4BTFA

Structure of mlkl
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
454
structure length
413
Chain Sequence
DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFILFHEVNEKLRDVWEELLLLLQVPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTASSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Pseudokinase Mlkl Mediates Necroptosis Via a Molecular Switch Mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
total genus 145
structure length 413
sequence length 454
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btfA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 4btfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btfA03
4RFYA 5EM7A 2XA4A 3QD0A 5HORA 1M2RA 4FV0A 4GKHA 4R3CA 3ZUVA 4AS0A 3A62A 4Q5HA 5AUZA 4NW5A 4MVFA 5CASA 5IQCA 2VTMA 3AC3A 3RPOA 2F9GA 4WUNA 2JKQA 4MNEA 1WCCA 2JDOA 3UVPA 4EUUA 4WNMA 4DFXE 3KF7A 4O38A 1PXMA 3F5GA 2CLXA 4G2FA 4OUCA 3VS3A 3UO6A 3QALE 3GB2A 2HK5A 4O6LA 4RX8A 3LJ2A 3VS5A 3F69A 4QMNA 5AAEA 3FMJA 3PXKA 2F7ZE 3QWKA 2C6LA 3DK3A 3LFFA 2VN9A 3NW6A 4IE9A 4M3QA 4AZWA 5AAGA 4A4CA 4I94A 4BCMA 2BCJA 2NNWB 3ZUTA 2W05A 4CXAA 4NH1A 3Q4ZA 4FTRA 4F9CA 4USEA 2ZAZA 1UWHA 2EU9A 2G15A 1K2PA 4F6SA 1Q62A 2XM8A 3FI3A 4XG7A 3SD0A 5HO7A 3QD4A 4I92A 4H36A 3LQ8A 3NW7A 3PUPA 4MBJA 4FODA 3TXOA 4WBOA 4QMSA 4A9RA 5AX9A 4QYFA 2VTSA 1YOLA 4PUZA 4DINA 2C1BA 4U43A 4RX9A 4WHZA 3MVHA 2P2IA 5HX8A 3CXWA 5A3XA 4I4EA 2X2LA 5C01A 3RCJA 3R0TA 1B6CB 5I9WA 2HW7A 2VV9A 3DOGA 3NUUA 4Q9SA 4N4SA 3HV7A 1UU3A 3E92A 3QHWA 2WTJA 4AGCA 3FE3A 2J0LA 3GOPA 2YISA 2PWLA 3Q32A 4C4HA 5M55A 3FMLA 3C0GA 2WMSA 3I81A 1OI9A 3RKBA 2C0OA 3QA8A 3OHTA 3EFJA 3NS9A 3WZJA 4EC9A 3AT4A 4FTUA 3CQWA 5GIPE 2OXDA 1G5SA 4L67A 4Q9ZA 1H8FA 1K3AA 1OPLA 4GUBA 4L6QA 3CJFA 2HCKA 3CPBA 4OT5A 3VQUA 3ZXTA 2GS7A 3PXZA 4M97A 2I7QA 4W4YA 5E8WA 4TKSA 5AP2A 4E3CA 4K8AA 3C51A 2IW6A 3CJGA 4NTSA 3NCZA 5IKWA 5H8BA 3P08A 4YO4A 1LPUA 1T46A 4ZS0A 2I40A 3P0MA 2VWZA 5FP5A 4FE2A 3W10A 2YITA 2G1TA 5BVEA 4MD7E 4FTQA 3HKOA 4FZ7A 4IXPA 2RFNA 4F7NA 4TWPA 5K4IA 4BI1A 5M4FA 3E62A 3FQSA 1M7QA 4ZLYA 3DK6A 4QMWA 5CEMA 4FEVA 3OP5A 3RTPA 4HGTA 5FD2A 3S00A 3FMMA 5JGBA 4K18A 4O2ZA 4EH4A 1SZMA 3EQCA 4I6HA 4LFIA 2O2UA 5L6WL 3KCKA 4OTIA 4V0GA 4DTBA 4CLIA 5E92A 4KUJA 2B4SB 4AW2A 3E7OA 3I7BA 4C3FA 4U45A 4H1MA 2XCKA 3D9VA 4I0RA 3N9XA 3RGFA 3S1HA 3RM6A 3G5DA 3R9RA 3FAAA 4ZEGA 4X2JA 4DBNA 5CXHA 2RIOA 4FTKA 1XBBA 2HXLA 2OG8A 3O8PA 3SW7A 4BDFA 3CGOA 4FL1A 4MNFA 4ONAA 3MB7A 5EM8A 3UZPA 2WHBA 1BMKA 2Y4IC 2ZM3A 3OY1A 4QYHA 4XRLA 4ACHA 4FV6A 3EZRA 3UIMA 4BDKA 4E4XA 3OOGA 1KV2A 3BRBA 4UXQA 4CKJA 1GIIA 3QXPA 4BWXA 5DR2A 2J5EA 3O23A 4ZTRA 3PE2A 3OVVA 2UW5A 4JBOA 4YHTA 1TQIA 4IWOA 3Q5ZA 3G15A 4UALA 3R02A 3GBZA 4I22A 5LWNA 4WG3A 5EQYA 4JDIA 3S0OA 3FY2A 2XKFA 3VBVA 1ZZLA 2VU3A 4NJ3A 4CG9A 3KL8A 3THBA 5CY3A 3NNXA 1DAWA 2WMBA 2WTVA 3QTZA 4Z7HA 4GEOA 2BHEA 4C02A 1CKIA 4ANMA 2JFMA 2YIQA 5DEYA 3UJGA 4M84A 3LFSA 2EXEA 4KRCA 4F9WA 2C5VA 3GP0A 4G16A 4EQMA 2PK9A 2GNFA 2IJMA 4FIEA 5A4TA 1QPEA 1XH5A 3HEGA 4D1XA 3WBLA 4E6DA 2YLEA 5L2TA 3UMWA 4GG5A 4LOQA 3UVRA 1VEBA 3DLSA 2FVDA 3KFAA 4E8AA 3F3ZA 3N4UA 2XNMA 4I0TA 3SOCA 5ETIA 3UYTA 4MXAA 4O0WA 1P2AA 3BPRA 3BX5A 3D4QA 1SVEA 2WTKB 3A4OX 3L9MA 4TN6A 5D11A 4EORA 4O86A 2NO3A 2R0IA 2R7BA 5HVKA 4FTLA 1FBNA 5AP1A 1JQHA 1Y8YA 3ZRKA 3BLRA 2A0CX 4FIJA 3RHKA 5JZJA 3PP1A 3U6HA 4TNBA 1YRPA 4CYJA 3LLTA 3CTHA 1ZMVA 3CTJA 4BC6A 5C4KA 5J5TA 1H27A 3DTWA 5EM5A 4BR3A 3DA6A 3SC1A 2JDRA 4TYJA 2BALA 2BDJA 2XZSA 3AC4A 4I1ZA 2X4FA 5AUUA 3TEIA 5AV4A 4AOJA 2R2PA 3GCVA 2PZ5A 2CKOA 4KS7A 3DXNA 3FLQA 3KN5A 3RAKA 4F6UA 2QKWB 3GU5A 3TNQB 2NP8A 2J0MB 5E8ZA 4ZSJA 4C8BA 1GOLA 2DWBA 5HEZA 3PXRA 5CSHA 4ZTLA 1ZRZA 4EH3A 1ZMUA 2WU6A 2OXYA 3I4BA 2Q0BA 3O50A 4IX5A 5HU3A 3HL7A 4DFLA 1CKPA 2UVXA 5I3OA 3UPXA 5BVFA 3VS1A 4J97A 3TACA 2W1DA 3KEXA 4FV4A 5EKNA 5JKGA 3H9FA 3LFNA 4HJOA 4JAJA 5KZ0A 2Y1MA 5H9BA 5ACBC 5J7HA 4RZWA 3OB2B 4U81A 2V5QA 2UW3A 3QXOA 3TIZA 4XG4A 3OW3A 4B9DA 5EH0A 2BDFA 4FGRA 4LUEA 3LFAA 3ZLXA 3FJQE 3F3TA 1Z57A 5JFXA 4QP8A 2QLQA 3OMVA 2WQOA 4JR3A 5EKOA 3E63A 4XEYA 1WBPA 2HZNA 4FV2A 4PY1A 4HGSA 4PDSA 2R3IA 5EOBA 3ROYA 3S3IA 5J1VA 4FK3A 1WVXA 1ZOGA 4IDTA 4AFEA 3QAME 4ALWA 4DEIA 4DG0E 5HX6A 5CEQA 2PUNA 2YCFA 3NRMA 3C4FA 1J3HA 2W9FB 4PX6A 4AZFA 5JQ8A 4HVSA 4RG0A 4LV8A 3ZHPC 4YP8A 4S2ZA 3BYSA 2BRGA 2XYUA 4HYUA 3OCSA 4E73A 4UYAA 4ASZA 4O96A 3BWFA 4MNEB 3NNWA 3SVVA 2Y0AA 2HYYA 3FUPA 2W1CA 3NDMA 4YZ9A 2ZMCA 3MV5A 4BCKA 4FK6A 4AX8A 2BRMA 2ITZA 3V6RA 3BUMB 5BVDA 3E8EA 4BIEA 4FTCA 3D7TB 5LJJA 4EOIA 4KKHA 3DFAA 3BUOB 4C58A 2W5HA 4FKIA 2OICA 3MSSA 5K9IA 4QP2A 4ZTNA 1W8CA 4AN2A 3EKNA 2R3MA 3KRWA 3UBDA 1PXKA 3C5UA 3QQHA 2JEDA 4FGBA 5IMXA 5ETAA 4CTBA 5IEXA 5CSWA 4YJSA 3VW8A 1L3RE 4RJ7A 4AE6A 2J7TA 3NR9A 3PE1A 4ID7A 4BL1A 3ZMMA 3ROCA 2CLQA 1JSTA 4UZHA 4FC0A 3QLGA 1PRYA 1YOJA 4YJRA 2BAKA 3FDNA 4NZWB 5A4CA 5ANGA 2OJ9A 1MRUA 4EONA 4J53A 3K5VA 3VC4A 4GV1A 3B8QA 3P1AA 4ZK5A 3RWQA 5C8NA 5KHWA 4ZY6A 3AD5A 4KABA 1E9HA 4IEBA 4CYIA 3QYZA 5CZIA 4EQCA 3AC1A 4M69B 4UMUA 4ZMFA 4K1BA 3CPCA 3IW4A 4W9XA 4G34A 1KV1A 2GS6A 2WXVA 3B2TA 5ANEA 3DBDA 4OT6A 4RFMA 5AR2A 5L3AA 4NCTC 2OJFE 1JOWB 2GPHA 4ZZNA 3DCVA 4RWLA 3VRPA 2BZKB 1AGWA 4OTFA 4X2NA 1BUHA 2W7XA 3MY5A 2J0JA 2YZLA 5M56A 2R3HA 3I0OA 4BCHA 3ANQA 5HCYA 3DXPA 3AC5A 2WIPA 3BQCA 1PW2A 2OH0E 4CCUA 2FGIA 3WE8A 1SVGA 4RIWB 2A2AA 5M08A 4WO5A 4KSPA 5AUYA 1HCLA 3VUMA 1BL6A 2VX1A 2DQ7X 3Q4UA 2FUMA 4NKSA 5D9HA 5CXZA 4G5PA 4DGNA 3HV5A 3PWYA 1QPCA 4EH2A 1F0QA 4WRSA 5DT0A 3KU2A 1VZOA 3DBCA 1PY5A 3ULZA 1W0XC 5KHXA 2XNGA 4JQ7A 3JYAA 4IANA 5H8EA 4FTTA 2H8HA 4HPUE 4WRGA 4NM3A 2QU6A 5M09A 4GFMA 4YZMA 4S32A 5DOSA 1SVHA 4Y5HA 4W9WA 2C68A 3DBFA 4TYGA 3E3PA 3FZRA 1Q5KA 1M14A 4JG7A 4UWYA 5HNGA 4JQ8A 3VUHA 2GFSA 3O7LB 3KF4A 2C3IB 3MPAA 3PA3A 3N51A 2YFXA 2YM5A 3R9DA 4NCTA 4Y85A 3ZUUA 3RCDA 2E9NA 3K2LA 2BHHA 3R21A 3QQJA 5AV2A 3PXYA 5DPVA 4B4LA 5JK3A 1YDTE 2X6DA 3BELA 4PMTA 1UNLA 4QPAA 3NNVA 3OROA 5AIKA 2WAJA 2X1NA 4FTOA 5CNOA 3AT2A 4GK3A 3R28A 4GFGA 3TNPC 4AZTA 5AUTA 2QR8A 5EYCA 3EQIA 1PMVA 2R3JA 3BYOA 3HRCA 1X8BA 2RL5A 5C9CA 3PVBA 2XNBA 3LE6A 3VNTA 5I9ZA 3ITZA 3VRQA 4DFUA 5DIAA 4BIDA 2FA2A 4KSQA 2CN8A 1UKHA 3AD6A 3S95A 3MTFA 4ACDA 4N6ZA 4XV3A 2I1MA 5IA3A 2C6DA 1YHSA 4G17A 3UP7A 5C1QB 4MYGA 4FKOA 2VO3A 3HP5A 4L01A 4QMLA 4S30A 4FZFB 3TNHA 3NX8A 4W8EA 3W2OA 1E1XA 2PHKA 5IUGA 2PZRA 4YO6A 3TN8A 4JAIA 4ITJA 4ARKA 4BBEA 4D28A 1OIYA 4MBIA 2Y8OA 4PWNA 5CU2A 3UO4A 3HV6A 4EWHA 5IQDA 5IF1A 4RLLA 1BKXA 4YNEA 4MXXA 5HICA 1MP8A 4CEGA 4E6QA 5F4NA 1NVQA 2ERZE 3BHVA 2ZVAA 3MIYA 3QRTA 4M67A 4K33A 4O7TA 4D4RA 3ZDUA 3KA0A 4M14A 3LAUA 4LM5A 3D2IA 3LHJA 4HYIA 2VWVA 1H07A 4PP9A 5M4CA 2YABA 2YAAA 3ENHA 4AZVA 4C3RA 3Q9ZA 3D5VA 1RJBA 3IDPA 4IZ7A 3ZSGA 4A9TA 4OTRA 2X8DA 1B38A 4G31A 4MKCA 3HA8A 2PZYA 4I5HA 5EHYA 3NYVA 5A6OA 3AT3A 2F7XE 3II5A 4FVQA 3ZO4A 3GGFA 3WF5A 3QRUA 2P33A 4ALUA 2HAKA 4BDIA 4J99A 4F0GA 5L2IA 3VW6A 2EXMA 2UW7A 1YWNA 3BV2A 3CKWA 4EKLA 2ITWA 3MESA 5D7AA 3VUKA 3D0EA 4ANNA 5HG9A 5AR3A 4L00A 5IDPA 4UWCA 4UBAA 4CMTA 2XF0A 3GCUA 3ACJA 5D41A 5JZNA 1XH4A 3FHRA 5LMKC 1OL6A 4GRBA 3EL8A 3MI9A 5CLPA 5HLPA 4F09A 4U80A 3COKA 4ALVA 1JBPE 5HD7A 2VAGA 3G9NA 5I9VA 4WUAA 5CAUA 4D0WA 3KRJA 1TKIA 3NLBA 3DZOA 2C6TA 3EIDA 2XBJA 4FT0A 3WF8A 2JLDA 4V01A 5CT0A 4FI1A 5LVPA 1L8TA 2X7OA 2QOLA 2VTIA 2OZAB 4DTKA 3GC9A 1K9AA 1PXLA 3GT8A 5EK7A 2ITUA 3QC9A 3ZCLA 2QHNA 4UV0A 3QFVA 4TL0A 4EH5A 1QMZA 4D2VA 4J71A 4X3FA 3QUEA 3R8LA 5IPJA 4ACMA 5EDPA 3DNDA 2JIUA 3MH1A 1SMHA 2WIHA 3PY3A 5HIBA 4DGOA 2FSLX 1UVRA 4UZDA 2B9IA 4YLLA 3PIZA 4FNZA 2YJRA 3UP2A 4CRSA 3SW4A 4TYHB 4R5YA 1Q24A 2QR7A 4YJTA 5I3RA 3KXXA 2ITTA 3NCGA 2XK3A 2B9HA 3BU5A 4G6OA 4QMOA 3R8ZA 3ZH8A 4E5WA 3PA4A 5DT4A 3OWPA 3FWQA 4IC7A 4D9TA 5CALA 4DTAA 4FL3A 1Q61A 2UW4A 2XK8A 3ZRMA 1G8SA 4E26A 4ENXA 2PL0A 4G3FA 4BF2A 3NUSA 4XBRA 5H2UA 4I0SA 5JH6A 1OVEA 2Q83A 2B7AA 3KMMA 1GZOA 2ESMA 4FSYA 4HYHA 4Y95A 2Y4PA 5LVLA 3PFVA 2YM8A 3PVWA 4EI4A 1MQ4A 3UOJA 3DGKA 4TTHB 2IPXA 4BDCA 4YBKA 1PXPA 2UZLA 2VTRA 4RC2A 1IRKA 4FSNA 2FSMX 1AQ1A 3UYSA 4NSTA 1DAYA 4F1TA 1MUOA 4F9YA 1V0PA 3C13A 1XBCA 2OO8X 3LCTA 3SAYA 3L9PA 5FXSA 1KE7A 2XRUA 4IAYA 3KVWA 3TIYA 2QC6A 2QOOA 4NT4A 4YU2A 3E8CA 3CLYA 1JLUE 2YLFA 5IUHA 1KE8A 2DUVA 3H3CA 5D7VA 5DE2A 3UQGA 4BDGA 2IZRA 5HIEA 4L7SA 4ZTMA 4CCBA 4IACA 3F88A 4KS8A 2GNIA 2VTAA 3WYXA 4AOIA 3MS9A 4QP4A 4I93A 4JDJA 4XX9A 3RPRA 4HPTE 3VBWA 2I0VA 3TV4A 3PIYA 2AC3A 3KB7A 4M7IA 3HYHA 3VQHA 4GT3A 3BUNB 5FTQA 4NL0A 4DITA 4OLIA 5FRIA 4FIFA 4XS2A 4MQ2A 2WQBA 5KNJA 3BYMA 4EOLA 5JMSA 4IAKA 2CPKE 2Y6MA 1H28A 4B6LA 2QHMA 4OTPA 5FTOA 5TOZA 1URWA 3ZOSA 3DT1A 4BZNA 4EK4A 3RNIA 4CVAA 1OL5A 3FV8A 2V62A 1OUKA 3MJ1A 4CFNA 4KIPA 3HP2A 3EWHA 3OF0A 3LFQA 4XMOA 4WSYA 1OB3A 3Q53A 4QP3A 2EB2A 3Q96A 5F95A 3ORNA 2YDKA 5E8UA 4IFCA 3ZFXA 4DAWA 4GJ3A 5DRBA 3FC2A 5AR7A 5JT2A 5GHVA 2LGCA 1WBWA 1WBSA 3MJ2A 1T45A 3V8TA 2Z7LA 4DH8A 4AUAA 5AWMA 4C61A 2X7GA 3ZONA 4O1OA 1A48A 3HMNA 4CGAA 1JSUA 3F2NA 4F6WA 5KMNA 4YJOA 1SYKA 4L9IA 5K0KA 4XG6A 3QTUA 4BKYA 2FYSA 4KA3A 3IQ7A 4QMZA 4A4XA 1RQQA 1PYEA 4C4EA 3TWJA 1KE6A 2JDVA 3R9OA 5CYIA 5E8XA 4AF3A 4AZSA 4DFNA 5DR6A 1PMEA 5CAOA 2YIRA 4Z9LA 2B54A 2R0UA 3FC1X 3KGAA 3P23A 4CFVA 4EH6A 2VTLA 3LM5A 5J9ZA 2IVTA 5M4UA 3EFLA 2UUEA 3FMNA 1ZOEA 3C4WA 2CMWA 3RP9A 3VWAA 4FKLA 2IWIA 1SM2A 4QNYA 3KVXA 1DI8A 5HVYA 5I0BA 4ANOA 5EDRA 3QCXA 3QZGA 4FSQA 3QTXA 4EHEA 1Q8UA 3I60A 3BIZA 4YHJA 4C59A 3W2SA 4CMUA 3BZ3A 3MTLA 3BE2A 4OTGA 4R78A 3VIDA 3WOWA 4LGDA 3R83A 4O84A 1FVVA 2GNHA 3C4EA 5K5XA 4RT7A 2WKMA 3U9CA 2XIKA 5ANKA 2P55A 3RHXA 3UIUA 2W9ZB 2QKRA 1W84A 4M13A 5KO1A 4QP9A 4YHFA 2CGXA 2F2UA 3BLHA 5KMJA 5EHOA 2PUPA 4ZTQA 4U5JA 4BCGA 3COHA 3R04A 3C0IA 5JFWA 4JRNA 2YM7A 4IJPA 2XNEA 4JR7A 4C4FA 4KKEA 5I9UA 2XIZA 4QYEA 4AN9A 2FSOX 1OPKA 1GZNA 3BCEA 3D7ZA 2Y6OA 3EFKA 5KMIA 3V3VA 4TY1A 5BPYA 4BCFA 5CWZA 2OJJA 5CI7A 4DN5A 3SXRA 4KBAA 4O0XA 2X9EA 3L8PA 4L45A 2REIA 3GVUA 4FIIA 1O6KA 4M0YA 2JAMA 1Q8YA 3ULIA 3BGQA 5L2QA 3V5WA 5LOHA 3BU6A 4FZDB 5FBOA 3MH3A 2OIBA 3GXLA 2XCHA 4Y83A 4D2PA 2FB8A 4GU6A 4EH8A 2HW6A 4DT8A 1XBAA 2V22A 3EYHA 4EOOA 4YJUA 4NW6A 3GI3A 4QT1A 1XHAA 2A27A 3PJ2A 2B1PA 3NUPA 3SGCA 3VN9A 5B7VA 2WQMA 4EEVA 5T68A 4FSZA 4MQ1A 3QZHA 2YDJA 3IDCA 4CD0A 2P3GX 5DI1A 2WMTA 1BX6A 5BVNA 3VRRA 3GENA 3TNIA 5E8TA 3F7ZA 4TNDA 4QTCA 4B0GA 3A4PA 5B2LA 5ACKA 5A4LA 3F3WA 3PDTA 4D5HA 4HYSA 1ZZ2A 4RJ5A 5DYJA 2W1IA 3IONA 3EQHA 3IW7A 3LXLA 3ZC6A 5IH5A 5M51A 2BKZA 2ITQA 2JD5A 3GCSA 3ZNIA 3RAHA 5AIRA 3MDYA 5J1WA 1Q3DA 3ERKA 2HXQA 4NTTA 4LQMA 1YXXA 3PY1A 5HLNA 4A9YA 1PXNA 2BRBA 4RBLA 2AUHA 3BHTA 4ERWA 2JC6A 2JKOA 4JVGA 3FL4A 4QMYA 2W0JA 1ZWSA 3V8WA 3NYXA 5GINE 3NNUA 4MD9E 4C3PA 3TKHA 4EOKA 5J9YA 3DXQA 4LRKA 1NY3A 3LQ5A 3F5XA 4FYNA 2ITVA 2O5KA 4C7TA 3N4TA 4N0SA 4WBBB 3VS2A 2C6OA 4FG9A 1FGKA 4PMPA 1A9UA 4ZTSA 3UQCA 3LLAA 4CFUA 4N70A 2OJIA 2QCSA 3KXZA 3LQ3A 2JIVA 2XEZA 2C6IA 4RWIA 4CQGA 3TL8A 3HRFA 2J2IB 4L3LA 2YIWA 4AT5A 2OFUA 2PVMA 2W1FA 4AZEA 4C57A 3FZTA 2XUUA 2ZJWA 4FKTA 4JNWA 4C4JA 2XP2A 5HE3A 1MRVA 3BGPA 3Q52A 4EWQA 1RW8A 2CGVA 2ETKA 2HOGA 2YERA 5CT7A 3TCPA 2ZV2A 4ZZOA 3E7VA 3B8RA 2VX0A 3OTUA 5D10A 3R8UA 4CV9A 3L1SA 3R30A 4JG8A 3PXFA 4NUSA 3RBWA 4IW0A 5HG7A 3RNYA 3TDWA 3ZDIA 2YEXA 5F20A 3WILA 4QTEA 5HTCA 5FDXA 2UW8A 4S31A 3WIGA 4ZAUA 4HVHA 5AEPA 5IQEA 2PMOX 2B55A 1H1RA 4BCIA 3CBLA 3DAJA 4ASEA 1F5QA 4DA5A 3I6UA 4QTBA 4ENYA 4OTQA 3L8VA 5AR5A 2B52A 5FM3A 2PPQA 1Y6AA 3LVPA 4CNHA 4F9BA 4O21A 3BGZA 5K5NA 1GZKA 4YMJA 3R01A 3MYGA 4MK0A 3A61A 4IWQA 1DS5A 4J1RA 4J52A 3NAYA 2WMUA 5DA3A 5JQ5A 3ID6C 4YLKA 1GIJA 1XJDA 3WE4A 3FPQA 5A9UA 4GG7A 3PJ3A 5M4IA 1O6LA 4E6CA 2C3JA 4EYJA 5HQ0A 1NVSA 1YOMA 4O7LA 1OECA 4FKQA 2YA9A 5CVFA 1I09A 3UOLA 4FTNA 2HY81 2WTCA 4CZYB 4YTCA 2YM6A 5BYZA 3LMGA 4RFZA 4AGDA 3KULB 1H1WA 3QBNA 4EK3A 2YN8A 5BVOA 3LKMA 3BV3A 1BL7A 2UZEA 4MH7A 3D5XA 3NUYA 5HZNA 5DG5A 1XKKA 2UZNA 3QTIA 4QP1A 3F6XA 2W17A 3PVUA 4A07A 4AT3A 2R3QA 4JBVA 3P79A 3BUXB 3ODYX 5J79A 5K4JA 5GJGA 4W8DA 2X81A 5AMNA 4GPLB 3HA6A 4YC8A 4HCVA 4BWKA 2BZIB 4EH7A 4H58A 4ANSA 2GQSA 4K9YA 4X2GA 2ZM1A 3UGCA 5BVKA 5I9YA 4D4SA 4ZZMA 2WQNA 4O0TA 1YWRA 4YZNA 1OKYA 4E4LA 2W4OA 3I5ZA 3NZ0A 3FMKA 1Q8TA 4JBPA 3GC7A 5DR9A 3FLNC 4S33A 3UVQA 4DGLC 3MVLA 5HO8A 3AQVA 2C4GA 4AE9A 3CIKA 5ANIA 4XG3A 2CNUA 5D12A 5EYKA 4MX9A 2NPQA 2RFEA 5CQWA 4BB4A 4FA2A 4IVBA 2RSVA 3U6JA 3DJ5A 1J1BA 3RMFA 2FO0A 1H0WA 3QUPA 4C36A 3REPA 3Q9XA 3FHIA 3ZEPA 5HE0A 3C9WA 4LYNA 4D2TA 3N4VA 5IQHA 4FNWA 4M15A 5CU3A 2PVNA 2FH9A 2QNJA 3CC6A 4FV9A 4U6RA 5IA5A 4ANQA 4UN0C 4GK4A 4H3QA 3FKNA 1ZMWA 2R3RA 3ORIA 2VO6A 4IAZA 4IAAA 5G6VA 3A8WA 1OIUA 2ZMDA 2G01A 2GNJA 3QQGA 1VJYA 4AA4A 3LPBA 1DM2A 4W4XA 5KE0A 4U8ZA 3SRVA 2CKEA 2HENA 1J7IA 4IWDA 5CU0A 1ZYSA 1U4DA 3GFWA 2GFCA 4ZTHA 4LGHA 4JX7A 3KQ7A 2UW0A 3M2WA 3UIBA 2BUJA 5A46A 4MHAA 4IB0A 4OTDA 3ODZX 2Z8CA 4I6QA 4KKGA 3RWPA 3CS9A 4GT5A 2BTSA 1Y8GA 3IGOA 3KK9A 4F7LA 2J5FA 2PVLA 3FLSA 4UMRA 4IM0A 2Z60A 2J6MA 4WG4A 4IQ6A 4USFA 4DFYA 4UEUA 3FI4A 1FPUA 4AOTA 2XH5A 2WOUA 1H24A 3TKUA 1OKWA 1YI4A 1ZOHA 4FKPA 4LV5A 4AGWA 4ASXA 4XCUA 1U5QA 3U9NA 1IA8A 3DKCA 3QU0A 1PKGA 4K6ZA 4FKRA 4HZSA 3HUBA 1LEWA 3I7CA 4TWCA 5HHWA 1M7NA 4N6YA 1GZ8A 2QQ7A 4DG3E 5LVMA 3R1SA 4X3FC 1R3CA 1V1KA 2I6LA 5HLWA 2GQRA 5BNJA 4UB7A 1OKZA 2XS0A 3R00A 5BUJA 3DFCB 2XMYA 4G9RA 3T3VA 5FEEA 4MXCA 3IO7A 1H00A 2W96B 2WEVA 4MTAA 3FXZA 5CANA 1WVWA 1M17A 3OOMA 3DPKA 5AUXA 5BUEA 4BBFA 3RALA 2ZYBA 4O22A 2XNNA 3GQIA 3MVJA 3O51A 5HGIA 4GU9A 4IX4A 4XV1A 4YPSA 4JOAA 3Q4CA 3OC1A 2XK7A 3CD3A 2VGOA 3UO5A 1IAJA 3M1SA 5EW9A 4IWPA 4AFJA 1OGUA 4BGHA 4J8MA 5E90A 5AV0A 3QX2A 5KCVA 2W1GA 5T3QA 2FSTX 3LFBA 4FG8A 4FKWA 2E2BA 4Y8DA 3PLSA 3ORLA 5DT3A 3S4QA 3QA0A 2ZB1A 2HWPA 3VBTA 3P5KA 4CZTA 4UX9A 1LUFA 4PMSA 2AYPA 3FXXA 1ZLTA 4NYEA 2Y1NA 4CZUA 2R3FA 3FZOA 1ZY4A 4XG9A 3RPSA 4FT7A 4O81A 3QCQA 4LRMA 4LGGA 3BYVA 3EQRA 3JS2A 3BHYA 3PG1A 1YXVA 3MWUA 2WMVA 3GOKA 3QZIA 4XRJA 3O0GA 4APCA 4MXZA 5HD4A 5CAVA 2J4ZA 2XKDA 1LR4A 4GYGA 4NKAA 3IW5A 4D2WA 4HW7A 5I5ZA 3TUDA 1Q4LA 4FSWA 1Z5MA 3CGFA 3PVGA 4U41A 3DNEA 1LP4A 3ZSHA 2QG7A 4PV0A 2UZBA 4U42A 5HTIA 3NVMB 2QOHA 1PHKA 2WEIA 4O1PA 4HGLA 5HTBA 4YTIA 2VX3A 4QMXA 3W32A 1R39A 3QRKA 3D5UA 4X7QA 4I6BA 3QKLA 3AGMA 3U87A 4FUXA 4PDPA 1O9UA 1YI3A 4M0ZA 4S34A 5AM7A 3I5NA 3LCDA 3WZUA 3JR1A 2YZAA 1H1QA 4JQEA 5TF9A 2BIKB 3L8XA 5FLFA 4XUFA 4D4YA 1KSWA 4Z7GA 5KBRA 2UW6A 2W99B 1GIHA 1UKIA 5JN2A 4HVGA 4E1ZA 5AM6A 3BBWA 4YZDA 4BDEA 4DC2A 4EKKA 4I20A 4LOOA 3VBXA 3CY3A 2PZIA 2GCDA 3FZSA 4JJRA 4TZRA 5GJFA 3VHEA 3GC8A 5A4EA 4RVTA 3AGLA 4CTCA 4L3PA 1UV5A 3QZFA 4EZ5A 4YTHA 2ETMA 4QTAA 4DLIA 4O6EA 3EN4A 1IG1A 5AR8A 3HVCA 5HCXA 4X3JA 4F9AA 3UDBA 4FR4A 2HELA 4JBQA 5GNKA 3EN9A 1SNXA 1KE5A 1FOTA 3TV6A 3PY0A 4I21A 4XP2A 3UZTA 5TO8A 4GIIA 3E8NA 2PMNX 1OZ1A 3VBYA 3ACKA 3G6GA 4RIYA 2H96A 5HI2A 4A7CA 2JAVA 2A19B 4R3RA 4A4LA 4IM3A 4OTHA 3KREA 3UE4A 3V5PA 3IDBA 3ZFMA 3EQPA 5C03A 1U5RA 3ATSA 5AV3A 4DE4A 4MD8E 4USDA 4XOYA 3RK5A 3KRXA 4ZIMA 1ZARA 2ZDUA 3MPMA 3OEZA 3H9RA 4E5BA 2WMWA 1OBGA 2RFSA 2PVFA 5AJQA 3C50A 5E8VA 5L8JA 2G2HA 2UZVA 4K11A 2VO0A 1YHWA 4QYGA 5IQIA 2C5XA 2BPMA 5L2SA 4GSBA 4UMTA 2H9VA 2IVVA 4LG4A 3POZA 1WFCA 4RJ6A 1YDRE 3WZKA 4DFBA 2B9FA 3OP0A 3OXZA 1OL7A 3FLWA 1DI9A 4QMUA 4XLVA 3GU7A 4A9SA 1PXOA 5FBNC 3VF9A 4WOVA 4D4VA 3DQXA 3MH2A 5JFVA 2O8YA 4B7TA 2QONA 4FV1A 4D2RA 2XIYA 1HOWA 5BQ0A 4P5ZA 2EWAA 2R5TA 4RMZA 4AQCA 5BUIA 4DH5A 4WG5A 2GHLA 5AR4A 3LFDA 4GT4A 3PXQA 4I5PA 5C8MA 4AG8A 5ITAA 3QUDA 3FSFA 1AD5A 3VRNA 3PWDA 1Y6BA 4MWIA 4A4OA 4ACCA 1P14A 4YJPA 3SV0A 5CF6A 3PLFB 4IM2A 1U46A 4FT9A 3E64A 5I4NA 5B0XA 4FKSA 3HMOA 2IO6A 2F49A 2OI4X 4Y5QA 5DVRA 5G1XA 5L8LA 3PZHA 1Z9XA 3ORTA 3QC4A 4CG8A 3PPKA 3VROA 2YJSA 4EHZA 1WBOA 4H1JA 4FV5A 2E9PA 1ZYJA 4DEDA 3M11A 3PSCA 3U8WA 3H30A 3QGWA 4BKJA 1ZY5A 3TJDA 4NFNA 4JXFA 4TYIA 4Z16A 2X7FA 3Q9YA 4FUYA 4ZSLA 1WBNA 3PIXA 4U7ZA 3MN3A 2P0CA 4U3ZA 3D15A 1JKKA 4TWNA 4ZOGA 4X0MA 2IVSA 5IQAA 1M52A 4NEUA 5CVHA 3VRZA 5HKYA 4WNPA 2ITPA 1JVPP 3OUKA 1FVRA 1NVRA 4X2KA 1H0VA 4QYYA 5AP7A 2WTDA 5M06A 2WTWA 3TJCA 4G3DA 2VNWA 4RA5A 2P2HA 3PYYA 2YWPA 4R7HA 3LIJA 4O7ZA 2PVRA 4X6RA 4O7RA 5KZIA 3POOA 4RJ8A 4EOQA 4I41A 2WOTA 4DFZE 3F5PA 1GY3A 4IMYA 1H08A 4JS8A 1JAMA 3OWJA 3QKMA 4CFWA 2J50A 1Q41A 3C4XA 4MF1A 4D1SA 5CNNA 4UY9A 3UIXA 1J91A 4EUTA 4J98A 5B2MA 4TWOA 3PPZA 4YJVA 3UODA 2JKKA 1KE9A 4YBJA 3R7GA 5AP0A 2IN6A 2WD1A 3SDJA 4PRJA 5CI6A 5ANJA 3L9LA 2C5YA 4D55A 4R7BA 1FMKA 5LARA 4QMQA 4IZ5A 4QP7A 4QQTA 1UNGA 4FTMA 3CY2A 2WMRA 2CNQA 2LAVA 2EXCX 5JGAA 1PMNA 4QPSA 3GQLA 4DYMA 2XIXA 1IA9A 3ZZEA 3E5AA 3ATTA 3VBQA 3LXPA 2YIXA 5AP5A 3ETAA 4A4BA 3VS7A 3DJ6A 1OL2A 4DEAA 3CR0A 4EJNA 5CEKA 3SOAA 3KRRA 3Q3BA 4L53A 5CSVA 3DKOA 5CENA 2XVDA 5CF5A 4O83A 2WELA 2PULA 2KULA 4H3BA 2C6KA 4OBQA 1R78A 4RLKA 5CS6A 5B2KA 4ZLZA 3AOXA 4J96A 3ZLYA 3MA3A 4EK5A 1APME 1WMKA 3A7JA 1XQZA 3Q2MA 5FXQA 4H05A 4YLJA 4CRLA 3NIEA 3EN7A 5IH4A 2W5BA 4G9CA 4F70A 3HMPA 5BX0A 5L2WA 4BCNA 2QURA 4U79A 4ZSEA 3NYNA 2VTNA 2ITOA 3V6SA 4O7NA 1O6YA 1YXTA 5EW3A 3LCOA 1R0EA 4OBPA 4J8NA 5M44A 2CJMA 3R7VA 4EQUA 3BUWB 4PDYA 2RKUA 3DZQA 5JGDA 2UZWE 3R2YA 4O7WA 3QCYA 2V55A 2OU7A 3FMHA 3P9JA 4JLCA 1TVOA 2BAQA 4AA5A 5M07A 3UNZA 3E87A 2EVAA 3HAVA 1REJA 1ZXEA 5DNRA 5LMAA 2F4JA 2YWVA 3JVSA 4FV7A 1JNKA 4J7BA 5EFQA 2Q0NA 4L68A 3RI1A 2OZOA 3EL7A 2QODA 3F61A 5CQUA 3W2PA 3ZO3A 4BDHA 3R9HA 3ALOA 2E9UA 3HLLA 5K0XA 4FEXA 3U4WA 3OBGA 5KKRC 2UZDA 4KIQA 4PL3A 4YGAA 5GZ9A 4C37A 1ND4A 4YSJA 4JDHA 4FV8A 5ANOA 2QD9A 3DBQA 3W18A 4BYIA 4KD1A 3FPMA 3Q4TA 4I24A 4FSUA 2XK9A 2QOFA 4QTDA 4EHVA 3G2FA 4JL9A 4GYIA 4PL4A 3PSDA 3P7CA 5EDQA 4FSMA 2IZTA 3T9TA 4GK2A 4BICA 5J9LA 5IQGA 3LCSA 4HVDA 2I0YA 1P4OA 3EHAA 2V7OA 3RAIA 2Y9QA 5GIOE 4R1YA 4APPA 5E9EA 1M2QA 2ZOQA 5CSXA 4ZY4A 2X2KA 2R64A 2PUIA 4YZBA 5HVJA 4PPBA 3A99A 3FMDA 3BKBA 3HNGA 2R3OA 3QTQA 3ZC5A 2YCRA 5DH3A 1G3NA 3TTJA 5TE0A 2GMXA 2VO7A 4PTCA 3ZTXA 4B8LA 4E4NA 4ZJVA 5A14A 3IS5A 4CT2A 4FOBA 4TT7A 5CEPA 2ACXA 5C4LA 3FLZA 3JVRA 3QGYA 4XV9A 2PTKA 2WZJA 1ZYLA 4K77A 2OFVA 5T6KA 2C6MA 5KMLA 4FYOA 1PJKA 3VAPA 3LM0A 5DHJA 3BU3A 3KK8A 2QOKA 1H25A 4J95A 2OF2A 4Y72A 3EFWA 2PVYA 4DH7A 4U40A 3Q04A 1CM8A 2J51A 3PJ8A 2WPAA 5AADA 4FIGA 1MRYA 3K5UA 2UZTA 1PXJA 2OK1A 4HCUA 5EG3A 1NXKA 2CSNA 3E3BX 4R7IA 1UU9A 4IVDA 3HGKA 2BROA 3SXFA 2BRHA 4BZDA 5KBQA 2GTNA 3HMIA 5J3XA 3VJNA 4AW5A 2WNTA 1E1VA 3QQUA 4RIOA 4NJDA 3G90X 2XJ2A 3GEQA 3W8QA 3KC3A 3G33A 3JY9A 2R9SA 4BRXA 4F08A 4BDBA 5DWRA 5FWKK 3RJCA 5BYLA 2RG5A 2VNYA 3DAEA 3KCFA 4IVCA 4MF0A 3QD2B 4BGQA 4QQ5A 4D58A 3GFEA 4ZJIA 3FZ1A 3ZRLA 5KUPA 5A54A 2BVAA 4C4IA 3V51A 3QL8A 4PQNA 4MAOA 4PTGA 3BI6A 4PPAA 4TYHA 5JRSA 4P2KA 3IG7A 4G6LA 2GQGA 4IJ9A 4BTJA 2NRYA 3NIZA 3RZFA 5AA8A 2VGPA 4F99A 4AACA 3FYJX 4K0YA 4TXCA 3VS0A 4F1MA 5LXMA 3GCPA 2BZHB 3ORMA 2ZB0A 3Q60A 3QYWA 4RIXA 4UYNA 4WKQA 4XBUA 4AU8A 2PSQA 2QU5A 3K3IA 4LRJA 4X3FB 4EYMA 2C3KA 3ANRA 4WD5A 4FSRA 4F1OA 4U0IA 1YDSE 3E88A 4I6FA 5HNIX 3UZRA 4CFMA 4IX3A 2ETRA 1XH9A 4FZAB 4ORKA 4C33A 5AA9A 5AV1A 1UWJA 3IW6A 4XG8A 4P90A 4AW1A 2A4LA 2OZAA 2C5OA 5FGKA 2VTPA 3NEWA 2VTJA 3G51A 3AMBA 3KKVA 4FIHA 4G3GA 3WF9A 4ERKA 1XH8A 3D94A 3ZLWA 3O8TA 4MXYA 4O7YA 2V0DA 1U59A 4DH1A 4G3EA 4WIHA 4U9AA 4BCJA 4DEHA 2BKKA 3IOPA 4NM0A 4FVPA 4KBCA 3QQKA 4NIFB 4ACGA 4LMUA 4LI5A 4EZ7A 5AUVA 4AP7A 5HBEA 4EOPA 3ENMA 2I0EA 3HV3A 4HZRA 5E1EA 5HKZA 5HKMA 4EJ7A 5EYMA 4GIHA 3O71A 2R3LA 4YTFA 1HCKA 4BGGA 4FVRA 1CDKA 1W7HA 3GUBA 4C4GA 5J5SA 3SRVB 3RAWA 4FX3A 4PP7A 3MFSA 3FBVA 3I6WA 4BCPA 4FT3A 3R8PA 3M42A 4FKJA 4RC3A 2R3GA 3R1QA 2CKPA 1P5EA 1OPJA 3CQUA 5F1ZA 4R8QA 3MB6A 2VWBA 3DDQA 3DKFA 4IIRA 4UWBA 4CKRA 4WA9A 1GNGA 3DU8A 1XO2B 3GNIB 4NM7A 4JDKA 5HBJA 2Y7JA 2W4KA 3H9OA 4RC4A 5CVGA 4O0RA 4KRDA 5H8GA 5C27A 2JGZA 4ANBA 3FQEA 1FINA 5L8KA 3R63A 3EH9A 2O65A 3A2CA 3W8LA 4ZS4A 3GC0A 2QG5A 2V7AA 3UG1A 2CN5A 2XRWA 3RPYA 3ZO1A 1BI8A 4KINA 2IVUA 4ASDA 1F3MC 1H4LA 3FKLA 4RQVA 3OEFX 3RM7A 3MIAA 5AP3A 4AW0A 5CAPA 1URCA 4IFGA 4LUDA 4YZCA 4HOKA 5EM6A 5HE1A 4K2RA 3FEGA 2GHMA 4PMMA 3QKKA 2VWUA 3SQQA 4ANLA 4IX6A 2HY0A 3ORKA 3W1FA 4BDDA 1OL1A 3PPJA 1J7LA 4O0YA 5HU9A 2CGWA 3EOCA 5HIDA 1ZYDA 2C6EA 4OBOA 5E8YA 2YCSA 3FMEA 4X21A 4F64A 5KMKA 3Q6WA 1S9IA 2WMQA 5TKDA 1Q8ZA 4BCOA 3ELJA 3A7HA 3V5QA 3AC8A 4BIBA 2X39A 5FUTA 2Y4IB 1UU7A 2O64A 3G0EA 3KULA 3KRLA 3PJCA 4TPTA 3T9IA 1IASA 3R7YA 4F4PA 3QWJA 4AXAA 5DMZA 3KY2A 3UNJA 4DF3A 5CTPA 4I23A 3E93A 5CU6A 5AP6A 2X9FA 5FEDA 1NT2A 3JUHA 3EYGA 2GSFA 3I79A 4FKUA 5JEBA 3V8SA 1ERKA 1IEPA 2G9XA 2OH4A 4BI0A 2QOIA 4GW8A 4A9UA 3SA0A 2XEYA 3MFTA 3I0QA 3OWLA 4O0VA 2PU8A 5CX9A 3ZXZA 2G2IA 2VTOA 4MXOA 5FXRA 4DG2E 4F7SA 2YCQA 2VZ6A 3OBJA 4NFMA 4FBXA 5IUIA 3VUTA 1IAHA 1Q99A 4G3CA 2CNVA 2I0HA 3EJ1A 3LCKA 5HKWA 3DK7A 4JIKA 4AGUA 2C0IA 4IB3A 4ZMEA 1XR1A 4DLJA 4RJ4A 4NIFA 5HESA 4C35A 1OBDA 2OIDA 3FY0A 4RIWA 4DEGA 4F7JA 3HRBA 3LOKA 3R71A 3BHUA 3RVGA 5IEYA 3QCSA 4B8MA 1RE8A 1NW1A 5IZFA 4R1VA 3FQHA 5HE2A 1YVHA 5CSPA 2C30A 4L43A 2CDZA 1J1CA 2BILB 1PXIA 1EH4A 1H26A 1PMUA 4XP3A 3C0HA 3TUCA 3IOKA 3KN6A 4GJ2A 4DGMA 2R3PA 2Z2WA 2QOQA 2CCHA 4FKVA 2QOCA 5LCKA 3HDMA 5LVOA 2C1AA 4BN1A 3I1AA 4L42A 4RIXB 4M69A 2OBJA 4NK9A 5AAFA 4AN3A 4BTMA 3F2RA 5AFVA 4FNXA 3ZFYA 2Z7QA 3NYOA 2VTTA 5M53A 2AC5A 3DLZA 2OF4A 5J95A 2CKQA 1CTPE 3GU4A 4QP6A 3C4CA 3WIKA 4QPMA 2DYLA 1FBVA 4CFFA 3EZVA 3SHEA 5L4QA 2QO7A 3LMIA 3DDPA 4RPVA 3V04A 2R4BA 2BAJA 5LCJA 3ZU7A 2WTIA 3D2KA 3CEKA 3NUXA 4FEWA 4EC8A 2Z7SA 4U44A 2ZV8A 5BYYA 3ZBXA 4R6VA 3UOHA 2GNLA 4KAOA 4E5AX 4O0UA 2C47A 3D7TA 3E8DA 5DEWA 4QQCA 2RF9A 5ETFA 5IA0A 1QPDA 3LXKA 5LVNA 1Q97A 2BDWA 3MGYA 3OCTA 4FKGA 4JX3A 5JSMA 3H0ZA 5A4QA 4NWMA 2EB3A 4XP0A 3VS4A 4PPCA 4XG2A 3T3UA 3UMXA 4LL5A 4MBLA 3SX9A 5E1SA 1NA7A 3PP0A 3Q5IA 2W1EA 3COMA 4IAFA 3R8MA 5CF8A 5HNBA 4CLJA 4V05A 4IB5A 3VJOA 4FOCA 3QTSA 1GAGA 5A6NA 2QVSE 5KX8A 5L6PA 4BTKA 3QD3A 2PVHA 1YQJA 3GCQA 2PE1A 3KXGA 4WSQA 3WF7A 3DJ7A 2IW9A 3ZO2A 3QHRA 5BMSA 1Q8WA 3W16A 3TT0A 3CKXA 4CT1A 3W2RA 5FDPA 4IDVA 4BYJA 4JI9A 3OD6X 3NMUF 2O3PA 4PF4A 3A7GA 4ITIA 4L8MA 1UA2A 4BDJA 5HG8A 3R7UA 1YW2A 3OXTA 4RWJA 2ITXA 3PJ1A 4G6NA 4F65A 4ZSAA 3JY0A 4MEDA 4KIOA 2OIQA 3CD8A 3SG9A 5CF4A 4HGEA 2G2FA 4H39A 4OAVB 1FQ1B 3VUDA 3TM0A 1CSNA 3O96A 5HOAA 4LMNA 3LZBA 3MFUA 2HZ4A 4QRCA 3ZBFA 3DKGA 5CZHA 3L9NA 4BKZA 2XNOA 3QX4A 3HDNA 4E93A 4EBVA 5AX3A 5EI8A 2YM4A 3RK9A 5GZAA 4D1ZA 4OTWA 3KXNA 4ITHA 4IB1A 4EBWA 5I9XA 4OR5A 4RVMA 3RZBA 3WARA 4M68A 4O0SA 2Z02A 4NM5A 4U3YA 5FEQA 4GFOA 3UNKA 5GZ8A 4GVJA 5EQEA 5E8SA 4OGRA 4O27B 3FYKX 4QMPA 4FZ6A 1YKRA 5DGZA 3R1YA 2WFYA 3FKOA 2WU7A 2WO6A 3PRFA 4AAAA 3DBEA 4RA4A 3WYYA 4Y46A 3C7QA 5C8KA 5FTGA 3CE3A 4BVUA 1PYXA 3W2CA 4BWPA 5EHLA 4FMQA 1KWPA 2BMCA 1BYGA 2ITNA 3FI8A 3A60A 3CSVA 1A06A 4TYEA 5E4HA 3NVKI 3OT8A 1H01A 3TNWA 4YR8A 4CSVA 2B9JA 3MVMA 5IG1A 4L3JA 2JITA 2WMAA 3ORZA 2C69A 3OW4A 4XHKB 1QL6A 1W83A 2X8IA 4M8TA 2C5NA 2GS2A 2XJ0A 3MW1A 4Q2AA 3R8VA 4C62A 3LJ1A 4IHPA 2IG7A 4CQEA 3IECA 5KKRB 4XLIA 2DS1A 4HCTA 1PKDA 3KMWA 4BI2A 3EQBA 2VD5A 4GL9A 4MCVA 4ZLOA 3JXWA 3QRJA 2JDSA 2JBPA 2UV2A 2KTYA 3NGAA 3ORPA 3QTWA 1UU8A 5EYDA 1LEZA 4JRVA 3T8OA 5ICPA 3OCBA 3TZ7A 2PYWA 3VUIA 4RGJA 4DHFA 4C34A 3IKAA 4RSSA 2R3NA 2ONLA 1FMOE 2HIWA 2F57A 4G5JA 3NPCA 1OKVA 5KMMA 4FEQA 2ERKA 4LL0A 4C38A 3ZM4A 3DS6A 3G9LX 4ZJJA 2GNGA 4RWKA 2BIYA 3GU6A 3BEGA 3MBLA 5E91A 2CGUA 2PMIA 3FLYA 3LMHA 2J0IA 3BEAA 3U51A 1OIRA 3R9NA 2ZM4A 3IW8A 1UNHA 3EB0A 5AXIA 5IQBA 3OXIA 4DCAA 4PDOA 3IGGA 4AWIA 2BFXA 2YHVA 4IBMA 3L8SA 3LFCA 3V5TA 2W4JA 1Y91A 4CV8A 3EQDA 3VO3A 4DH3A 3HAMA 4C2VA 3U6IA 5IU2A 2BRNA 4RX7A 1KOAA 4RJ3A 4PNIA 4CKIA 3F9NA 3Q2JA 3WI6A 2VRXA 4GCJA 4OAUC 4XOZA 2XIRA 1XH7A 3FSKA 2HWOA 3W33A 3QLFA 4F0FA 3R2BA 4V0GB 3F3VA 4IAIA 4H3PA 3WF6A 5JFSA 2UZOA 4FNYA 4FL2A 5LMKA 3GU8A 3F2AA 4FV3A 4P4CA 3TDVA 1QCFA 2OWBA 3TZ9A 2O63A 4RRVA 3PSBA 3MY1A 3PLAE 2QI8A 4DEBA 5AUWA 4O82A 2GHGA 4IH8A 4M12A 3Q6UA 4W4VA 3VVHA 2WB8A 1REKA 2XBAA 2IZUA 4DEEA 2CHLA 3PG3A 3DB8A 3OS3A 4Z3VA 3U54A 3V01A 3H10A 3C5IA 1OUYA 1OMWA 2QOBA 2QO9A 3QQFA 1V0BA 2W5AA 5IMEA 2ONLC 3EQGA 3VS6A 3SG8A 3KMUA 3QF9A 1H1SA 4GS6A 2B53A 3NW5A 3CCNA 4YUQA 1OITA 4UMPA 4YPDA 1WAKA 3NSZA 3MY0A 3P4KA 4AA0A 2XJ1A 2UVZA 4KB8A 4Y73A 3U4UA 3UPZA 2YACA 5IA2A 2BR1A 3HECA 5ANDA 3ZLSA 4DCEA 1W98A 4YJQA 3CP9A 3W2QA 3CQEA 2QO2A 4PNKA 1WBTA 2JBOA 4HNIA 1XH6A 5DBXA 5FG8A 3QTRA 2YM3A 5L6OA 4JIAA 3V5LA 1JKLA 3MPTA 4X6QC 2ZV7A 1B47A 4M66A 1TQPA 2PUUA 5HO6A 5J7BA 3VUGA 3NUNA 4FTJA 4YJNA 3C1XA 3KXMA 1YHVA 2UVYA 4UXLA 4R77A 5IEVA 3VULA 2XK6A 4EK8A 5F9EA 3AD4A 3F5UA 2PMLX 3BLQA 1S9JA 5HCZA 4FF8A 2UW9A 5EQPA 1R1WA 4R5SA 3F82A 4IADA 2OW3A 4XV2A 2YIYA 2B0QA 1ZAOA 2W1HA 3EKKA 1W82A 2A1AB 1VYWA 2XB7A 3F3UA 4JT3A 2OLCA 4U97A 5M57A 1Y57A 2J9MA 3TUBA 1BI7A 5GJDA 4D2SA 2OSCA 3OY3A 3VRYA 4KBKA 3R6XA 1OM1A 2HZ0A 2VWIA 4IZYA 2VUWA 4XJ0A 3OZ6A 4FG7A 4II5A 3NUAA 4CFXA 3CTQA 3BQRA 4QQJA 4FT5A 4IVAA 5IDNA 5K3YA 2GU8A 4DGGA 1J7UA 3SLSA 4N57A 4DBXA 4RIYB 1B39A 3F7WA 3VF8A 3COIA 2YDIA 4E4MA 2J0KA 5EW8A 2RFDA 4BFMA 2XKEA 2SRCA 2XYNA 3OB1B 2R3KA 2E9VA 4L52A 4PL5A 4O7SA 4EZ3A 2CBLA 4EOJA 4B99A 2WQEA 2VWXA 5KMOA 4YNOA 4XYFA 3C4ZA 2X6EA 1OIQA 4R3PA 5C26A 3RINA 3OWKA 3HV4A 3AC2A 2XKCA 4YSMA 1JPAA 5J87A 2BTRA 3DQWA 3P86A 1GJOA 3JPVA 3ET7A 2ZDTA 3BHHA 3DAKA 3UOKA 5IA1A 5IH6A 4QNAA 5LQFA 5F94A 1YXSA 4FICA 3ZEWA 3ALNA 3OUNB 4E7WA 3WZDA 3KXHA 4QMMA 3AMAA 3OT3A 2X2MA 3FZPA 3P7BA 5D1JA 4C0TA 4KIKB 1JKSA 2NRUA 1YI6A 3AMYA 4D0XA 4ZP5A 5IQFA 2OKRA 1QPJA 5EOLA 3UC3A 3TTIA 1WZYA 3FI2A 2ZV9A 3MA6A 1XWSA 4V04A 3IPHA 4YC6A 3DY7A 2BFYA 3K54A 4QD6A 4RVKA 5LMBA 3P78A 2EUFB 4KWPA 4LOPA 4X2FA 3UG2A 3D83A 4P7EA 2BZJA 1YVJA 4BCQA 1JKTA 3NWWA 1U54B 4O91A 2OJGA 4BDAA 1KOBA 3A8XA 4ZSGA 3G0FA 5CU4A 5CEOA 5DRDA 4GKIA 3PFQA 4GMYA 3HUCA 4OW8A 1VR2A 3R73A 5J8IA 4EK6A 3EQFA 4EOSA 2JKMA 3VGOA 1CKJA 2J90A 2O0UA 4YC3A 2F7EE 2IW8A 5E7RA 3PTGA 3HZTA 3BE9A 1FGIA 3O17A 5CEIA 4HNFA 1STCE 3MFRA 3R22A 5ETCA 4BHZA 4IZAA 1RDQE 4WT6A 3TI1A 3Q9WA 4GVAA 3OTVA 2C3LA 5AP4A 4I3ZA 4E20A 1WVYA 1FVTA 1TQMA 3LFEA 4RVLA 2Z7RA 1Q3WA 3EMGA 3UQFA 2PVJA 3R7EA 2XNPA 4I5CA 1KUTA 1SNUA 4QMTA 4DT9A 2OGVA 1JWHA 3O2MA 3ORXA 2PVKA 4F0IA 3TKIA 3D14A 2E9OA 3H0YA 4EOMA 2WMXA 3DB6A 3ZSIA 3U55A 2RGPA 4O2PA 5EI2A 2VWWA 4GUEA 3DV3A 3UTOA 4NU1A 4Z55A 3F66A 2XM9A 4G1WA 4EL9A 3SXSA 5FP6A 4L7FA 4ZY5A 3ZZWA 4GH2A 1P4FA 2PE0A 3PZEA 5H3QA 3RK7A 3UC4A 3A7FA 3O7LD 2VWYA 1H1PA 3O8UA 1ZYCA 2CCIA 3EN6A 3RPVA 3BBTB 2HZIA 2C0TA 3ZS5A 5BVWA 3ZYAA 4Q5EA 3OG7A 3BYUA 4FSTA 4XH6A 4YURA 2RG6A 4E6AA 5HBHA 1MQBA 2VTQA 3DTCA 4AT4A 4FEUA 2IZSA 2QLUA 3H4JA 4EH9A 3A7IA 1VYZA 2W06A 3TZ8A 3WZEA 3G6HA 2ITYA 3R7IA 2X8EA 1IR3A 4IC8A 5IA4A 4TW9A 3OFMA 1M2PA 4ZXTA 3SKCA 3TZMA 4BY9E 2PE2A 3VHKA 5EI6A 2VTHA 4EHGA 5DFPA 3ZM9A 3V5JA 1BLXA 3AXWA 4W4WA 5FQDC 4I4FA 4HVIA 4RZVA 3MH0A 5TT7A 3EN5A 1U54A 2W1ZA 4BZOA 3QQLA 4QO9A 5LWMA 5TR6A 2X4ZA 2H6DA 4TRLA 3FXWA 4UMQA 4MWHA 4WNKA 2WTKC 4I5MA 2YAKA 4A06A 2X0GA 1R0PA 3QRIA 4RQKA 5IISA 1V0OA 2PY3A 2GTMA 3TV7A 4L46A 1G8AA 4FTAA 4L44A 4D9UA 3K3JA 4C2WA 2JDTA 3W55A 2GDOA 2UZUE 2P4IA 2XK4A 3D5WA 5FM2A 3NAXA 4CMOA 3HX4A 3LW0A 4QMVA 4JG6A 4KIKA 2R7IA 1ATPE 1JSVA 2JIIA 3BWJA 5JRQA 5BMMA 3LJ0A 3FL5A 3P7AA 4D5KA 2PZPA 3B2WA 1YXUA 3R1NA 4BHNA 2OXXA 3R7OA 4RX5A 1PF8A 1CMKE 3TG1A 4BBMA 2JFLA 5DLSA 3PRIA 2F2CB 4F63A 4KNBA 4FTIA 3PA5A 3IK3A 4PTEA 2H34A 4P5QA 1I44A 1WBVA 3OCGA 4XNEA 5HG5A 1YWVA 3AG9A 4QOXA 3S2PA 4BTFA 2WGJA 5CAQA 4WNOA 3HMMA 5DN3A 3LXNA 4O7VA
chains in the Genus database with same CATH superfamily
4RFYA 5EM7A 2XA4A 3QD0A 5HORA 1M2RA 4FV0A 4GKHA 4R3CA 3ZUVA 4AS0A 3A62A 4Q5HA 5AUZA 4NW5A 4MVFA 5CASA 5IQCA 2VTMA 3AC3A 3W0OA 3RPOA 2F9GA 4WUNA 2JKQA 4MNEA 1WCCA 2JDOA 3UVPA 4EUUA 4WNMA 4DFXE 3KF7A 4O38A 2DLAA 4NGRA 3PUFC 1PXMA 3F5GA 2CLXA 4G2FA 4OUCA 3VS3A 4O4CA 3UO6A 3QALE 3GB2A 2HK5A 4O6LA 4RX8A 3LJ2A 1EO0A 3VS5A 3F69A 4QMNA 5AAEA 3FMJA 3PXKA 2F7ZE 3QWKA 2C6LA 3DK3A 3LFFA 2VN9A 3NW6A 4IE9A 4M3QA 4AZWA 5AAGA 4A4CA 4I94A 4BCMA 2BCJA 2NNWB 3ZUTA 2W05A 4CXAA 4NH1A 3Q4ZA 4FTRA 4F9CA 4USEA 2ZAZA 1UWHA 2EU9A 2G15A 1K2PA 4F6SA 1Q62A 2XM8A 3FI3A 4XG7A 3SD0A 5HO7A 3QD4A 4I92A 4H36A 3LQ8A 3NW7A 3PUPA 4MBJA 4FODA 3BL9A 3TXOA 4WBOA 4QMSA 4A9RA 5AX9A 4QYFA 2VTSA 1YOLA 4PUZA 4DINA 2C1BA 4U43A 4RX9A 4WHZA 3MVHA 2P2IA 5HX8A 3CXWA 5A3XA 4I4EA 2X2LA 5C01A 3RCJA 3R0TA 1B6CB 5I9WA 2HW7A 2VV9A 3DOGA 3NUUA 4Q9SA 4N4SA 3HV7A 1UU3A 3E92A 3QHWA 2WTJA 4AGCA 3FE3A 2J0LA 3GOPA 2YISA 2PWLA 3Q32A 4C4HA 5M55A 3FMLA 3C0GA 2WMSA 3I81A 1OI9A 3RKBA 2C0OA 3QA8A 3OHTA 3EFJA 3NS9A 3WZJA 4EC9A 3AT4A 4FTUA 3CQWA 5GIPE 2OXDA 1G5SA 4L67A 4Q9ZA 1H8FA 1K3AA 1OPLA 4GUBA 4L6QA 3CJFA 2HCKA 3CPBA 4OT5A 3VQUA 3ZXTA 2GS7A 3PXZA 4M97A 2I7QA 4W4YA 5E8WA 4TKSA 5AP2A 4E3CA 4K8AA 3C51A 2IW6A 3CJGA 4NTSA 3NCZA 5IKWA 5H8BA 3P08A 4YO4A 1LPUA 1T46A 4ZS0A 2I40A 3P0MA 2VWZA 5FP5A 4FE2A 3W10A 2YITA 2G1TA 5BVEA 3BI0A 4MD7E 4FTQA 3HKOA 4FZ7A 4IXPA 2RFNA 4F7NA 4TWPA 5K4IA 4BI1A 5M4FA 3E62A 3FQSA 1M7QA 4ZLYA 3W0SA 3DK6A 4FRFA 4QMWA 5CEMA 4FEVA 3OP5A 3RTPA 4HGTA 5FD2A 3S00A 3FMMA 5JGBA 4K18A 4O2ZA 4EH4A 1SZMA 3EQCA 4I6HA 4LFIA 2O2UA 5L6WL 2XPLA 4AXEA 3KCKA 4OTIA 4V0GA 4DTBA 4CLIA 5E92A 4KUJA 2B4SB 4AW2A 3E7OA 3I7BA 4C3FA 4U45A 4H1MA 2XCKA 3D9VA 4I0RA 3N9XA 3RGFA 3S1HA 3RM6A 3G5DA 3R9RA 3FAAA 4ZEGA 4X2JA 4DBNA 5CXHA 2RIOA 4FTKA 1XBBA 2HXLA 2OG8A 3O8PA 3SW7A 3F9KC 4BDFA 3CGOA 4FL1A 4MNFA 4ONAA 2X0PA 3MB7A 5EM8A 3UZPA 2WHBA 3RBUA 1BMKA 2Y4IC 2ZM3A 3OY1A 4QYHA 4XRLA 4ACHA 4FV6A 3EZRA 3UIMA 4BDKA 4E4XA 3OOGA 1KV2A 3BRBA 4UXQA 4CKJA 1GIIA 3QXPA 4BWXA 5DR2A 2J5EA 3O23A 4ZTRA 3PE2A 3OVVA 2UW5A 4JBOA 4YHTA 1TQIA 4IWOA 3Q5ZA 3G15A 4UALA 3R02A 3GBZA 4I22A 5LWNA 4WG3A 5EQYA 4JDIA 3S0OA 3FY2A 2XKFA 3VBVA 1ZZLA 2VU3A 4NJ3A 4CG9A 3KL8A 3THBA 5CY3A 3NNXA 1DAWA 2WMBA 2WTVA 3QTZA 4Z7HA 4GEOA 2BHEA 4C02A 1CKIA 4ANMA 2JFMA 2YIQA 5DEYA 3UJGA 4M84A 3LFSA 2EXEA 4KRCA 4F9WA 2C5VA 3GP0A 4G16A 4EQMA 2XPNA 4OC2A 2PK9A 2GNFA 2IJMA 4FIEA 5A4TA 1QPEA 1XH5A 3HEGA 4D1XA 3WBLA 4E6DA 2YLEA 5L2TA 3UMWA 4GG5A 4LOQA 3UVRA 1VEBA 3DLSA 2FVDA 3KFAA 4E8AA 3F3ZA 3N4UA 2XNMA 4I0TA 3SOCA 5ETIA 3UYTA 4BPUB 4MXAA 4O0WA 1P2AA 3BPRA 3BX5A 3D4QA 1SVEA 2WTKB 3A4OX 3L9MA 4TN6A 5D11A 4EORA 4O86A 2NO3A 2R0IA 3W0NA 2R7BA 5HVKA 4FTLA 1FBNA 5AP1A 1JQHA 1Y8YA 3ZRKA 3BLRA 2A0CX 4FIJA 3RHKA 5JZJA 3NFQA 3S9LA 3PP1A 3U6HA 4TNBA 1YRPA 4CYJA 3LLTA 3CTHA 1ZMVA 3CTJA 4BC6A 5C4KA 5J5TA 1H27A 3DTWA 5EM5A 4BR3A 3DA6A 3SC1A 2JDRA 4TYJA 2BALA 2BDJA 2XZSA 3AC4A 4I1ZA 2X4FA 5AUUA 3TEIA 5AV4A 4AOJA 2R2PA 3GCVA 2PZ5A 2CKOA 4KS7A 3DXNA 4P4DA 3FLQA 3KN5A 3RAKA 4F6UA 2QKWB 3GU5A 3TNQB 2NP8A 2J0MB 5E8ZA 4ZSJA 4C8BA 1GOLA 2DWBA 5HEZA 3PXRA 5CSHA 4ZTLA 1ZRZA 4EH3A 1ZMUA 2WU6A 2OXYA 3I4BA 4MUQA 2Q0BA 3O50A 4IX5A 5HU3A 3HL7A 4DFLA 1CKPA 2UVXA 5I3OA 3UPXA 5BVFA 3VS1A 4J97A 3TACA 2W1DA 3KEXA 4FV4A 5EKNA 5JKGA 3H9FA 3LFNA 4HJOA 4JAJA 5KZ0A 2Y1MA 5H9BA 5ACBC 5J7HA 4RZWA 3OB2B 4U81A 2V5QA 2UW3A 3QXOA 3TIZA 4XG4A 5BV3A 3OW3A 4B9DA 5EH0A 2BDFA 4FGRA 4LUEA 3LFAA 3ZLXA 2XEFA 3FJQE 3F3TA 1Z57A 5JFXA 4QP8A 2QLQA 3OMVA 2WQOA 4JR3A 5EKOA 3E63A 2NYAA 4XEYA 1WBPA 2HZNA 4FV2A 4PY1A 4HGSA 4PDSA 2R3IA 5EOBA 3ROYA 3S3IA 5J1VA 4FK3A 1WVXA 1ZOGA 4IDTA 4AFEA 3QAME 4ALWA 4DEIA 4DG0E 5HX6A 5CEQA 2PUNA 2YCFA 3NRMA 3C4FA 1J3HA 2W9FB 4PX6A 4AZFA 5JQ8A 4HVSA 4RG0A 4LV8A 3ZHPC 4YP8A 4S2ZA 3BYSA 2BRGA 2XYUA 4HYUA 3OCSA 4E73A 4UYAA 4ASZA 4O96A 3BWFA 4MNEB 3NNWA 3SVVA 2Y0AA 2HYYA 3FUPA 2W1CA 3NDMA 4YZ9A 2ZMCA 3MV5A 4BCKA 4FK6A 4AX8A 2BRMA 2ITZA 3V6RA 3BUMB 5BVDA 4P4JA 3E8EA 4BIEA 4FTCA 3D7TB 5LJJA 4EOIA 4KKHA 3DFAA 3BUOB 4C58A 2W5HA 4FKIA 2OICA 3MSSA 5K9IA 4QP2A 4ZTNA 1W8CA 4AN2A 3EKNA 2R3MA 3KRWA 3UBDA 1PXKA 3C5UA 3QQHA 2JEDA 4FGBA 5IMXA 5ETAA 4CTBA 5IEXA 5CSWA 4YJSA 3VW8A 1L3RE 4RJ7A 4AE6A 2J7TA 3NR9A 3PE1A 4ID7A 4BL1A 3D7DA 3ZMMA 5BY0A 3ROCA 2CLQA 1JSTA 4UZHA 3HPHE 4FC0A 3QLGA 1PRYA 1YOJA 4YJRA 2BAKA 3FDNA 4NZWB 5A4CA 5ANGA 2OJ9A 1MRUA 4EONA 4J53A 3K5VA 3VC4A 4GV1A 3B8QA 3P1AA 4ZK5A 3RWQA 5C8NA 5KHWA 4ZY6A 3AD5A 4KABA 1E9HA 4IEBA 4CYIA 3QYZA 5CZIA 4EQCA 3AC1A 4M69B 4UMUA 4FJVA 4ZMFA 4K1BA 3CPCA 3IW4A 4W9XA 4G34A 1KV1A 2GS6A 2WXVA 3B2TA 5ANEA 3DBDA 4OT6A 4RFMA 5AR2A 5L3AA 4NCTC 2OJFE 1JOWB 2GPHA 4ZZNA 3DCVA 4RWLA 3VRPA 2BZKB 1AGWA 4OTFA 2C6PA 4X2NA 1BUHA 2W7XA 3MY5A 2J0JA 2YZLA 5M56A 2R3HA 3I0OA 4DHZA 4BCHA 3ANQA 5HCYA 3DXPA 3AC5A 2WIPA 3BQCA 1PW2A 2OH0E 4CCUA 2FGIA 3WE8A 1SVGA 4RIWB 2A2AA 3ML1A 5M08A 4WO5A 4KSPA 5AUYA 1HCLA 3VUMA 3NFGB 1BL6A 2VX1A 2DQ7X 3Q4UA 2FUMA 4NKSA 5D9HA 5CXZA 4G5PA 4DGNA 3HV5A 3PWYA 1QPCA 4EH2A 1F0QA 4WRSA 5DT0A 3KU2A 1VZOA 3DBCA 1PY5A 3ULZA 1W0XC 5KHXA 4P4EA 2XNGA 4JQ7A 3JYAA 4IANA 5H8EA 2ZFYA 4FTTA 2H8HA 4HPUE 4WRGA 4NM3A 2QU6A 5M09A 4GFMA 4YZMA 4S32A 5DOSA 1SVHA 4Y5HA 4W9WA 2C68A 3DBFA 4TYGA 3E3PA 3FZRA 1Q5KA 1M14A 4JG7A 4UWYA 5HNGA 4JQ8A 3VUHA 2GFSA 3O7LB 3KF4A 2C3IB 3MPAA 3PA3A 3N51A 2YFXA 2YM5A 3R9DA 4NCTA 4Y85A 3ZUUA 3RCDA 2E9NA 3K2LA 2BHHA 3R21A 3QQJA 5AV2A 3PXYA 5DPVA 4B4LA 5JK3A 1YDTE 2X6DA 3BELA 4PMTA 1UNLA 4QPAA 3NNVA 3OROA 5AIKA 2WAJA 2X1NA 4FTOA 5CNOA 3AT2A 4GK3A 3R28A 4GFGA 3TNPC 4AZTA 5AUTA 2XARA 2QR8A 5EYCA 3EQIA 1PMVA 2R3JA 3BYOA 3HRCA 1X8BA 2RL5A 5C9CA 3PVBA 2XNBA 3LE6A 3VNTA 5I9ZA 3ITZA 3VRQA 4DFUA 5DIAA 4BIDA 2FA2A 4KSQA 2CN8A 1UKHA 3AD6A 3S95A 3MTFA 4ACDA 4N6ZA 4XV3A 2I1MA 5IA3A 2C6DA 1YHSA 4G17A 3UP7A 5C1QB 4MYGA 4FKOA 2VO3A 3HP5A 4L01A 4QMLA 4S30A 4FZFB 3TNHA 3NX8A 4W8EA 3W2OA 1E1XA 2PHKA 5IUGA 2PZRA 4YO6A 3TN8A 4JAIA 4ITJA 4ARKA 4BBEA 4D28A 1OIYA 4MBIA 2Y8OA 4PWNA 5CU2A 3UO4A 3HV6A 4EWHA 5IQDA 5IF1A 1XMMA 4RLLA 1BKXA 4YNEA 4MXXA 5HICA 2IF8A 1MP8A 4CEGA 4E6QA 5F4NA 1NVQA 2ERZE 3BHVA 2ZVAA 3MIYA 3QRTA 4M67A 4K33A 4O7TA 4D4RA 3ZDUA 3KA0A 4M14A 3LAUA 4LM5A 3D2IA 3LHJA 2X0OA 4HYIA 2VWVA 1H07A 4PP9A 5M4CA 2YABA 2YAAA 3ENHA 4AZVA 4C3RA 3Q9ZA 3D5VA 4MCRA 1RJBA 3IDPA 4AAYA 4IZ7A 3ZSGA 4A9TA 4OTRA 2X8DA 1B38A 4G31A 4MKCA 3HA8A 2PZYA 4I5HA 5EHYA 3NYVA 5A6OA 4NGMA 3AT3A 2F7XE 3II5A 4FVQA 3ZO4A 3GGFA 3WF5A 3QRUA 2P33A 4ALUA 2HAKA 4BDIA 4J99A 4F0GA 5L2IA 3VW6A 2EXMA 2UW7A 1YWNA 3BV2A 3CKWA 4EKLA 2ITWA 3MESA 5D7AA 3VUKA 3D0EA 4ANNA 5HG9A 5AR3A 4L00A 5IDPA 4UWCA 4UBAA 4CMTA 2XF0A 3GCUA 3ACJA 5D41A 5JZNA 1XH4A 3FHRA 5LMKC 1OL6A 4GRBA 3EL8A 3MI9A 5CLPA 5HLPA 4F09A 4U80A 3COKA 4ALVA 1JBPE 5HD7A 2VAGA 3G9NA 5I9VA 4WUAA 5CAUA 4D0WA 3KRJA 1TKIA 3NLBA 3DZOA 2C6TA 3EIDA 2XBJA 4FT0A 3WF8A 2JLDA 4V01A 5CT0A 4FI1A 5LVPA 1L8TA 2X7OA 2QOLA 2VTIA 2OZAB 4DTKA 3GC9A 1K9AA 1PXLA 3GT8A 5EK7A 2ITUA 3QC9A 3ZCLA 2QHNA 4UV0A 3QFVA 4TL0A 4EH5A 1QMZA 4D2VA 4J71A 4X3FA 3QUEA 3R8LA 5IPJA 4ACMA 5EDPA 3DNDA 4W9YA 2JIUA 3MH1A 1SMHA 2WIHA 4BJJB 3PY3A 5HIBA 4DGOA 2FSLX 1UVRA 4UZDA 2B9IA 4YLLA 3PIZA 4FNZA 2YJRA 3UP2A 4CRSA 3SW4A 4TYHB 4R5YA 1Q24A 2QR7A 4YJTA 5I3RA 3KXXA 2ITTA 3NCGA 2XK3A 2B9HA 3BU5A 4G6OA 4QMOA 3R8ZA 3ZH8A 4E5WA 3PA4A 5DT4A 3OWPA 3FWQA 4IC7A 4D9TA 5CALA 4DTAA 4FL3A 1Q61A 2UW4A 2XK8A 3ZRMA 1G8SA 4E26A 4ENXA 2PL0A 4G3FA 4BF2A 3NUSA 4XBRA 5H2UA 4I0SA 5JH6A 1OVEA 2Q83A 2B7AA 3KMMA 1GZOA 2ESMA 4FSYA 4HYHA 4Y95A 2Y4PA 5LVLA 3PFVA 2YM8A 3PVWA 4EI4A 1MQ4A 3UOJA 3DGKA 4TTHB 2IPXA 4BDCA 4YBKA 1PXPA 2UZLA 2VTRA 4RC2A 1IRKA 4FSNA 3U88C 2FSMX 1AQ1A 3UYSA 4NSTA 1DAYA 4F1TA 1MUOA 4MCQA 4F9YA 1V0PA 3C13A 1XBCA 2OO8X 3LCTA 3SAYA 3L9PA 5FXSA 1KE7A 2XRUA 4IAYA 3KVWA 3TIYA 2QC6A 2QOOA 4NT4A 1TFFA 4YU2A 3E8CA 3CLYA 1JLUE 2YLFA 5IUHA 1KE8A 2DUVA 3H3CA 5D7VA 5DE2A 3UQGA 4BDGA 2IZRA 5HIEA 4L7SA 4ZTMA 4CCBA 4IACA 3F88A 4KS8A 2GNIA 2VTAA 3WYXA 4AOIA 3MS9A 4QP4A 4I93A 4JDJA 4XX9A 3RPRA 4HPTE 3VBWA 2I0VA 3TV4A 3PIYA 2AC3A 3KB7A 4M7IA 3HYHA 3VQHA 4GT3A 3BUNB 5FTQA 4NL0A 4DITA 4OLIA 5FRIA 3SJGA 4FIFA 4XS2A 4MQ2A 2WQBA 5KNJA 4DDIA 3BYMA 4EOLA 5JMSA 4IAKA 2CPKE 2Y6MA 1H28A 4B6LA 2QHMA 4QEBA 4OTPA 5FTOA 5TOZA 1URWA 3ZOSA 3DT1A 4BZNA 4EK4A 3RNIA 4CVAA 1OL5A 3FV8A 2V62A 1OUKA 3MJ1A 4CFNA 4KIPA 3HP2A 3EWHA 3OF0A 3LFQA 4XMOA 4WSYA 1OB3A 3Q53A 4QP3A 2EB2A 3Q96A 5F95A 3ORNA 2YDKA 5E8UA 4IFCA 3ZFXA 4DAWA 4GJ3A 3S9MA 5DRBA 3FC2A 5AR7A 5JT2A 5GHVA 2LGCA 1WBWA 1WBSA 3MJ2A 1T45A 3V8TA 2Z7LA 4DH8A 4AUAA 5AWMA 2PVWA 4C61A 2X7GA 3ZONA 4O1OA 1A48A 3HMNA 1G8JA 4CGAA 1JSUA 3F2NA 4F6WA 5KMNA 4YJOA 1SYKA 4L9IA 5K0KA 4XG6A 3QTUA 2A98A 4BKYA 2FYSA 4KA3A 3IQ7A 4QMZA 4A4XA 1RQQA 1PYEA 4C4EA 3TWJA 1KE6A 2JDVA 3R9OA 5CYIA 5E8XA 4AF3A 1OGYA 3P5JC 4AZSA 1W2DA 4DFNA 4RR2B 5DR6A 1PMEA 2VKZG 5CAOA 2YIRA 4Z9LA 2B54A 2R0UA 3FC1X 3KGAA 3P23A 4CFVA 4EH6A 2VTLA 3LM5A 5J9ZA 2IVTA 5M4UA 3UDSA 3EFLA 2UUEA 3FMNA 1ZOEA 3C4WA 2CMWA 3RP9A 3VWAA 4FKLA 2IWIA 1SM2A 4QNYA 4P4FA 3KVXA 1DI8A 5HVYA 5I0BA 4ANOA 5EDRA 3QCXA 3QZGA 4FSQA 3QTXA 4EHEA 1Q8UA 3I60A 3BIZA 4YHJA 4C59A 3W2SA 4CMUA 3BZ3A 3MTLA 3BE2A 4OTGA 4R78A 3VIDA 3WOWA 4LGDA 3R83A 4O84A 4DHJA 1FVVA 2GNHA 3C4EA 5K5XA 3AKKA 4RT7A 2WKMA 3U9CA 2XIKA 5ANKA 4JMQA 2P55A 3RHXA 3UIUA 2W9ZB 2QKRA 1W84A 4M13A 5KO1A 4QP9A 4YHFA 2CGXA 2F2UA 3BLHA 5KMJA 3IWWA 5EHOA 2PUPA 4ZTQA 4U5JA 4BCGA 3COHA 3R04A 3C0IA 5JFWA 4JRNA 2YM7A 4IJPA 2XNEA 4JR7A 4C4FA 4KKEA 5I9UA 2XIZA 4QYEA 4AN9A 2FSOX 1OPKA 1GZNA 3BCEA 3D7ZA 2Y6OA 3EFKA 5KMIA 3V3VA 4TY1A 5BPYA 4BCFA 5CWZA 2OJJA 5CI7A 4DN5A 3SXRA 4KBAA 4O0XA 2X9EA 3L8PA 4L45A 2REIA 3GVUA 4FIIA 1O6KA 4M0YA 2JAMA 1Q8YA 3ULIA 3BGQA 5L2QA 3V5WA 4DDGA 5LOHA 3BU6A 4FZDB 5FBOA 3MH3A 2OIBA 3GXLA 2XCHA 4Y83A 4D2PA 2FB8A 4GU6A 4EH8A 2HW6A 4DT8A 1XBAA 2V22A 3EYHA 4EOOA 4YJUA 4NW6A 3GI3A 4QT1A 1XHAA 2A27A 3PJ2A 2B1PA 3NUPA 3SGCA 3VN9A 5B7VA 2WQMA 4EEVA 5T68A 4FSZA 4P44A 4MQ1A 3QZHA 2YDJA 3IDCA 4CD0A 2P3GX 5DI1A 3BHXA 2WMTA 1BX6A 5BVNA 3VRRA 3GENA 3TNIA 5E8TA 3F7ZA 4TNDA 4QTCA 4B0GA 3A4PA 5B2LA 5ACKA 5A4LA 3F3WA 1W2CA 3PDTA 4D5HA 4HYSA 1ZZ2A 4RJ5A 5DYJA 2W1IA 3IONA 3EQHA 3IW7A 3LXLA 3ZC6A 5IH5A 5M51A 2BKZA 2ITQA 2JD5A 3GCSA 3ZNIA 3RAHA 5AIRA 3MDYA 5J1WA 3PFYA 1Q3DA 3ERKA 2HXQA 4NTTA 4LQMA 5D29A 1YXXA 3PY1A 5HLNA 4A9YA 1PXNA 2BRBA 4RBLA 2AUHA 3BHTA 4ERWA 2JC6A 2JKOA 4JVGA 4OC0A 3FL4A 4QMYA 2W0JA 1ZWSA 3V8WA 3NYXA 5GINE 3NNUA 4MD9E 4C3PA 3TKHA 4EOKA 5J9YA 3DXQA 2XEIA 4LRKA 1NY3A 3LQ5A 3F5XA 4FYNA 2ITVA 4O4DA 2XANA 2O5KA 4C7TA 3N4TA 4N0SA 4WBBB 3VS2A 2C6OA 4P4IA 4FG9A 1FGKA 4PMPA 1A9UA 4ZTSA 3UQCA 3LLAA 4CFUA 4N70A 2OJIA 2QCSA 3KXZA 4NGSA 4OC4A 3LQ3A 2JIVA 2XEZA 2C6IA 4RWIA 4CQGA 2JBKA 3TL8A 3HRFA 2J2IB 4L3LA 3D7GA 2YIWA 4AT5A 2OFUA 2PVMA 2W1FA 4AZEA 4C57A 3FZTA 2XUUA 2ZJWA 4FKTA 4JNWA 4C4JA 2XP2A 5HE3A 1MRVA 3BGPA 3Q52A 4EWQA 3BLAA 1RW8A 2CGVA 2ETKA 2HOGA 2YERA 5CT7A 3TCPA 2ZV2A 4ZZOA 4NGTA 3E7VA 3B8RA 2VX0A 3OTUA 5D10A 3R8UA 4CV9A 3L1SA 3R30A 4JG8A 3PXFA 4NUSA 3RBWA 4IW0A 5HG7A 3RNYA 3TDWA 3ZDIA 2YEXA 5F20A 3WILA 4QTEA 5HTCA 5FDXA 2UW8A 4S31A 3WIGA 4ZAUA 4HVHA 5AEPA 5IQEA 2PMOX 2B55A 1H1RA 4BCIA 3CBLA 3DAJA 4ASEA 1F5QA 4DA5A 3I6UA 4QTBA 4ENYA 4OTQA 3L8VA 5AR5A 2B52A 5FM3A 2PPQA 1Y6AA 3LVPA 4CNHA 4F9BA 4O21A 3BGZA 5K5NA 1GZKA 4YMJA 4F78A 3R01A 3MYGA 4MK0A 3A61A 4IWQA 2CIJA 1DS5A 4J1RA 4J52A 3NAYA 2WMUA 5DA3A 5JQ5A 3ID6C 4YLKA 1GIJA 1XJDA 2B4JC 3WE4A 3FPQA 5A9UA 4GG7A 3PJ3A 5M4IA 3O5AA 1O6LA 4E6CA 2C3JA 4EYJA 5HQ0A 1NVSA 1YOMA 4O7LA 1OECA 4FKQA 2YA9A 5CVFA 1I09A 3UOLA 4FTNA 2HY81 2WTCA 4CZYB 4YTCA 2YM6A 5BYZA 3LMGA 4RFZA 4AGDA 3KULB 1H1WA 3QBNA 4EK3A 2YN8A 5BVOA 3LKMA 3BV3A 1BL7A 2UZEA 4MH7A 4OC5A 3D5XA 3NUYA 5HZNA 5DG5A 1XKKA 2UZNA 3QTIA 4QP1A 3F6XA 2W17A 3PVUA 4A07A 4AT3A 2R3QA 4JBVA 3P79A 3BUXB 3ODYX 5J79A 5K4JA 5GJGA 4W8DA 2X81A 5AMNA 4GPLB 3HA6A 4YC8A 4HCVA 4BWKA 2BZIB 4EH7A 4H58A 4ANSA 2GQSA 4K9YA 2JBJA 4X2GA 2ZM1A 3UGCA 5BVKA 5I9YA 4MCPA 4D4SA 4ZZMA 2WQNA 4O0TA 1YWRA 4YZNA 1OKYA 4E4LA 2W4OA 3I5ZA 3NZ0A 3FMKA 1Q8TA 4JBPA 3GC7A 5DR9A 3FLNC 4S33A 3UVQA 4DGLC 3MVLA 5HO8A 3AQVA 2C4GA 4AE9A 3CIKA 5ANIA 4XG3A 2CNUA 5D12A 5EYKA 4MX9A 2NPQA 2RFEA 5CQWA 4BB4A 4FA2A 4IVBA 2RSVA 3U6JA 3DJ5A 1J1BA 3RMFA 2FO0A 1H0WA 3QUPA 4C36A 3REPA 3Q9XA 3FHIA 3ZEPA 5HE0A 3C9WA 4LYNA 4D2TA 3N4VA 5IQHA 4FNWA 4M15A 5CU3A 2PVNA 2FH9A 2QNJA 3CC6A 4FV9A 4U6RA 5IA5A 4ANQA 4UN0C 4GK4A 4H3QA 3FKNA 1ZMWA 2R3RA 3ORIA 2VO6A 4IAZA 4IAAA 5G6VA 3A8WA 1OIUA 2ZMDA 2G01A 2GNJA 3QQGA 1VJYA 4AA4A 3LPBA 1DM2A 4W4XA 5KE0A 4U8ZA 3SRVA 2CKEA 2HENA 1J7IA 4IWDA 5CU0A 1ZYSA 1U4DA 3GFWA 2GFCA 4ZTHA 4LGHA 4JX7A 3KQ7A 2UW0A 3M2WA 3UIBA 2BUJA 5A46A 4MHAA 4IB0A 4OTDA 3ODZX 2Z8CA 4I6QA 4KKGA 3RWPA 3CS9A 4GT5A 2BTSA 1Y8GA 3IGOA 3KK9A 4F7LA 2J5FA 2PVLA 3FLSA 4UMRA 4IM0A 2Z60A 3UDZA 2XAOA 2J6MA 4WG4A 4IQ6A 4USFA 4DFYA 4UEUA 3FI4A 1FPUA 4AOTA 2XH5A 2WOUA 1H24A 3TKUA 1OKWA 1YI4A 1ZOHA 4FKPA 4LV5A 4AGWA 4ASXA 4XCUA 1U5QA 3U9NA 1IA8A 3DKCA 3QU0A 1PKGA 4K6ZA 4FKRA 4HZSA 3HUBA 1LEWA 3I7CA 4TWCA 5HHWA 1M7NA 4N6YA 1WJTA 3OAKA 1GZ8A 2QQ7A 4DG3E 5LVMA 3R1SA 4X3FC 1R3CA 1V1KA 2I6LA 5HLWA 2GQRA 5BNJA 4UB7A 4BPWB 1OKZA 2XS0A 3R00A 5BUJA 3DFCB 2XMYA 4G9RA 3T3VA 5FEEA 4MXCA 3IO7A 1H00A 2W96B 2WEVA 4MTAA 3FXZA 5CANA 1WVWA 3BL7A 1M17A 3OOMA 3DPKA 5AUXA 5BUEA 4BBFA 3RALA 2ZYBA 4O22A 2XNNA 3GQIA 3MVJA 3O51A 5HGIA 4GU9A 4IX4A 4XV1A 4YPSA 4JOAA 3Q4CA 3OC1A 2XK7A 3CD3A 2VGOA 3UO5A 1IAJA 3M1SA 5EW9A 4IWPA 4AFJA 1OGUA 4BGHA 4J8MA 5E90A 5AV0A 3QX2A 5KCVA 2W1GA 5T3QA 2FSTX <