4A 3CY3A 1XQZA 3VRYA 4GSBA 3VBVA 3BUWB 1E9HA 3ZO3A 4C2VA 1PXIA 4IFGA 2G2FA 5T6KA 3I5NA 2R3GA 4OTHA 3H10A 4S33A 4YO6A 4R3PA 3BWFA 3E8CA 5LMKC 4ACCA 4NJ3A 2GPHA 3BEGA 3DLSA 4P5ZA 4U42A 3N51A 4X2JA 1FGIA 4WG4A 3GC7A 3W0QA 3GUBA 4FIIA 2XNEA 2OK1A 3FWQA 5CEIA 2YM3A 4B8LA 3Q60A 4LGDA 4ZY5A 4V01A 4FODA 4ID7A 4ZJIA 4EHVA 1KV2A 3ALNA 5A9UA 3SGCA 2ZM3A 5K4JA 2JKOA 3DCVA 3OWPA 3CGFA 4IBMA 5EW9A 3TACA 2C6EA 4ENYA 4E93A 4G6LA 3HKOA 4V0GA 2JIIA 2ZB0A 2CMWA 4MF0A 2JAVA 2YDIA 3EQHA 2FSMX 2OJ9A 3NUUA 4IEBA 2R7BA 2BRHA 4XOYA 1BL6A 4KBCA 3KEXA 3R7GA 4NGMA 3BCEA 3WF9A 3KFAA 2CGWA 4YBKA 5EDPA 2WMSA 4DEHA 2WMBA 3R9NA 2A4LA 2WELA 4IQ6A 2WMTA 3QQUA 4TYGA 3BU6A 1U59A 2YJSA 4YPSA 2OZAB 5K5NA 5KHWA 2QR8A 3D5WA 4LUDA 1K2PA 2X7OA 3BQCA 3G90X 2FUMA 5CSXA 2C1BA 3SHEA 4IX4A 1LEZA 4EHZA 4TW9A 2WAJA 3K5UA 5FDXA 3R1YA 2C3JA 2DYLA 1P5EA 4JIAA 4RA4A 2OF2A 4W4YA 3ZXTA 3FKLA 4DLJA 2UZVA 2FVDA 2XCHA 2Y0AA 3GC0A 1YXUA 3R9OA 1JVPP 2HAKA 5I9XA 3H3CA 5CVHA 1ZZ2A 2QOQA 4KIKB 4QO9A 2OJJA 2EXCX 2CGXA 5IDPA 2EXMA 2B0QA 4EC8A 4BJJA 4KSPA 2PVWA 5DT3A 5AP5A 4EOIA 1M52A 5JQ8A 2OZOA 3DZQA 4NGTA 3I6WA 2H34A 4YJUA 3GCSA 5D7AA 3VBXA 4D9TA 1YRPA 3M1SA 4JNWA 2WQOA 3V5QA 4C2WA 3CQWA 4RX5A 5BUJA 4Q9ZA 4RPVA 3WE4A 1BYGA 1KE9A 3VN9A 5J9YA 3A61A 3CD3A 4MBLA 4ZTQA 2QKWB 4I5PA 4UY9A 4F9WA 5EM6A 3W32A 3UOKA 4X2GA 2PZ5A 2OF4A 3O71A 3QTUA 4FR4A 4BCNA 4FTTA 3OOGA 4LMNA 3ACJA 1TVOA 3E7OA 4I6QA 4TWPA 2YISA 4R7BA 4HGLA 3F3VA 3FAAA 4HGSA 4K0YA 5BPYA 3NFGB 1ZOHA 4AN3A 1BMKA 2XJ0A 3F2AA 3HL7A 1UWHA 4WBOA 5BYLA 4QMZA 1URWA 4CV9A 3VS7A 2E9PA 1TKIA 2WTKB 5IA1A 4M68A 2JKMA 3WIGA 4AA0A 1YXSA 1RW8A 4JXFA 1W0XC 5JFXA 4IWDA 4DLIA 3BPRA 2VO6A 3BL9A 3G33A 3QKKA 2LAVA 4AXFA 2F57A 3FYKX 4C8BA 4M8TA 2XM9A 4ALUA 4HGEA 2B9HA 2XMYA 1H25A 4QP9A 3A7GA 5CVGA 2QU6A 1JQHA 2DWBA 4FV2A 5BVFA 3R8UA 4F70A 3TJDA 3UDZA 3UVRA 1JOWB 4FKWA 2C6TA 4NK9A 1G8JA 2ZFYA 3K3IA 2R4BA 4II5A 4UXLA 5DVRA 2X2KA 4U5JA 2WTCA 4BWXA 2BTSA 3G15A 5IQFA 2QOOA 1P4FA 3DFCB 3CSVA 5CU0A 2WTKC 2CJMA 3DBEA 3EQRA 4QD6A 1ZMVA 5IEYA 4FG9A 4IM3A 4MQ2A 5AX3A 2PE0A 3IDPA 4FKGA 1KUTA 4RIXA 4R6VA 5JRSA 2PL0A 4PY1A 3RP9A 4D9UA 2GS7A 3ORKA 1V0OA 4IZ5A 1OL7A 3KRRA 4K2RA 4UMTA 1YDRE 4J52A 5LVNA 4OT6A 3DQWA 3FPQA 3R6XA 3U51A 5IISA 2Z02A 3SXRA 4AAYA 1YKRA 2PE2A 1A48A 3CY2A 5CU4A 1OKWA 2XIZA 3P1AA 5D41A 3HVCA 4CFMA 4BKJA 5HGIA 1XBCA 4DTBA 3WF5A 3MY5A 4IC8A 1MRVA 5CTPA 2C6DA 2R0IA 5IMEA 2PPQA 3H0YA 2XZSA 2YM4A 3A4OX 4E6AA 1YDTE 4ANNA 4DFYA 3GCUA 2CKEA 4HOKA 3PIXA 3IG7A 3SW4A 2ACXA 1T46A 3HMPA 4NJDA 4FTKA 4R1VA 3T9TA 4FTLA 3UP2A 5AR7A 2WU6A 4QEBA 4AACA 2CSNA 1F5QA 2XEGA 2XBAA 1J91A 2VTPA 1JWHA 3OT8A 3D7TA 2CNVA 4BCQA 3TNHA 5AAGA 4U41A 4E4LA 2JDSA 3D4QA 3I7BA 3BX5A 4I5HA 5FDPA 4M69B 4XP2A 3HP2A 5B2KA 4AA5A 2VTOA 2WHBA 5BYZA 5AV4A 2UVXA 2I40A 2W0JA 2ZMCA 4LV7A 3QLGA 5DH3A 3R71A 3RI1A 3ROYA 5FLFA 5HVYA 3BHTA 4UBAA 3R9RA 4TPTA 3ULZA 5KCVA 5ANDA 3WYXA 3HV7A 2RSVA 2ITXA 3JXWA 3O8PA 4IVAA 4NM5A 1B6CB 4FTCA 4WBBB 4EH6A 4EZ5A 1OPJA 4M66A 4OT5A 2VRXA 4WUNA 5CVFA 3D5UA 4FG8A 5CF4A 1FBVA 4CLIA 4AXDA 4D2SA 2W05A 4PQNA 3E64A 4IW0A 2B9JA 1J7LA 3LQ5A 5ANGA 1AGWA 4IX6A 3P0MA 4O4DA 1GJOA 2XNNA 2O8YA 2VX1A 5I5ZA 3I4BA 4P4DA 1G8SA 2XRWA 3I7CA 3I0OA 2VU3A 3AMBA 4WHZA 5AR4A 3RZFA 4OAVB 1E1XA 2WTJA 3EN7A 1YVHA 1FMKA 4BGGA 3AD4A 4L7FA 3AMYA 4JRVA 4G5JA 3T3UA 2UW9A 1NXKA 2GFCA 4DH5A 3PT1A 4GV1A 1BL7A 4CXAA 1ZLTA 4IWPA 4O0YA 4E6CA 1WBTA 3G5DA 4PMMA 3F7WA 3C4FA 3HV6A 1R78A 3QUDA 4KRCA 5HE3A 3KA0A 2XPLA 3OAKA 1OL2A 3IDBA 3IGOA 3KXGA 4EH2A 5AR8A 5K4IA 4D55A 1M7QA 2Q0NA 3ALOA 3C4XA 4H3BA 3VBTA 5CANA 5JFWA 3NUAA 4XUFA 4ZSLA 3FZSA 4R3CA 2UZOA 1M7NA 4DEGA 4W8DA 2P33A 3DK6A 3ENMA 3BYSA 1W2FA 3MH0A 4AGCA 4GMYA 2J90A 3MFUA 2IVUA 2HW7A 5AUUA 3CLYA 3FMLA 4QQCA 4MHAA 3U6JA 2QG5A 4FV6A 5HOAA 5I9YA 3VHEA 4ASEA 5EW8A 1PXJA 4F6WA 5CQUA 5I9VA 2YZLA 1KE6A 3AOXA 3FZTA 4IZYA 4FL3A 4WUAA 2VWZA 2NNWB 4XG6A 3NWWA 4EK6A 3QYZA 5A4LA 4UN0C 2R3OA 4CLJA 4O86A 1QCFA 3EB0A 3BKBA 5IA2A 4ITHA 2BHEA 3LPBA 2WXVA 3U9CA 3IOKA 3BXMA 4O81A 4X2NA 4QQJA 5FEDA 4B99A 4EH4A 3PJ2A 3U4UA 2A98A 3EQBA 1H0WA 3ZOSA 2EUFB 5JEBA 5JFSA 4K18A 4KWPA 2WMXA 3W0SA 3B2TA 1JSUA 5A14A 1WAKA 4IAIA 3CCNA 4HVSA 2C5YA 3UYSA 4FKSA 5CXHA 3FXZA 3W10A 3ZRKA 4TN6A 1YOMA 3CJFA 4FICA 3QTXA 4YLKA 3F5PA 2C0IA 1JKKA 1XO2B 4GEOA 1JSTA 3U9NA 3V8WA 4KIQA 1OBGA 1L3RE 2VD5A 3L9PA 2ZV2A 4G31A 4MCRA 4FE2A 2JFMA 2Y4PA 1PMNA 3JY9A 4QNAA 3RPRA 3ZSIA 5KKRB 2CKOA 3NSZA 2Y1MA 2JEDA 3PSBA 4ITJA 2GNIA 3RJCA 3BHYA 5CF8A 2GTNA 3KCKA 4LOQA 2YIYA 4DG3E 4LM5A 4EBVA 2OIDA 5C1QB 1Q97A 2YWVA 1ND4A 5AFVA 4NGPA 5IQEA 5AP4A 3DNEA 2VTHA 3EZRA 4M15A 4XG9A 5CSWA 3BI1A 3LFFA 4DYMA 5AXIA 3MA6A 3QRUA 5B2LA 1Q41A 4E26A 2BILB 4YC8A 4AZFA 3FLSA 4XG7A 5HO8A 5JFVA 4HYSA 3RHXA 2VX3A 3BWJA 3HX4A 4O0UA 4QMQA 3BUMB 3TNQB 3MVHA 2V0DA 2C0TA 4RGJA 2B55A 4P4IA 4AW0A 2OO8X 3BBTB 3T9IA 4O7VA 4FTJA 4W9WA 1W7HA 3JY0A 4FT5A 2BDWA 5CYIA 2UW3A 5EH0A 2PE1A 4MAOA 5KKRC 4CFVA 3OBGA 3CTQA 4Z7HA 3ZO2A 3EQFA 2UZTA 1R0PA 3QLFA 4X7QA 2DLAA 1VJYA 3GENA 2O3PA 3LW0A 2IVVA 4FIHA 4DFNA 4AT3A 1OBDA 2W4KA 4YSJA 1REKA 3R21A 1GOLA 4O6EA 2PY3A 5DIAA 5IEXA 4D1XA 3T8OA 2X1NA 3Q32A 1XWSA 3DBDA 4G3CA 2XNPA 4G3EA 3O8UA 3H9FA 3O0GA 4MXYA 3EYGA 2F7ZE 5CAVA 1PY5A 5GIPE 4ZOGA 3PY3A 3PJ1A 2YIXA 3FI4A 4HNFA 2IZSA 5ANIA 5KBRA 2XYUA 1V0PA 3TN8A 3QU0A 1BKXA 4BY9E 5LWMA 2CNUA 2G9XA 5L2IA 4U0IA 2WOTA 2BCJA 3NYNA 2BUJA 4F63A 3FL4A 2AC5A 4CFWA 2YAKA 3NUNA 4OC2A 3EMGA 3KIOC 4RQKA 2YDKA 3QZGA 5DWRA 5HVKA 3PXQA 5BVOA 4P4BA 2OXYA 2C1AA 3DOGA 2ITUA 3V3VA 4LYNA 4OAUC 4FVPA 1KOBA 2RL5A 4IE9A 3RMFA 2PZRA 5HX8A 3EH9A 5HKYA 2IW9A 5AP2A 4FOCA 1BI7A 1M17A 3FC2A 4RLKA 4C4HA 3FPMA 3JPVA 3E92A 4EUUA 4LOOA 4RWIA 3ZC5A 4G2FA 2R5TA 3VBQA 4JQEA 4OMEA 3VUIA 2VWUA 2E9NA 3AT4A 3ZM4A 4MNEB 5EI6A 3CD8A 4QMWA 4YJOA 1OB3A 3HMMA 3FMJA 5LARA 4YTHA 4BCFA 3NNWA 5FG8A 3JVSA 1PXPA 4O22A 3KB7A 2VWVA 2C6KA 3VGOA 4J8NA 4FZ6A 4CD0A 5L6OA 1WVYA 3BU3A 2BZIB 3FDNA 4YBJA 4AOTA 4CRLA 4O7NA 4BF2A 3IGGA 5DA3A 3W2CA 3LCSA 1XMMA 4XHKB 2IVSA 4C4FA 2Y4IB 4DG2E 4GFOA 4ZTRA 4PUZA 1LPUA 1S9IA 3R22A 4QP3A 5IQAA 3WOWA 3QHRA 3QCQA 5AUTA 2PUUA 2Z2WA 4F64A 3DV3A 2YABA 3LCTA 4C4JA 3DJ5A 5F20A 4AS0A 4QMUA 4BYJA 5HIDA 2YJRA 4FKQA 5DOSA 4USFA 4CTCA 3RWQA 1U54A 4ONAA 4DFZE 4EQMA 4GS6A 3UNJA 4AW1A 4B8MA 2NP8A 1XHAA 4IANA 5FEQA 4FKVA 3TTJA 4WSQA 3MPMA 5LMKA 3TMOA 5KZIA 4BKYA 4OBOA 3ELJA 4BKZA 4M13A 5BNJA 3OWKA 4BI1A 5CF5A 3QC9A 4ZMEA 4Q2AA 3DPKA 3HA8A 3TG1A 1UU9A 2ITYA 4DAWA 2Y4IC 4JL9A 3G9NA 4I92A 2JDTA 4H36A 3C0GA 2X39A 4ZTLA 2Q83A 4YGAA 3JS2A 4DC2A 4I0SA 2J5FA 3OWJA 2IN6A 5EM7A 4HJOA 4Q9SA 3TT0A 3UIXA 2V62A 4O4BB 4PNIA 5E8XA 3FQHA 4ZZNA 3BYOA 5KBQA 5HO7A 5ANKA 1Q5KA 2ZV7A 3PXKA 3GNIB 4AF3A 3TCPA 1CM8A 3L8PA 4CKJA 4AZSA 1OL5A 1H27A 5A54A 3AC3A 5AUYA 4IB3A 4KB8A 4RT7A 3ATTA 2ETRA 3NCZA 3UC3A 5CEKA 5EM5A 5KMIA 4TRLA 1UNHA 3L8VA 3L9LA 4BDHA 3O5AA 4UYAA 5ANJA 3UVQA 1BX6A 2B52A 4YJTA 2R3LA 4FL1A 3TKIA 3TUCA 3ANQA 3SXFA 4A9RA 4BDEA 3VS2A 3F5XA 4FEVA 2C0OA 3C4WA 5BQ0A 4NZWB 4F6SA 1SMHA 2UZEA 4G9CA 4BWKA 1H24A 5L2TA 1OL6A 3L8SA 4ZSAA 2UZUE 4RG0A 4KKGA 3UNKA 4CMTA 3LOKA 2XIXA 3MN3A 4G6OA 3SJXA 1O9UA 2O65A 3PTGA 5HNBA 4F08A 4JMQA 4D2PA 4DHIB 5AAFA 4IM2A 3PDTA 4N70A 3QCSA 4FRFA 1LR4A 4PMPA 2XEIA 2QONA 2YIRA 4TL0A 1PW2A 2XYNA 5M55A 2YACA 4A4LA 4JZ0A 3FLNC 3WZDA 3QTSA 4A06A 3VVHA 4QYYA 3F66A 4FTNA 5DGZA 2C4GA 3FMMA 3C50A 3RINA 3V51A 4IIRA 4KSQA 4MXOA 2RF9A 4DA5A 4O83A 2F7EE 4BPXB 2PVRA 4LRKA 4XYFA 5HO6A 3SOCA 3PG3A 1PMVA 3LKMA 2BAKA 3FYJX 1YVJA 3KCFA 4O38A 3AMAA 4EUTA 4IVCA 4J98A 4RQVA 1G5SA 4O21A 2IPXA 2VO3A 1ZWSA 1MRYA 4W9YA 3D7ZA 4DTKA 4USDA 4D2TA 4ARKA 5J7HA 5HE0A 2N3AB 1XH6A 4FT7A 2HCKA 3NIZA 1JLUE 2B9IA 3DKGA 3PVUA 3QRKA 4P4FA 1J3HA 3CJGA 3VS4A 3C13A 5HBEA 3FEEA 5AUWA 3LM0A 2JKKA 2V22A 4FBXA 3EOCA 3UNZA 4HVDA 4E8AA 4AGWA 2GQRA 4BCKA 3NAYA 1FBNA 4X3JA 1RDQE 1OPKA 4QP8A 1XBBA 5A6NA 3HMNA 3Q9YA 5CZHA 4P4CA 2R0UA 5CZIA 3S95A 3KXNA 1ZRZA 1H28A 2XAMA 5CAOA 1VR2A 4H05A 3ZFYA 4G3DA 4KS8A 3C5IA 3HGKA 1H4LA 1CKPA 1X8BA 2GS6A 3FL5A 1NVQA 4XNEA 4AUAA 5EYCA 3MY0A 4YTCA 1H07A 2XNGA 3LFSA 4GUBA 4DF3A 3PXRA 4FIJA 3ZHPC 1HCLA 1XJDA 3SRVB 3C51A 3VUTA 2BALA 2UVZA 3Q4ZA 2WD1A 2W1ZA 4GK2A 4LGHA 3OD6X 3RNYA 4CCBA 4NW5A 5H2UA 4GJ2A 2WMRA 1DAWA 3NW5A 3W8QA 4RA5A 5I3OA 4MBJA 4JYWA 3GQLA 4GU9A 5AM7A 3WF8A 5IDNA 5FTGA 5FXQA 3UZTA 3L9MA 1Z9XA 4L00A 1SZMA 2HXQA 5H9BA 5IQIA 3LJ1A 2XRUA 4RWJA 4XMOA 3MTFA 3V8SA 2NRYA 3TWJA 1Q8WA 1Y8YA 4KBAA 5IH4A 1F3MC 4M97A 4XLVA 4BDGA 2WZJA 4L7SA 5ELYA 2J6MA 1BI8A 2XNOA 4R7HA 1MQBA 4KNBA 4XG3A 5EYMA 4M0ZA 4FTMA 3V6RA 4D0XA 5HIBA 2HYYA 1WBSA 4Y5HA 2BDFA 3G2FA 2ITTA 1Q3DA 3FBVA 4FUYA 4M67A 3W55A 4BDBA 4ANMA 5KZ0A 2QVSE 1ZXEA 4WRGA 4AU8A 3ZUTA 1Y6BA 4XV3A 4MXZA 4BGHA 3ORMA 4U40A 4MCPA 3D7FA 3U8WA 5M08A 5JRQA 5H8EA 4U6RA 3MY1A 2JDVA 3R30A 1ERKA 4DBNA 4WOVA 5AM6A 5JGBA 3RM6A 3WZEA 3NNUA 2EVAA 3A8XA 1ST0A 4ZXTA 5TOZA 3VNTA 3K3JA 3ORIA 4AQKA 2PUPA 3MB6A 4PDOA 5L2QA 4EK3A 4QDVA 2BRMA 2XKCA 4EORA 2F7XE 3GU8A 3VUKA 1CKIA 3OB1B 1GZKA 5GIOE 1KSWA 4MEDA 2HXLA 5EI8A 3NFFB 1URCA 4FTIA 1P14A 3NPCA 4XRJA 4CTBA 5AR2A 3ZZWA 4JQ8A 4JX7A 3DB8A 4M0YA 4FKJA 4OTFA 5G1XA 2PVFA 4XBUA 4YR8A 3T3VA 2OIBA 2WQBA 4RIOA 3RPVA 3TTIA 4JDIA 4EI4A 2ZV9A 3KULA 2HW6A 4GYGA 4U97A 3QGYA 1FVTA 5HVJA 2ITWA 3QA0A 4QMLA 5C01A 5I3RA 2HWPA 4J95A 5J5TA 3L9NA 3CPBA 3D7HA 1V1KA 3F3TA 2YITA 5FBNC 4QTAA 3EN5A 3P86A 1ZYLA 4PMTA 3AKLA 2G1TA 4X2KA 3MV5A 2X4FA 3MPAA 2R3JA 4TT7A 5M06A 1WMKA 3F3UA 4FTUA 4D4SA 4EYMA 4BWPA 3UPZA 4CGAA 2OU7A 2ONLA 4TWCA 4Y46A 4F7JA 4YZCA 3R0TA 3D9VA 5AV1A 4IB5A 4X3FA 4QYEA 2LGCA 3C7QA 3I79A 4EK8A 4L52A 1KE8A 3KGAA 3TKHA 5K0XA 4JR3A 2FO0A 2XKFA 3VBWA 2CCIA 2OXDA 3AC2A 3ZMMA 5IH6A 1BLXA 1HCKA 3ZSGA 3P23A 4FT0A 4C62A 3BHVA 3MGYA 3PA4A 1WZYA 5BVKA 4B4LA 1MUOA 3LE6A 5HKMA 5DYJA 1YHSA 5GHVA 3LHJA 3LXKA 5AWMA 1SVEA 4E20A 2W4JA 5LCJA 3FMKA 2YLFA 3GOKA 4RC2A 2RG6A 3WF7A 3DKFA 1CDKA 2QOIA 4LGGA 3LLAA 2JLDA 1JNKA 5TKDA 3MI9A 3OCSA 4O2ZA 4WNMA 1M2QA 1OIRA 3Q9WA 4YZNA 4RJ5A 2VGOA 3MIAA 4YLJA 4CKIA 5LQFA 4O4EA 1Z9EA 4FSWA 3W18A 3SA0A 1NW1A 3TYKA 5AMNA 1ZYDA 2QLUA 3G9LX 3PZHA 3SJFA 3FHIA 4YU2A 5L8LA 4FEQA 2HENA 4ZS0A 3NEWA 5J9LA 4NGRA 1H26A 3DBCA 4L43A 5CI6A 4N57A 4QYFA 3VQHA 3OOMA 5CNNA 3FLZA 2C47A 4OC1A 3EHAA 4QMXA 4RJ4A 5HEZA 1FMOE 3QCXA 4AW2A 2GHGA 2RFDA 2Y6OA 3DDQA 4EOMA 4E4MA 3C4ZA 4H58A 3HLLA 3OZ6A 3K54A 4MK0A 1S9JA 2PMOX 3NR9A 1A9UA 3W0MA 5H3QA 2KTYA 2YIQA 3UQCA 3F2RA 2H9VA 3QHWA 4NM7A 2AYPA 4QP6A 5C27A 3VONA 4GVAA 2R3QA 2HZNA 4FKPA 2XANA 3UE4A 3GT8A 3IQ7A 4K1BA 4RWLA 1OI9A 3PPJA 5CT7A 4O7YA 4FNYA 3NUSA 3FI2A 3ZH8A 4EOKA 2WTDA 2W1HA 4I23A 4AA4A 5BVEA 4BCOA 2UV8G 2X6DA 1FPUA 3QFVA 4IM0A 4UZHA 4XX9A 3UOLA 4EONA 2W1EA 2OSCA 4QYGA 2UUEA 2W9ZB 3CBLA 4J71A 5I9ZA 3LJ2A 4GYIA 3GBZA 3E8DA 4A07A 4ASDA 3RAWA 4KIOA 3H0ZA 3SLSA 4U81A 4FV7A 2W1FA 2R64A 3OVVA 3W16A 3RAHA 4A9SA 4MTAA 4O7ZA 3Q9ZA 5CT0A 4B6LA 4BCHA 4PL4A 2PZYA 2CIJA 2E9OA 5E1EA 4QP4A 2F4JA 3D5VA 3QQFA 1PXMA 3U6HA 3QKLA 5CU2A 1WBVA 3QTRA 4DT9A 3B8RA 3PXZA 3QL8A 1CKJA 4IH8A 5E90A 3C5UA 4WNKA 5FM2A 5M57A 2B4JC 4QTBA 4EL9A 3HV4A 3COHA 1GZ8A 2QURA 3SV0A 2XNMA 3FY2A 3AD6A 4ZP5A 1H1PA 4CKRA 3JUHA 2OJGA 3TEIA 4FG7A 2IEWA 3P78A 1KV1A 1WBPA 2XK3A 4IC7A 5I9WA 4IZAA 3TIYA 4K77A 4QQTA 5CI7A 5KUPA 3IECA 4HNIA 2BRNA 4MD9E 1YOLA 4PTCA 3AG9A 4IMYA 2JDRA 4NGNA 4YNEA 5K3YA 1W82A 3BHXA 2J0KA 3PUPA 4G9RA 5HG8A 1Y6AA 2F2UA 5H8GA 5HG9A 3ULIA 3ZM9A 5IUIA 4FVQA 3NYOA 4D2WA 1Q8UA 4JS8A 2J0JA 3ZCLA 2BTRA 2H6DA 3OC1A 4FV3A 3PLAE 1YWNA 2VGPA 2QOCA 3KU2A 4E4NA 1IAHA 5A46A 4BFMA 5E1SA 3PIYA 2E9VA 1J7IA 3FKNA 1Q8ZA 4KAOA 4OTQA 3PFYA 5M56A 2R2PA 3BGQA 2GDOA 3MFSA 1DM2A 3UYTA 5AA8A 4CYIA 2P2HA 4ZTNA 5F94A 2PUNA 3A7IA 3HMOA 5IZFA 3BLRA 1YHVA 3QQLA 4XLIA 5DEYA 4ZIMA 5ACKA 1IAJA 3I6UA 2XPNA 4IVDA 1UKHA 5T3QA 3RK9A 2AEGA 3KF4A 4DCAA 1GZNA 2QO7A 4GT5A 2J2IB 1YHWA 1I09A 3UMXA 4FNXA 4NTTA 4BRXA 5HORA 3SVVA 3QC4A 4BHNA 4CQEA 1YDSE 4RZWA 3GU5A 3W2OA 4NL0A 3F69A 4YURA 5AEPA 3QTQA 5EQEA 1W8CA 4AFEA 2QHNA 2BZHB 3R1QA 3IDCA 2GNHA 3B8QA 1DI8A 2ZM4A 5GZ9A 2XVDA 3U4WA 3UDBA 3F2NA 5AIRA 4BI0A 1SNUA 3OXIA 3FF3A 2WPAA 4BDIA 4KINA 5JZJA 4E5AX 4FKRA 3QUPA 1OZ1A 3U6IA 2I1MA 4JI9A 3KQ7A 2GTMA 1Q62A 3OCGA 3CS9A 3W2RA 2P0CA 3SG9A 3IO7A 3R28A 2J9MA 4AFJA 3A7JA 3GXLA 2G2IA 2IZTA 3CTHA 3EZVA 4USEA 4FTQA 5CSHA 3TNPC 4DE4A 2QO2A 5CALA 4NCTC 1K9AA 1ZY5A 3ZLXA 4BIEA 4XV1A 5IKWA 3ZLWA 4AZWA 4LFIA 4ZJVA 4IADA 5DPVA 4FSZA 4FSMA 3R01A 4O4FA 3P08A 5IA5A 3W0PA 5HNGA 3VRPA 4RX8A 4NM0A 3R83A 3ZBFA 2EB2A 3Q2JA 3FMDA 4DGNA 4IB0A 4CCUA 4ENXA 3EN6A 5E4HA 4DG0E 1JSVA 3MWUA 5FXSA 1SVHA 4P4EA 2ZM1A 4FTOA 4IJ9A 1OIQA 4DTAA 1ZYSA 3ZBXA 2FSLX 3VRQA 3RVGA 3ODZX 5EQYA 2HZ4A 3ZZEA 1IEPA 4OTPA 4GFGA 4LDTA 3OG7A 4FZDB 4OC3A 2C68A 4K11A 4IX3A 4UX9A 5ANEA 4AXAA 3RBUA 2UZWE 4D4VA 4D4YA 4HVHA 5LOHA 1YI6A 1Z5MA 5TR6A 2FB8A 4DEIA 2IVTA 4WKQA 4ZSGA 2W06A 1DS5A 3GCQA 3GI3A 5HTCA 5A4EA 4V04A 1KOAA 4FSRA 4L3LA 5L3AA 1PJKA 3ET7A 4F1MA 2Y7JA 5AR3A 5HG7A 3OW3A 4DHJA 4QOXA 4F9AA 4HGTA 3UMWA 2IW6A 3TZ9A 3EN4A 4BJJB 4OC5A 4OLIA 4DCEA 3UZRA 3A8WA 5A3XA 4RIYA 3MTLA 3IW8A 3F9KC 1OGUA 3I0QA 2C69A 4IDVA 3OEFX 4S34A 3VJOA 4F9BA 4F78A 2BKKA