4BTFA

Structure of mlkl
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
454
structure length
413
Chain Sequence
DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFILFHEVNEKLRDVWEELLLLLQVPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTASSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Pseudokinase Mlkl Mediates Necroptosis Via a Molecular Switch Mechanism
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
molecule keywords MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
total genus 145
structure length 413
sequence length 454
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btfA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 4btfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btfA03
3NDMA 3KMMA 3I6WA 3F7ZA 5E91A 5TKDA 2JDSA 4I3ZA 5JFSA 4ZMFA 4ZZOA 3ZZWA 2XJ1A 5L3AA 4P7EA 5CS6A 1PMUA 2JITA 5LWNA 3QXPA 1LPUA 4FT3A 3D5VA 3NW6A 5I0BA 2WXVA 3UZTA 3ACKA 4PL4A 3RP9A 4C62A 4CYJA 4D2PA 3AG9A 3R1YA 2XNOA 2QR7A 3H10A 3SRVB 4C4HA 3OCGA 4FZFB 3BGZA 3CBLA 3PLFB 2GS2A 3EH9A 4J53A 1IASA 2V7OA 4FIGA 4YHFA 3K3IA 4S32A 3GGFA 3SQQA 3VBXA 3PVBA 1APME 2X6DA 5DH3A 5EHYA 5FXQA 2CGVA 2R3JA 3MFSA 4XYFA 4DGMA 3ORPA 4L8MA 5JQ5A 5I9UA 1OKVA 3RK5A 3F69A 2QD9A 4WA9A 1UU7A 2UZOA 3JXWA 5L2IA 3SW7A 3R7VA 3U6HA 3FLZA 5L2WA 4XG2A 3VS0A 2XNPA 5AMNA 2EXMA 3VUMA 4PPBA 1YXTA 4GS6A 1PJKA 1V1KA 4O1OA 2VTRA 3HV5A 1ZLTA 3QTUA 4K1BA 2YFXA 5CF5A 5D7VA 1MQ4A 3CGOA 4W9XA 4G3CA 3C9WA 3O7LB 5I4NA 5E8ZA 3FC2A 5CWZA 4HGLA 1KSWA 2R3GA 3MA3A 2ITTA 4EKKA 3S3IA 2I0YA 5HE1A 2AUHA 5ETCA 4GT5A 3CKWA 2A27A 5HG7A 3DZQA 2XBJA 4S31A 3Q9ZA 1BYGA 4FYOA 5L6WL 1BL7A 3PZHA 1H07A 3NX8A 5DT0A 4WUNA 2W96B 3UIXA 4PP7A 3UBDA 2W1HA 3LMHA 4NUSA 5AR4A 3REPA 3UOLA 2PVFA 2G1TA 3DNDA 3QBNA 1Q24A 4AZFA 4MBIA 3NZ0A 3D0EA 3HV7A 2BZHB 4IH8A 4IX3A 3TZ9A 2C69A 2W1IA 2BRBA 5KZ0A 5CQUA 3LM0A 1FPUA 3FKOA 2QLUA 5I9YA 3BGQA 3F3UA 2WHBA 4O2ZA 2WTCA 3MBLA 4IC8A 1OVEA 5F95A 4ARKA 4BDFA 2XIZA 4M12A 2XMYA 5CNOA 4HYSA 1KOAA 2C47A 4RLLA 4LGHA 1YQJA 4AQCA 2EU9A 4FZ7A 4CV9A 4O82A 3UMWA 4IDVA 4KD1A 4XRLA 2B52A 4MD8E 5EQYA 4ANNA 3A7HA 4DT9A 3O8UA 3Q53A 3WYYA 4BR3A 2Y9QA 2XNEA 3AC3A 1OPKA 4BY9E 3NVKI 3O0GA 3C0IA 4BIBA 2CPKE 2QOIA 1ZYJA 1JSVA 1ZYSA 3W2PA 1F0QA 3DDPA 4FTNA 1SMHA 4YJVA 3R8VA 4DCAA 3A8XA 2JFLA 3UODA 5CTPA 1BKXA 3CTHA 5CU0A 3P0MA 3TWJA 3V01A 3R7IA 2IG7A 1B6CB 4L7FA 4FV4A 4ZTRA 3HECA 5CEMA 3MPAA 4EJNA 4K18A 5LWMA 4IWQA 3PFVA 4QMWA 3JVRA 5EM5A 4RJ3A 4XNEA 3R83A 4FK6A 4IB0A 4CEGA 4FTAA 4GG7A 4FTTA 1PMEA 3RAHA 3RM7A 2ESMA 3VVHA 4JRNA 4YP8A 4C4FA 5EHOA 4E93A 3ITZA 5E7RA 4D2WA 4YR8A 4W9WA 3JS2A 4LMNA 3MB6A 2O5KA 2QR8A 3LCTA 3SGCA 2IVUA 2VWXA 4AACA 4QQTA 2WAJA 1PXKA 4NU1A 3VRYA 4CFWA 2GQSA 4JG7A 4UB7A 5JEBA 3GVUA 4P5ZA 3GC8A 4O86A 2VU3A 4Z55A 5LMBA 3PWDA 4BBMA 4E5BA 5M51A 3PSCA 5LMAA 2BRHA 3Q4ZA 1GIIA 2OJGA 2A0CX 4BDBA 5K9IA 1BI8A 1Q62A 5CXZA 4D0WA 4C4IA 2Y1NA 4E73A 2C0IA 3Q32A 4DH7A 3OB2B 2C6OA 3NW5A 1MRVA 3VBWA 4EUUA 5EI2A 5HKWA 4AZTA 4RA4A 2BKKA 3VUDA 2JDVA 2PVJA 4JQ8A 2UW7A 3AT3A 1P4OA 4MQ1A 4ZXTA 2VTIA 3Q60A 3FE3A 4QO9A 4RIOA 1GJOA 3NAYA 4F7JA 3KKVA 3QKMA 3WI6A 4IC7A 5DEWA 1MUOA 4H3PA 4PY1A 3R22A 3DTCA 3AT4A 5F1ZA 5E8SA 3V51A 4UYAA 3MV5A 4RC2A 5CF6A 3RINA 1OL2A 5DBXA 2R3MA 4KBAA 2XKEA 2YA9A 4LMUA 3CQUA 4BTFA 4DH3A 4W4YA 2BRNA 1WBOA 2G9XA 4HOKA 4I6HA 4DEDA 4X7QA 3GXLA 4A06A 2R3LA 3BLQA 3AXWA 5IU2A 4U41A 2WTKB 4PP9A 3E92A 1ZRZA 4QQCA 4GT3A 3EQFA 1YXXA 2PVHA 4G16A 4NIFA 4QRCA 4OTIA 5A9UA 2RG5A 4KKEA 3QTWA 3QCXA 4GK2A 4U97A 4DEGA 4EWHA 4BWKA 3PVUA 3AD6A 3WIKA 4XG8A 3NW7A 1QL6A 1W84A 4UBAA 4R6VA 3FSFA 4PUZA 1R78A 1WCCA 2WU7A 1SZMA 2QOCA 3GCUA 3KXNA 4JG8A 2Z8CA 3UGCA 4BDHA 4DE4A 3EHAA 5BVKA 1LR4A 4I5PA 2EUFB 2P2HA 3D9VA 3HV6A 4J95A 1GZOA 1JSUA 4IFCA 4A7CA 4MEDA 5FD2A 1OL7A 4TYHB 4E6QA 3W2OA 4MK0A 2DS1A 3VBTA 2YLEA 2C0OA 3LW0A 4DEHA 2XUUA 3SV0A 2QVSE 2W5HA 2QOBA 3KMUA 2RFEA 4PMTA 2F49A 2ITVA 2R3IA 2RFDA 2XNBA 3OBJA 3SOCA 3MIYA 4LUEA 3WZDA 5B2LA 1F3MC 1ZOHA 3CP9A 4FSYA 2O2UA 2DQ7X 4U43A 5KCVA 2B9IA 1ND4A 1KOBA 4N0SA 3HV4A 4IWOA 3KULB 3E8DA 2QG7A 5M08A 1J7LA 4QMMA 3QTQA 1M2QA 5FGKA 2IZRA 4NIFB 3AD4A 1YXSA 5M07A 4PQNA 2ZDTA 3EZVA 4ZSLA 3HMOA 2DWBA 3DK3A 2C0TA 3L8PA 4BI2A 3MVJA 2PE1A 5CNNA 2XNNA 4XEYA 5AUUA 3LXKA 4JDIA 4AE6A 3T9TA 5DI1A 3VS2A 3LLTA 4QYFA 3Q6UA 4C4JA 4F7NA 3GQLA 4ZJJA 3FMKA 4UMPA 3UIUA 4ZY4A 5GHVA 2RKUA 1JKKA 4I24A 4FV1A 4UY9A 4ZAUA 4KINA 1V0OA 2Z2WA 3RBWA 1OUYA 1F5QA 4FF8A 3BEGA 4BTJA 2W1FA 3GFEA 3O2MA 3FBVA 1JAMA 1ZARA 1SVGA 4UWCA 5FTOA 2I0HA 2B55A 4ITHA 3PRFA 4KSQA 4I5HA 4XLIA 1UV5A 3BHHA 3S95A 5F4NA 4ANOA 4D9TA 4FGBA 4EHZA 3CKXA 3G51A 2WO6A 3HV3A 3W10A 4DCEA 3QQFA 2W5BA 3JVSA 4YJNA 2F4JA 5KHXA 1O6KA 3MY5A 1DM2A 3BYVA 4MHAA 4TYHA 5AUYA 3RVGA 1W7HA 3HP5A 2Y4IC 3ZUVA 4ASEA 4FSWA 4L7SA 3EQPA 1NY3A 3ORTA 3FLYA 2R4BA 2UW9A 5IA0A 4KRDA 5KMKA 2C5VA 4OTDA 1XBBA 2J4ZA 4L01A 3H9OA 3KY2A 4DGLC 5JQ8A 4GUBA 4PPCA 5A6NA 2HIWA 3KCFA 3F2NA 1UU9A 3BELA 1G5SA 3R1SA 3W2SA 3CLYA 3GUBA 4W4XA 3BHYA 4FSUA 4BCPA 1P4FA 3FMHA 3V04A 4E7WA 4IM3A 4DEAA 4C33A 1Q3DA 2ITYA 5ANGA 3RCJA 3THBA 4FZAB 5CI6A 5HLPA 1P5EA 4EOOA 4JAIA 4A4CA 2XH5A 4TZRA 5DT3A 4J52A 1ZWSA 1KE8A 5EYCA 4BZDA 1XH9A 4LOQA 4FTCA 3CQWA 4MXCA 4BCIA 4EONA 4ACDA 1UU8A 4O96A 4R7HA 4YU2A 3IONA 4YHJA 4RWJA 5DR2A 4ZTHA 1PY5A 3ZFXA 2ZOQA 1MRYA 4FKTA 2ACXA 5CXHA 4AA4A 3UNZA 4UX9A 4ZS0A 2YCQA 4FNXA 1Q4LA 3O51A 5C01A 2WEVA 3QYZA 3H9RA 4FG7A 4FZ6A 3VRQA 2YWVA 1LP4A 1HOWA 4LL0A 4J71A 2W17A 4F7SA 1WVYA 5AA8A 4QPAA 5IH6A 3QZGA 4AG8A 4I0RA 5E8UA 4GRBA 3DLSA 4QP4A 4F65A 2OXXA 4BCNA 4CKJA 4BDJA 4TY1A 4BDKA 3VQUA 4EI4A 2J9MA 4JX7A 3D94A 1FMKA 5IH5A 3R7UA 5H3QA 2JKQA 4OUCA 2X6EA 5T68A 4ACHA 1Y57A 4C4GA 2ITXA 2WTJA 3S1HA 3HKOA 4I21A 5CANA 4DF3A 3FYJX 1LEZA 5IA3A 2GNLA 2W05A 2X39A 4FI1A 4ZSGA 3WILA 4FKGA 5L8LA 4UZHA 4CFNA 5HOAA 4O27B 2WKMA 4HPTE 2VO7A 3POZA 2Q83A 5M44A 3IS5A 2AC3A 5DT4A 1IEPA 3C13A 2ZYBA 2XK9A 1Q41A 3RALA 1WBVA 3IOPA 4EOIA 1YRPA 2HZNA 4Y46A 5ETFA 3MWUA 5FUTA 2CLQA 3P08A 1WBTA 3IKAA 4IJ9A 2F7EE 3PYYA 4BDGA 4M3QA 1PW2A 2HW7A 5DG5A 3KN5A 4D1ZA 3TUCA 3SLSA 4FV7A 3UYTA 5D7AA 4YTCA 1KE7A 3KQ7A 3ORKA 4O7YA 2WOTA 3AC1A 1FOTA 3MH0A 1CDKA 3UG1A 3TKHA 4F64A 4RJ5A 3QTZA 1IRKA 3R00A 3V6RA 2J0IA 2IVSA 3JY9A 4EYJA 3EQBA 3PFQA 4JBOA 5HGIA 3OEFX 4F6UA 4OTGA 2BR1A 3MA6A 4Y73A 1UWHA 4DLJA 4N6ZA 4FIFA 4BVUA 4EH9A 4IWPA 4WNOA 3HYHA 5FM3A 3Q04A 1G8SA 2C30A 2GS7A 2WQNA 3ODZX 4IFGA 3DJ6A 4XS2A 1CSNA 2C4GA 3ANRA 3IK3A 3PY0A 3VO3A 4EZ5A 2WMTA 3AC2A 1YHVA 2WMBA 4FTMA 3PA5A 3RPRA 2JFMA 2EXCX 3QGYA 4PWNA 4U3YA 5M4UA 3CEKA 3VN9A 5J9LA 2YZLA 3CE3A 4ZK5A 4BF2A 2HZ0A 4RSSA 3W2QA 4B7TA 4MD9E 4OTWA 4NL0A 3R9HA 5DPVA 5JN2A 2PZYA 5BVDA 5H8EA 2CNVA 2Z02A 5IEVA 1URWA 4JQ7A 3D7TA 1STCE 4FC0A 3TIZA 2GS6A 3NNWA 4W4WA 4WBOA 3UDBA 3WARA 4C2VA 5JFWA 5AAEA 2YEXA 3K54A 2FA2A 4ID7A 4YJTA 4Q5HA 1XJDA 1I09A 2VTOA 4J1RA 4R7IA 2GU8A 2XIRA 2YISA 3LVPA 4GIIA 2PZIA 2QO2A 1NVRA 1XH4A 2UZDA 2W9FB 3G33A 1RDQE 3POOA 3R02A 4IB3A 5IMEA 4I6BA 2BIYA 3HP2A 3MPMA 2JKOA 3VF8A 4ENYA 2UW5A 1Q8ZA 3KRJA 4L44A 3PJ8A 4G6OA 4TNBA 4FVPA 5EG3A 3BUWB 5KMOA 1PMVA 2PULA 4JJRA 5AUXA 5KZIA 4NH1A 2O64A 2VTAA 3U8WA 4D28A 2XJ2A 3GU6A 2PUPA 2V55A 4LL5A 3UQCA 4H3QA 4PNKA 4DLIA 3NIZA 5CSWA 5D12A 5A46A 3NUXA 3SD0A 3O7LD 3BE9A 4TTHB 4EH4A 3RK7A 4R77A 4UMQA 5ACBC 3QA8A 2FSOX 4NKAA 4PL3A 2E9PA 1GZNA 3FLSA 3TTIA 4IQ6A 4QMTA 1ZMVA 3TJCA 1KE5A 3T9IA 1U5RA 3QC4A 1J7UA 1VZOA 1O6YA 3Q4UA 4QT1A 2PSQA 4TWCA 4EORA 3DCVA 3QFVA 3RNYA 3EZRA 1ZYCA 4O7TA 3F61A 1QPJA 1XO2B 2WMXA 4LYNA 3O23A 3W33A 1BLXA 4U81A 4W8EA 4YUQA 4QP2A 4WHZA 5JFXA 1WFCA 2ETMA 4QP6A 5AJQA 3VNTA 2OJ9A 4JR7A 4KKGA 2ZV7A 4C36A 3PJCA 3UVQA 2X2MA 4ALWA 2CSNA 2J50A 1UNHA 4BGGA 2WU6A 4MBLA 4XG9A 1H0WA 4KIKB 4MVFA 2BVAA 2QHNA 5E4HA 1OUKA 2PUNA 2BDWA 3MVMA 4D4RA 5FLFA 4FTRA 4QMYA 3BQCA 4TWNA 4X21A 2H8HA 3GU5A 3QZFA 1OKZA 4QQJA 5CEIA 2UW8A 4WIHA 2PWLA 2ITZA 2CNQA 4MXYA 5CZHA 4CT2A 2C3IB 3UOJA 4IMYA 2B4SB 4U80A 1DI9A 4WRSA 5J1WA 2R3FA 4HVGA 5EQPA 5BYLA 5GJFA 3BHTA 3SG8A 1J91A 5E92A 3QKLA 3PVWA 3WBLA 4MX9A 4G6NA 2R3QA 5GJDA 5BPYA 5JZJA 3VS6A 2X8DA 4C8BA 4F1TA 2X8IA 4AA5A 4FIEA 4BKYA 4ONAA 4TNDA 5IA1A 2VGOA 2RF9A 2CDZA 1IAHA 3S00A 5HBEA 5CALA 4ITJA 4Q9ZA 4KWPA 3VS1A 3QF9A 1B39A 4MXOA 4AFEA 2BDJA 4C0TA 3MPTA 4D1XA 4W8DA 1QCFA 1VYWA 5AA9A 4FIJA 2QC6A 3F88A 3Q5ZA 5F94A 4AT3A 4CMOA 5CAOA 5CSPA 4GEOA 5HHWA 2C3JA 1ZXEA 1OB3A 4RWKA 5BUEA 4QMLA 3W55A 4FT0A 3GU7A 4B9DA 2YJSA 3MB7A 2FO0A 3WF5A 2ITQA 5IQHA 3GNIB 4YLJA 3T3UA 5EW9A 5TE0A 5DEYA 3CY2A 4LRJA 2C5NA 2V5QA 2XRWA 3AQVA 4P90A 5E1SA 3U54A 4KS8A 3IO7A 3C4FA 2PMOX 3GC0A 2OJIA 4FK3A 1H1WA 5FWKK 4XV3A 1REJA 2QU6A 5A14A 2PZRA 2VRXA 5HKYA 5CT7A 3IDBA 2WIPA 4O7WA 5JK3A 4DEEA 2YABA 4YNOA 3N9XA 3FZRA 3ZLSA 1FVVA 3LJ1A 4BL1A 5HICA 5DR6A 3ENMA 3HDNA 3PIXA 5L6OA 2ZB1A 3QUEA 4OR5A 4B99A 3NUYA 5HCXA 4X6RA 4L3JA 3PRIA 4MWHA 3QD2B 2UVZA 3CC6A 1R0PA 2B1PA 2JAMA 4D1SA 4I6QA 3ZUTA 5KX8A 5EDQA 3TZMA 3H0ZA 5AIRA 4D4SA 4F9YA 2PZ5A 4FKSA 2PUIA 2Y0AA 2W1DA 3DDQA 2GHMA 3VS7A 4F08A 2WMRA 5T6KA 3I5NA 2V0DA 3FAAA 5A4CA 4RJ6A 1YDTE 5CT0A 3KRLA 3ZZEA 3EMGA 3CJGA 3IDCA 5HVKA 4CCUA 3KGAA 2YDKA 5EI8A 4HCTA 3RM6A 4DTBA 3UQFA 5M4IA 3EFKA 1Y6BA 1OPJA 2GMXA 2QKRA 3Q96A 3LHJA 5AM7A 1J1CA 5DOSA 1RJBA 3DKFA 3HRCA 3FLNC 1A48A 2XB7A 4ASDA 4EBWA 4L67A 4QMZA 5HCZA 2ONLA 2WZJA 1Q8TA 3BLHA 3HAMA 3TV4A 2J0KA 2H96A 1PKDA 1OL5A 4UWYA 4Y72A 4FSNA 2EB3A 1FGIA 3KL8A 4FSTA 2YAAA 2P3GX 3ZH8A 3DAKA 3V8TA 1G8AA 4ALUA 4NKSA 4JAJA 4F9WA 1PRYA 4XMOA 4RQKA 3VWAA 5DN3A 4XH6A 1Z5MA 3RPOA 2BAJA 3BZ3A 1VJYA 3R7EA 2XM9A 4FMQA 2B0QA 3UG2A 2PE2A 3ATSA 2CLXA 2UZNA 3M1SA 2IW9A 4GFOA 4BCGA 5IDPA 2GDOA 3QTSA 5TO8A 4ZY5A 2OIBA 2E9VA 4L43A 5CASA 3ZS5A 3RGFA 3L8XA 5AIKA 2ZVAA 4PTCA 3GCVA 4HYUA 5LOHA 1YXVA 2ITPA 4XCUA 4D4VA 1NVQA 4FV2A 5C8MA 4IW0A 4C58A 2J5FA 4BGQA 3BYMA 5FP5A 5KO1A 3R01A 1ZYLA 3TKIA 4DFXE 3MESA 2WEIA 4BDCA 2OK1A 5CVFA 5I3RA 3HLLA 1XR1A 4OGRA 2F7XE 2R3OA 1ATPE 2UZBA 3PE1A 3QL8A 4QMSA 2WOUA 1S9JA 2G15A 5J1VA 3BBWA 4H05A 4BFMA 2PVNA 4HVIA 4AZSA 3SW4A 4ANBA 4I4FA 1GIHA 2HCKA 3KF7A 3BQRA 2P0CA 4O7RA 4FOCA 5HBHA 4AOIA 2O63A 4YJSA 4AW2A 4FBXA 4IVBA 3RMFA 5K0KA 4CGAA 3G6GA 4GFGA 4YZBA 2FSLX 4B0GA 4CLJA 3VRZA 2VTHA 1XH7A 3EN5A 2CMWA 5EK7A 3OT8A 5KMLA 4FKIA 4MNEA 5DE2A 4JRVA 4B8LA 4CRLA 2VTSA 4M7IA 3MSSA 1OL6A 3BX5A 3OOGA 1PYEA 4IADA 4C35A 1GNGA 4QYYA 5CI7A 2CKEA 3CJFA 5EDPA 5IDNA 2WMAA 3A2CA 1I44A 4QYGA 3LLAA 1H8FA 4XP0A 2VO3A 5C8KA 4YZCA 3EL8A 5DNRA 3OWLA 3QKKA 2IWIA 4GW8A 3VW8A 3NVMB 2OJFE 4LV5A 4EOQA 2XM8A 4XV2A 5JKGA 2AC5A 4LOPA 4LV8A 1VEBA 4EK6A 3UMXA 2GNGA 4PTEA 4C37A 5BMSA 3AC4A 3PJ1A 3F5GA 3QHWA 1L8TA 4UMTA 2QOKA 4MF1A 2YAKA 5AP4A 3OWKA 3QRUA 5CAUA 4YTIA 1OIUA 3R1QA 1U54B 2YM6A 3UTOA 4I0SA 3MH1A 2YERA 2HK5A 3EN9A 3OMVA 4GU9A 2IW6A 2UZEA 3NYOA 4FICA 3VROA 2A2AA 1PXMA 1ZZ2A 4K8AA 3S2PA 4EC9A 3O8TA 4MF0A 3F2AA 2JD5A 5HNBA 3DBDA 1YI3A 1FMOE 4Q5EA 2VAGA 1OGUA 3A7FA 3PXZA 4FOBA 3PPZA 3G0FA 4IVAA 4HZRA 4QP3A 3B2TA 3A4PA 5DLSA 4ENXA 5HIEA 5JT2A 4A9RA 4KSPA 1CKPA 4BHNA 3FEGA 4RRVA 2OG8A 2X2KA 3OTUA 3MY0A 3QYWA 3R8LA 4R1YA 2OLCA 4B8MA 5HLNA 4CKRA 2E9UA 3O17A 4DT8A 3SG9A 3A62A 4BDAA 3OC1A 4EK8A 4TWOA 3P7BA 5GNKA 3VJNA 2PVYA 5GZ8A 3VUKA 4WUAA 4R3PA 4DINA 4E4MA 2FYSA 3EL7A 2C1AA 4XG4A 2XF0A 4C59A 1OL1A 1W82A 4KRCA 1YOLA 3ID6C 4MH7A 1H27A 3ULZA 3NLBA 3UC4A 3LAUA 1YOMA 4BCJA 2GTMA 1YHSA 3HDMA 1DS5A 4IX4A 3QX4A 3BKBA 4BBEA 4XP2A 2R7IA 3A99A 3HL7A 2VTMA 2P33A 3R7GA 5ETAA 3EN6A 3MJ2A 4FKOA 3ZO3A 4ANQA 4E6DA 5EQEA 4CKIA 2Z7RA 4MTAA 3FI3A 4XBUA 4ZY6A 3DLZA 3L9LA 4FSMA 1M2PA 3ALNA 3EQGA 3Q4TA 1LUFA 4F1OA 2YM4A 4G9RA 2QONA 3DZOA 3IW6A 2XVDA 1M7QA 4JI9A 4YBKA 4IIRA 4CZYB 4DH5A 3WE4A 3FXXA 2W4KA 4JVGA 4O7VA 3Q3BA 2QOFA 3G90X 4E20A 1XBCA 3D4QA 3D2IA 3EFJA 3GU4A 3LCOA 5DR9A 4ASXA 2UW6A 4Y5HA 2ZAZA 5IKWA 4KKHA 5DRBA 4ZTQA 3R2YA 4DH8A 4Q2AA 2HXLA 2VWVA 4L53A 3ORMA 3AC8A 3TXOA 4RVTA 3ZO1A 5LCJA 1U59A 4S2ZA 3KRRA 1URCA 5JGAA 1WBSA 3Q52A 4L9IA 4DFUA 3RAKA 3DQXA 3GP0A 2VTJA 3COMA 2VX3A 3LCSA 5JRQA 3TUDA 4FEQA 3BPRA 4FV8A 5M4CA 4YZ9A 4CFXA 4FA2A 2ONLC 3ORZA 3U55A 3AC5A 3OVVA 4PRJA 4KBKA 4E4LA 4IAAA 3DXQA 1M17A 2BALA 3LFDA 4OTRA 3P7AA 4DG3E 3PTGA 4IX6A 3QTXA 2VWZA 4OAUC 1Z57A 2IZTA 4N4SA 4M67A 3W2CA 4EH8A 3RCDA 3JR1A 4F70A 4EQCA 4FZDB 2JKMA 4AT4A 5HTCA 1AQ1A 4YLKA 3W32A 2YIQA 5CLPA 2UZWE 4J7BA 3A7IA 4QMXA 3JY0A 4F1MA 4AU8A 4E6CA 2CKOA 3COKA 2VWYA 4IZ5A 3GU8A 3E3BX 4D2VA 4QP7A 4L52A 1UKIA 3DAEA 4YZMA 3SC1A 4EUTA 4O83A 4QOXA 4ANSA 1XH6A 4AZWA 5AXIA 5CZIA 2PZPA 3DJ7A 4D5HA 2OZAA 5I9VA 4U7ZA 3FDNA 2PK9A 4OBQA 2XIXA 4JR3A 2GTNA 2ZM3A 4F6SA 1SVHA 4CG9A 3UZPA 5CF4A 4JIKA 3PJ3A 4RQVA 4V05A 4CG8A 3KXGA 1JLUE 5HVYA 3BRBA 3G15A 3FV8A 2X2LA 3LIJA 4RVMA 2NO3A 2OI4X 3TV7A 2HYYA 3BWFA 3QQHA 4MWIA 4AA0A 5FRIA 3R71A 5EHLA 5M4FA 1SNXA 5FG8A 3MYGA 2YN8A 4GVAA 4NEUA 5I9WA 5C4LA 4MCVA 4FG8A 5D11A 5H2UA 4AOTA 3VUHA 2H9VA 5L4QA 1ZY5A 3U4WA 3R6XA 5EW3A 2HXQA 4RC3A 4F7LA 4BCKA 5EYKA 4A4BA 4PTGA 2QNJA 3FKNA 4I4EA 1YI6A 2IZUA 4IEBA 3IG7A 4C57A 3RHXA 2ERKA 3S0OA 3ZSGA 2I7QA 2X4FA 3I0QA 3LFQA 4U44A 2BHEA 3ROCA 1W0XC 4Y83A 1OIYA 3TEIA 2G2FA 4FKQA 4FSZA 4CTBA 1TKIA 5M56A 4NCTA 1JWHA 4WNKA 2GHGA 5B2KA 5HIDA 1HCKA 1YWRA 4V04A 3RHKA 3DPKA 4IZYA 3FMMA 2VO6A 2OZAB 4F0GA 5L6PA 1WVWA 3P78A 1YXUA 3VAPA 3IQ7A 4E8AA 1WVXA 3V5JA 3GOPA 1E1VA 1OZ1A 1TQPA 3BWJA 4FODA 3RTPA 4H58A 2FB8A 4PL5A 3FQSA 4RFZA 4AP7A 4QMNA 2UVXA 3DXNA 4IAKA 4M69A 5EW8A 3OTVA 3TG1A 4FEVA 3NMUF 4QMOA 5TT7A 1XH8A 3OOMA 2J7TA 4CZTA 3F6XA 3FXZA 5L2SA 1JQHA 2PVRA 2OIQA 5EOBA 4XV1A 3T8OA 4MNEB 3F3VA 3PXYA 4X2JA 3GI3A 2GSFA 4G3EA 3E88A 4I23A 2UZTA 4D0XA 3TM0A 4LFIA 5HD7A 1L3RE 3K3JA 5AR8A 5GZAA 5HESA 5LARA 2ZDUA 3SXRA 2F2CB 2P4IA 5FEQA 2UVYA 2HY0A 3DV3A 3F7WA 3PP1A 3B2WA 4IXPA 1OBDA 3KRWA 3PXRA 4D4YA 1UVRA 5ANDA 3C4XA 4GK4A 4CCBA 2LAVA 2JKKA 2XYNA 5J7BA 4O0SA 1SM2A 4YGAA 3LPBA 4X0MA 3IOKA 4BCMA 2BZKB 4C3FA 4GPLB 2IVVA 4CMTA 5IA5A 4RX9A 5ACKA 2HENA 5EH0A 3ZSHA 3LE6A 3L8SA 4BZNA 3GC7A 2RL5A 2X7GA 2WTKC 4YMJA 3OHTA 4WKQA 4RIXA 5DVRA 4USEA 3AGMA 5A4QA 3GB2A 3H30A 3LKMA 2IN6A 2Y4IB 2C6EA 4J8MA 1U54A 3PPJA 3E87A 3ZRMA 4FV6A 1K9AA 4YO4A 5IUGA 5J79A 3BE2A 2W1ZA 3ACJA 4RFMA 2W06A 3BU3A 3MS9A 1QPCA 3DTWA 4P4CA 2CHLA 4KIQA 3S4QA 2GNJA 4FNYA 4E4NA 3C4EA 1Y6AA 4BCQA 2PVLA 3BIZA 2XKDA 5TR6A 5L8JA 2IJMA 5CENA 2R3HA 5I9ZA 4IM2A 5HIBA 3V8SA 4QMQA 2XA4A 2CGWA 3L1SA 3DA6A 5KMJA 1YHWA 4TYEA 4PDYA 1JPAA 4CVAA 1NXKA 5FBNC 4NCTC 4I22A 2X9FA 3LXLA 3O50A 2EVAA 3MW1A 3LQ5A 5GIOE 3EKNA 1K3AA 4PDPA 2J0MB 2WQBA 1KWPA 3QZIA 1JSTA 4NM7A 4AX8A 4EYMA 1XKKA 3FLWA 3RK9A 4IVCA 3WF8A 2I0VA 1U4DA 3DOGA 4J97A 5DFPA 5IA4A 5C4KA 2YDIA 1SYKA 4O7SA 1WZYA 4WOVA 5F20A 3VC4A 5HO6A 2J0LA 4OTFA 3ANQA 3HAVA 1H26A 1Z9XA 1M2RA 3A60A 4OAVB 3U9NA 4DFZE 4RIXB 3QRIA 3CSVA 3C51A 2VNYA 3EWHA 4RJ7A 2W7XA 2FUMA 2X9EA 1YOJA 3NGAA 3C4ZA 4UALA 4DFYA 3DFCB 3G9NA 4RWIA 1H25A 2PMNX 3I4BA 3OFMA 3OT3A 5EM6A 1WAKA 5FDPA 2IPXA 2YM8A 4FG9A 5E8VA 4RIWB 3Q4CA 1WBWA 2BTRA 3G0EA 3G2FA 4UMUA 3LMIA 4F0FA 1E1XA 4RX5A 4RT7A 3LFCA 4IAFA 4GCJA 4GJ3A 4TL0A 3FYKX 4XG6A 4TYGA 3IW5A 4E26A 3I79A 1H00A 3ZLXA 2GNFA 4QNYA 5G6VA 2IZSA 4FIHA 4J99A 2C5YA 2ERZE 2GHLA 3QD0A 3CCNA 3DKGA 4R3RA 4YBJA 5IF1A 4AF3A 5ICPA 4YNEA 1SNUA 4C2WA 5G1XA 2R0UA 3E8EA 2V22A 3R8PA 2OZOA 1BMKA 3MFRA 5FQDC 2PY3A 3QWJA 5AP0A 2A4LA 5K5XA 1Q8UA 3LXNA 4GG5A 4GH2A 3R63A 4HCUA 4UEUA 3JUHA 5M55A 3ZDUA 4N57A 4H36A 3GCSA 3UYSA 2R7BA 4EH5A 2YWPA 5HVJA 5T3QA 3TUBA 1J3HA 2PHKA 4JBVA 3OW4A 3TACA 1RE8A 5ANOA 3LOKA 2KTYA 3UVRA 3FI2A 4F9AA 4RJ8A 1Q99A 4CSVA 5AV4A 4IHPA 2VO0A 4XBRA 3ZC5A 1T45A 4QYEA 4R7BA 4RVKA 1S9IA 1RQQA 2HZ4A 5H9BA 2J6MA 3LFBA 4RLKA 4FEXA 2XNMA 2QOOA 3DBCA 3JYAA 2BUJA 3RPSA 4QD6A 4YSMA 4G3GA 4AW0A 5CU6A 3D5WA 2FSMX 4BC6A 4GIHA 4BHZA 4A4XA 5AUWA 1EH4A 3UPXA 2E9NA 4BDDA 2UW3A 3R1NA 4XG3A 3NCGA 5HBJA 1JOWB 3L9MA 4M13A 4HNIA 1JVPP 5HLWA 1W83A 3W2RA 2OWBA 4L68A 4OT5A 4DH1A 2R3RA 3ZXZA 5K5NA 5IQEA 2JBPA 2RG6A 2YCFA 4DEBA 3R2BA 3QRKA 4QTBA 4RIYB 3LFAA 3MI9A 4O0XA 2XIYA 3F82A 3D15A 5AP7A 3DBEA 2Y4PA 5B0XA 3C4WA 3ALOA 3NEWA 5KMIA 2X8EA 2XK7A 5FM2A 2WD1A 2HAKA 4EH3A 3DT1A 5JRSA 4HYIA 1YVHA 3V8WA 3QUDA 4HVDA 4YJUA 1X8BA 2YACA 4X3FC 5JGDA 4Z7GA 4O7ZA 5J5TA 2R2PA 3EKKA 3IGOA 3PLSA 4A9SA 1BL6A 4IDTA 2RFSA 5HG9A 4L3LA 4W4VA 3O71A 4FKUA 4JQEA 3V5TA 3VRPA 3DNEA 5B7VA 2BPMA 1Y8YA 4FL3A 2PUUA 4KAOA 2Y6OA 1OKYA 4FKJA 1B47A 3FMJA 2W4JA 4FVRA 3HMPA 3OXTA 4NTSA 4TPTA 4DTAA 3CXWA 2C3KA 1PXPA 2GFCA 3FZSA 4AE9A 4ERWA 3ZM4A 3P86A 3I5ZA 1UNGA 4L46A 3WF7A 4M69B 4A4LA 4G2FA 5A54A 1JKSA 5EM8A 4BB4A 4EHEA 5IPJA 1OBGA 2BROA 4O0RA 5EI6A 3N4TA 3IECA 4O1PA 2BFYA 3QHRA 3TNHA 4DBNA 5FXRA 3CTQA 4AS0A 4EK5A 5BNJA 5LMKC 5HE2A 2PVKA 5JH6A 5BUIA 2BRGA 3Q5IA 4KUJA 2JGZA 4FKRA 3K2LA 3KFAA 4GV1A 2WTDA 3BU6A 3ULIA 1YWNA 4BTMA 5D41A 4YO6A 3NYVA 2VX0A 4FEWA 1PXLA 4GL9A 3AMBA 3BHVA 4EOPA 5LXMA 2OKRA 3QWKA 4H1MA 4EHGA 2BRMA 3FWQA 3NUPA 4JDJA 4LGGA 4BBFA 5J8IA 4K9YA 3UIBA 4PDOA 4U6RA 4PMPA 2YIRA 4AOJA 2R3NA 3V5LA 4FE2A 5HD4A 3GQIA 4G9CA 4MBJA 5AEPA 3ZCLA 5AX9A 2JDOA 2PPQA 2AYPA 2I6LA 4JLCA 3EOCA 4G1WA 1VR2A 5C27A 2IW8A 3ZC6A 3PJ2A 1YDRE 3UP2A 3VHKA 5BUJA 4AW5A 4KIKA 3BV2A 1B38A 1CKJA 4EK3A 3CTJA 2G01A 2X7FA 3GT8A 2QOQA 3OUKA 2XBAA 3QD3A 2CN5A 2E9OA 3GBZA 4YJQA 4CXAA 3QRTA 4O21A 3VULA 3OF0A 2ETRA 4U45A 4FTLA 2ZV8A 3DQWA 3VS3A 3ET7A 4OBOA 3ZBXA 4I92A 2GQGA 1GY3A 3PUPA 4E5AX 4J96A 2XKFA 4EKLA 4NM3A 3DFAA 4LG4A 3DBQA 1OPLA 3H0YA 2B53A 1OM1A 3C4CA 3ETAA 2A19B 4IAZA 5BX0A 2Z7SA 5HU3A 4D9UA 2FGIA 4M14A 3R9RA 2WQEA 3E5AA 1FGKA 3UC3A 2DUVA 3BV3A 3C1XA 5C1QB 4ASZA 3WYXA 3F3WA 4PDSA 1UKHA 2FSTX 2RGPA 4CQGA 2WPAA 1W8CA 2BDFA 4XRJA 3PXFA 3N51A 3ORIA 5BYYA 4HJOA 3ZDIA 3FMNA 2XIKA 5CU3A 3SA0A 4L6QA 4M97A 1ZAOA 3VS5A 4O2PA 3TDWA 4C02A 3QTIA 2X4ZA 1WBPA 2YM3A 4IE9A 3NNUA 2H34A 3A7JA 3BEAA 4GUEA 3OROA 3P1AA 3FMLA 2JIVA 3HUBA 5L2QA 4JBPA 5IQBA 3QQUA 5EYDA 1ZMUA 3IDPA 3QLGA 3ZFYA 5EKNA 3N4UA 2YIYA 2HZIA 3G5DA 3VRRA 5IH4A 3RI1A 5C26A 5HX6A 3W16A 5HTBA 3KB7A 3QXOA 5EOLA 3AMAA 3P5KA 2OGVA 4JX3A 3V3VA 1ZYDA 5AUVA 3WZEA 3EB0A 3UNKA 3TTJA 4DGGA 4FV3A 3BLRA 4M68A 4LOOA 5ANJA 4CNHA 4KBCA 3R04A 4PX6A 4UZDA 4ANLA 4IB1A 3BUOB 2BCJA 3PLAE 3VRNA 2XRUA 3D5XA 3DKOA 3KXZA 4ZOGA 4NK9A 2ZM1A 2VNWA 4TKSA 2ZM4A 3QZHA 3COHA 1R1WA 3SXSA 5K4JA 2Z7QA 4F4PA 1H1SA 3EIDA 3QQJA 2VTLA 3DGKA 3W1FA 3ZNIA 4BTKA 4LRKA 4ORKA 4NTTA 4WRGA 4FKWA 4C34A 5A3XA 2Q0NA 2WNTA 3OY1A 5CF8A 3TNPC 4BICA 3CD3A 5BVEA 3FMEA 3D2KA 3MTFA 2ZMDA 5CEPA 1M14A 1OIQA 2JIUA 2C1BA 2Y6MA 4YZNA 5HKMA 4BRXA 3BYOA 3DB8A 4YTFA 2NP8A 5DWRA 4ACGA 3CPCA 3Q9YA 3ZEWA 4FT9A 2QG5A 2EXEA 3KU2A 3QUPA 4AN2A 4O0WA 4E5WA 4O0TA 4EJ7A 3RZFA 4CT1A 2YLFA 2XZSA 3KXXA 2VTTA 1QMZA 1NVSA 4U3ZA 3SDJA 1NW1A 3L9NA 4XV9A 5AAFA 4AAAA 3K5VA 3UOHA 4F6WA 4MD7E 4DAWA 3MN3A 5LVNA 4A4OA 4AUAA 1PXNA 2XP2A 4IACA 3QX2A 2ITWA 3I7BA 4AN3A 2CJMA 2W1GA 2UZUE 4FUYA 4I41A 5IQDA 1Q3WA 3PY3A 5EFQA 5LVLA 3I0OA 1ZOGA 4ZTMA 4O38A 4OW8A 3VF9A 5AAGA 2I1MA 2YZAA 3SKCA 5A4TA 4JS8A 4RFYA 3VBYA 3ORLA 4NFNA 4P2KA 4O22A 1T46A 5TF9A 4APCA 1KE6A 5EKOA 2V7AA 4UMRA 3SVVA 3EQHA 3LXPA 1Y8GA 2B7AA 4O81A 3OWJA 4O84A 3KK9A 4USFA 4B6LA 2REIA 3OXZA 5C9CA 4R78A 3QCSA 2CGXA 1LEWA 5E90A 4I20A 4RZWA 4QMUA 2WTIA 2WTWA 2Y8OA 2R5TA 3RNIA 2CKQA 2YM5A 4AT5A 5AADA 3QC9A 3KC3A 3PP0A 1PKGA 5AP1A 5J9YA 2R3KA 5GZ9A 4PNIA 4X3JA 3HNGA 4NJ3A 3OS3A 4JT3A 3FSKA 4G5PA 5AP2A 3E62A 5LCKA 2VTNA 3PSBA 3V5PA 5HG8A 2QKWB 3ODYX 1YKRA 2ZMCA 3H9FA 4FNZA 3RZBA 3FY2A 3SHEA 3LFEA 4FIIA 2JEDA 4HCVA 4CYIA 2GNHA 2C3LA 3CR0A 2XKCA 5HE3A 3UJGA 4WD5A 5H8GA 2JAVA 1OITA 5M53A 5BMMA 4Z16A 1MP8A 2ITOA 4TYIA 3UQGA 3AT2A 3OCSA 4F09A 2WQOA 3PVGA 3OY3A 2JBOA 1UWJA 3GFWA 4K6ZA 2NRYA 4CFMA 1G3NA 2VN9A 2XK8A 3NRMA 4RPVA 5BVWA 5A4EA 4QQ5A 5A4LA 4A9TA 4QTEA 5CU4A 5ANEA 4FV9A 2NRUA 2X7OA 4DG0E 5BQ0A 3QU0A 3ZRKA 3EJ1A 3TJDA 3GC9A 1GAGA 1BX6A 4F0IA 3HMNA 3P23A 3HUCA 3SOAA 4AGUA 2OF4A 3LJ0A 5CSVA 4XP3A 4IVDA 5AV2A 4ZLOA 2W1EA 3O8PA 1UA2A 2W5AA 4EL9A 2YIXA 3RAWA 3R7YA 4LQMA 4TN6A 3F5XA 3KULA 1UNLA 4QMVA 4WO5A 4CFFA 4WG4A 5IQGA 5FEEA 2X81A 3BUXB 1IR3A 4RG0A 1H1QA 4KA3A 2IO6A 4RX7A 4ITIA 5D10A 3I1AA 3NWWA 4EOLA 3U87A 2BHHA 3I81A 4IM0A 4CRSA 3W8QA 1H01A 1XWSA 4E4XA 4G5JA 3MIAA 2XEYA 3R9DA 2VTPA 5FTQA 4IWDA 2PTKA 2Z7LA 4JL9A 4EH6A 4F9CA 2J5EA 3R73A 4JBQA 4D2RA 4I5CA 3L9PA 4FTJA 5HORA 3I6UA 2XCKA 4N6YA 3V6SA 2QCSA 1J1BA 4FSQA 2YIWA 3DXPA 2QI8A 3KCKA 1QPDA 4JOAA 4BWPA 4M66A 5K0XA 2BAKA 3QRJA 3H3CA 3BGPA 2UZVA 5A6OA 4AZEA 3VS4A 1H24A 2J2IB 1JNKA 4BN1A 2OBJA 2X1NA 5KKRC 4FX3A 5M57A 4ZTNA 3QCQA 2XYUA 3BUNB 3NCZA 3QCYA 4BYJA 4ERKA 5BVOA 4DGOA 2A1AB 3D14A 3NR9A 3OXIA 4NT4A 4WSQA 3D7ZA 3FMDA 5IEXA 2PYWA 4KIPA 4DITA 1XQZA 3OCBA 4BYIA 4CLIA 1R0EA 3PA3A 5KNJA 5ETIA 4ZTLA 3R8MA 1P2AA 5CQWA 4E6AA 3ZLYA 2IVTA 3ZM9A 4KNBA 3HVCA 3PDTA 3PXKA 4I94A 2CGUA 4BKJA 4DTKA 5CSHA 4UWBA 2WMSA 1ERKA 4RGJA 2WIHA 4LM5A 4PPAA 4C3PA 2RFNA 2J51A 4FTOA 5BYZA 3RWPA 4ZIMA 4O91A 4MXXA 2G2IA 3HA8A 3Q6WA 4NZWB 4YZDA 3VUIA 5BVFA 4AGCA 1YWVA 4UV0A 4BDIA 2O0UA 2Q0BA 3C5UA 4FKPA 5J95A 3DAJA 5AP5A 2C6LA 3FUPA 4PF4A 4Z9LA 4ZJVA 4U0IA 3ZU7A 2R0IA 3TIYA 4FGRA 5CEKA 4JXFA 1TVOA 2B9HA 2JDRA 4JG6A 5E1EA 1M52A 4ZSAA 5JSMA 2WMQA 3TNQB 2F7ZE 2BFXA 2ZJWA 3C0HA 1Y91A 3U51A 2DYLA 3KK8A 2OFUA 2JLDA 3L8VA 3R30A 4FL2A 5CVGA 3TCPA 5IEYA 2YDJA 3ZHPC 3D7TB 2QHMA 4TW9A 4EH7A 3R0TA 3VBVA 2PE0A 3A4OX 2R64A 2Y1MA 1JKLA 3PG3A 4M8TA 4BZOA 5H8BA 5HO8A 2CNUA 3EN4A 4XG7A 4RBLA 3LQ8A 3BYSA 5DMZA 3LFFA 4EQUA 4K11A 1IG1A 2WQMA 3BYUA 3H4JA 1OI9A 3HEGA 4H1JA 3ZTXA 3KRXA 5AR2A 4BIDA 3RPYA 4QP8A 3MDYA 4X3FA 2BMCA 5AP3A 4AGDA 3LQ3A 4WNPA 3VBQA 2Z60A 3TV6A 3BU5A 3SXFA 1TQMA 2BAQA 3IGGA 3ZMMA 1YVJA 3EYGA 5E8XA 4RJ4A 4FT7A 5I5ZA 4HGEA 3OBGA 4M15A 1WMKA 4OBPA 1NA7A 4ZSEA 2OU7A 3DK7A 5AX3A 5HEZA 3QAME 4BWXA 3E8NA 3FZPA 2O65A 4UXQA 5AR5A 2W4OA 4CD0A 5KKRB 3R8UA 3B8QA 4QMPA 4D58A 4TXCA 2CCHA 3FZTA 4YJPA 4IZAA 5K4IA 1FVRA 2PVMA 3DBFA 5AV3A 3PSDA 4QTAA 4EH2A 4O0YA 4BKZA 5CAPA 1W98A 3OD6X 3UP7A 3VIDA 2V62A 3AOXA 4E1ZA 3CGFA 3K5UA 3A7GA 4OLIA 1FVTA 3FI4A 3PIZA 5AFVA 2UW0A 3OZ6A 2I0EA 4MAOA 4IZ7A 4DBXA 1AGWA 3D5UA 4G31A 4QYHA 3RKBA 5CSXA 4LRMA 4BCHA 1CKIA 3FZ1A 2OXDA 4GK3A 4X3FB 4D55A 3P79A 4QTCA 5D1JA 5FEDA 3P4KA 1H08A 3PZEA 4FTUA 4CMUA 3P7CA 2C68A 4O0UA 4DN5A 4YC3A 4EK4A 4X2FA 3VGOA 2YM7A 3WF6A 3E63A 2YCSA 4IANA 4EC8A 4H39A 4ZMEA 1H1PA 1AD5A 1H1RA 4TRLA 4QNAA 2P55A 3MFUA 3ZOSA 3KF4A 5HU9A 4YPSA 2JIIA 1KV2A 3KXMA 2SRCA 4QP9A 3MFTA 3V5WA 5J87A 4GFMA 3VW6A 2WMWA 2BILB 3A8WA 4HZSA 5LVMA 5GIPE 2VWUA 3KA0A 4ANMA 5J5SA 5KBRA 3BUMB 3OP5A 4HYHA 2Y7JA 3GOKA 4GKHA 1IA8A 1Q8WA 5IZFA 3U9CA 5KMNA 5HX8A 3WZJA 4M0YA 3LJ2A 3MVHA 3ZUUA 2C6KA 4ZLZA 5GINE 4EZ3A 4IB5A 3FL5A 4R1VA 4WG3A 2LGCA 4GMYA 4YURA 3SAYA 2OH4A 4EZ7A 3GCPA 4YJRA 4RZVA 4F9BA 5AR3A 1RW8A 4RIYA 2HW6A 4HVSA 5E9EA 4YPDA 2F57A 3VUTA 4GSBA 3PXQA 3PG1A 5J3XA 1OIRA 4B4LA 2WFYA 4AGWA 5HTIA 2ZV2A 1M7NA 5J7HA 3NUUA 3R9OA 3QD4A 2XK6A 4DFLA 3I7CA 4EQMA 2VD5A 4PMSA 3FZOA 5HKZA 4O7LA 3LM5A 4TYJA 2GCDA 2OIDA 2OICA 3GCQA 4O6EA 4ZTSA 3OCTA 5DYJA 3NUSA 2HY81 3EYHA 3ELJA 4X6QC 4CTCA 2HWPA 2UUEA 3WZUA 4ALVA 4DC2A 4ZP5A 3I60A 3O96A 5JZNA 2O3PA 3F2RA 3DU8A 3ZEPA 2C5OA 4UYNA 3E64A 3HX4A 4EOSA 3LMGA 2WELA 3WZKA 2NNWB 2P2IA 3MGYA 4NW5A 5HE0A 1PYXA 4FTKA 3ROYA 4NM0A 2C5XA 1PHKA 4C3RA 2CBLA 4NYEA 3FI8A 5IUIA 2C6MA 3QA0A 4O7NA 3MJ1A 4U5JA 3DK6A 3QQKA 4YLLA 3Q2JA 3KVWA 3ZONA 3OW3A 4O6LA 4TWPA 3ATTA 3QLFA 4IAIA 3UE4A 3VJOA 4IX5A 1FQ1B 2R3PA 4EOMA 4BI0A 1CTPE 2OXYA 1H4LA 3M2WA 4K77A 5GJGA 3PY1A 4AFJA 5CEOA 3W8LA 4ZLYA 3N4VA 3B8RA 4AZVA 3MH2A 2EWAA 3PPKA 4FYNA 5LVOA 3UOKA 2YJRA 3KN6A 3U6IA 2B54A 2C6DA 5M09A 5KUPA 2OFVA 5CVHA 4C61A 4FV5A 3ZXTA 3VUGA 2OW3A 3JPVA 5DRDA 1XBAA 3PIYA 5I3OA 2QU5A 4U79A 4C4EA 5ANKA 4YSJA 3OEZA 4I1ZA 4LUDA 5DHJA 5C03A 2VWIA 4R8QA 3ZO4A 4EHVA 1TQIA 4IJPA 5IQFA 3FLQA 3PE2A 1E9HA 5I9XA 4CV8A 3F66A 4HGSA 4AWIA 3ENHA 4RX8A 4PV0A 4RVLA 2PMLX 2W9ZB 5AR7A 2B9FA 3TKUA 5AUTA 5IQIA 4P5QA 2QQ7A 4HGTA 2GPHA 2UV2A 1GOLA 2RSVA 3G9LX 3OB1B 4U9AA 3UO4A 1KUTA 3WIGA 2WMVA 2WMUA 4UXLA 4Y5QA 1BUHA 4D2TA 2VZ6A 4XOZA 2F2UA 5K3YA 3FY0A 3HRBA 2XNGA 4QP1A 3NPCA 4NWMA 2BIKB 3HMIA 4FSRA 5HNIX 3IW4A 4CFUA 3DB6A 4MXAA 2WB8A 2NPQA 4I6FA 3R7OA 4OT6A 4GU6A 3C5IA 1GZKA 4PMMA 5CY3A 3KMWA 4KABA 5JGBA 4F63A 3F5PA 4FTIA 1DAYA 3TNIA 2CKPA 3WF9A 4Z7HA 3PWYA 2OH0E 1ZOEA 5KE0A 4EBVA 1JKTA 3EQDA 4E3CA 2VUWA 3II5A 5ANIA 5IA2A 3TNWA 4D5KA 3F3ZA 5E8WA 5HO7A 3FXWA 3BBTB 3MTLA 3OG7A 4FVQA 4GJ2A 3AMYA 4I93A 3TT0A 3ZFMA 4K2RA 3LFSA 3ZO2A 4DYMA 4LI5A 1GIJA 1O9UA 5E8YA 2G2HA 3TZ7A 3T3VA 3R8ZA 4GYIA 3EN7A 4O0VA 3NAXA 2YCRA 1KV1A 1YDSE 5HG5A 1A06A 4U8ZA 3RWQA 5EYMA 5ITAA 2HOGA 5FXSA 5IISA 5HCYA 4MKCA 3FC1X 2VWBA 1KE9A 3FQHA 3NSZA 5AV1A 3ZSIA 4CQEA 4UN0C 2FVDA 5AP6A 3C50A 3R9NA 4NW6A 2XK4A 4Q9SA 4XLVA 3FQEA 5IQAA 3E7OA 1U5QA 2QURA 4YC8A 5CX9A 3CQEA 5AWMA 4V01A 5CAVA 5IUHA 3NNXA 4QTDA 3NYNA 4XJ0A 5D9HA 3ZRLA 3VHEA 3UO5A 1CM8A 3TL8A 3LCKA 4G17A 2YHVA 5DGZA 2WTVA 4N70A 2PMIA 3PA4A 2QO7A 3C0GA 3EQRA 4BGHA 3MY1A 1FBVA 3QGWA 4L45A 3LZBA 1BI7A 1FINA 3F9NA 1J7IA 1QPEA 4WBBB 2B9JA 1K2PA 4FNWA 5M06A 2XK3A 3CPBA 1HCLA 4USDA 4ZSJA 4XHKB 5DA3A 2X0GA 4OTPA 4A9YA 5JMSA 2HELA 5AUZA 1V0PA 1O6LA 4KB8A 4KS7A 1YW2A 4HPUE 4FKVA 4L00A 1CMKE 4G3FA 4R3CA 5IMXA 2BKZA 4GT4A 3QQLA 1PXOA 4R5YA 3QALE 2QO9A 3GENA 4ZS4A 2HWOA 4HNFA 3UIMA 1UU3A 5IQCA 5EM7A 5TOZA 3MVLA 2E2BA 3EQCA 3FJQE 4QPMA 4II5A 1Q97A 2QOLA 3F3TA 2PL0A 4DFBA 2C6IA 1DI8A 2OF2A 3QTRA 4BDEA 1OECA 2JDTA 2OSCA 4AXAA 4RA5A 4NJDA 2UW4A 5L8KA 2F9GA 4A9UA 4FKLA 3AD5A 4X2NA 4XOYA 4D2SA 5CAQA 3OUNB 3BHUA 3NUAA 3OWPA 4S33A 1REKA 3KXHA 5EDRA 2VWWA 2ZV9A 4APPA 4C38A 1R39A 1FBNA 1P14A 3FHIA 4CZUA 2J0JA 2RIOA 1WBNA 4GKIA 4RC4A 2ITNA 3HA6A 3FL4A 4YJOA 5HZNA 2GNIA 2OJJA 1H0VA 2OO8X 4R5SA 4ZEGA 4DEIA 1U46A 4NM5A 1ZY4A 2I40A 4JIAA 4JDHA 3R28A 1SVEA 1VYZA 2QODA 4M0ZA 5CU2A 5HQ0A 1H28A 1Q61A 4XUFA 4RWLA 2CCIA 2ZB0A 1GZ8A 2QOHA 3COIA 4JDKA 4S30A 4G6LA 3CY3A 4NFMA 3EQIA 3TI1A 2VGPA 4HW7A 4G34A 3FHRA 2GQRA 4L3PA 4Y8DA 1PXIA 3VQHA 3E93A 1V0BA 4I0TA 5AM6A 5LQFA 4WG5A 1XH5A 3RJCA 4WT6A 5CEQA 4AN9A 1OKWA 3ZYAA 4Z3VA 2O8YA 3ZBFA 4GYGA 4CFVA 4RMZA 3DJ5A 4EEVA 4FL1A 3AGLA 3EFWA 4FEUA 2W1CA 1MRUA 2XCHA 3M11A 4MQ2A 3DY7A 3E8CA 4U42A 5HNGA 3SX9A 2PU8A 4QPSA 2CN8A 4ACMA 3UPZA 2W0JA 4MNFA 2BZJA 3DS6A 3HZTA 4ACCA 2ITUA 3Q9WA 4XX9A 4FT5A 2J90A 4X2GA 3DKCA 2QLQA 4K33A 4MYGA 4V0GB 3TZ8A 1IA9A 4J98A 2UZLA 4S34A 4G3DA 2BTSA 5J9ZA 2ETKA 3ERKA 5E8TA 4DG2E 3C7QA 4A07A 5LMKA 5KMMA 4ZJIA 2XS0A 5CYIA 5FDXA 5AV0A 1Q8YA 2GFSA 3CD8A 3IW7A 4RIWA 4L42A 5DIAA 3NIEA 3U4UA 4BI1A 4DGNA 3OP0A 3LFNA 3WE8A 5C8NA 4M84A 2JC6A 3BCEA 1XHAA 3IW8A 4FR4A 3G6HA 5JFVA 3QQGA 5HI2A 3FKLA 1DAWA 3RAIA 4DFNA 5IG1A 4ZZNA 5FBOA 2VV9A 4EWQA 4OTQA 4NSTA 5BVNA 3D83A 3M42A 1OMWA 3E3PA 4FV0A 4IBMA 4YC6A 3MH3A 2W99B 3BI6A 4AW1A 2EB2A 3CIKA 3UVPA 5LVPA 2BZIB 3A61A 2XEZA 2YITA 2R9SA 4TT7A 3HGKA 4HVHA 1A9UA 1YI4A 3HMMA 3R21A 3F5UA 3Q2MA 3TN8A 1MQBA 4BCOA 2FH9A 4I5MA 5F9EA 4J8NA 1PMNA 3V5QA 5L2TA 3EFLA 3W18A 1IAJA 4Y95A 4F99A 2KULA 3UO6A 5KHWA 3P9JA 3NYXA 3KEXA 1PF8A 5LJJA 3KVXA 3UNJA 2C6TA 3NS9A 3ORXA 4KIOA 5KBQA 4FUXA 3LCDA 2XJ0A 4EOJA 3HRFA 4OTHA 3FPQA 3GEQA 4MXZA 1NT2A 2VX1A 4IAYA 3ZLWA 4WSYA 2WGJA 3IPHA 4EOKA 4FTQA 4YTHA 3CS9A 1ZMWA 4Y85A 4C7TA 1JBPE 3U6JA 4YHTA 3RPVA 1R3CA 4H3BA 2H6DA 4JNWA 3SRVA 4DHFA 5B2MA 3WOWA 4U40A 4X2KA 4BIEA 4DA5A 1ZZLA 3FPMA 3Q9XA 4K0YA 4V0GA 3ORNA 3E7VA 4ZZMA 3KREA 3TDVA 5FP6A 5FTGA 3UZRA 2VTQA 3NNVA 4GVJA 4BCFA 4WNMA 1PXJA 3NUNA 1Q5KA 4LGDA
chains in the Genus database with same CATH superfamily
3NDMA 3KMMA 3I6WA 3F7ZA 5E91A 5TKDA 2JDSA 4I3ZA 5JFSA 4ZMFA 4ZZOA 3ZZWA 2XJ1A 5L3AA 4P7EA 5CS6A 1PMUA 2JITA 5LWNA 3QXPA 1LPUA 4FT3A 3D5VA 3NW6A 5I0BA 2WXVA 3UZTA 3ACKA 4PL4A 3RP9A 4C62A 4CYJA 4D2PA 3AG9A 3R1YA 2XNOA 2QR7A 3H10A 3SRVB 4C4HA 3OCGA 4FZFB 3BGZA 3CBLA 3PLFB 2GS2A 3EH9A 4J53A 1IASA 2V7OA 4FIGA 4YHFA 3K3IA 4S32A 3GGFA 3SQQA 3VBXA 3PVBA 1APME 2X6DA 5DH3A 5EHYA 5FXQA 2CGVA 2R3JA 3MFSA 4XYFA 4DGMA 3BLAA 3ORPA 4O4BB 4L8MA 5JQ5A 5I9UA 4LV7A 1OKVA 3RK5A 3F69A 2QD9A 4WA9A 1UU7A 2UZOA 3JXWA 5L2IA 3SW7A 3R7VA 3U6HA 3FLZA 5L2WA 4XG2A 3VS0A 2XNPA 5AMNA 2EXMA 3VUMA 4PPBA 1YXTA 4GS6A 1PJKA 1V1KA 4O1OA 2VTRA 3HV5A 1ZLTA 3QTUA 4K1BA 2YFXA 5CF5A 5D7VA 1MQ4A 3CGOA 4W9XA 4G3CA 3PUFC 3C9WA 3O7LB 5I4NA 5E8ZA 3FC2A 5CWZA 4HGLA 1KSWA 2R3GA 3MA3A 2ITTA 4EKKA 3S3IA 2I0YA 5HE1A 2AUHA 5ETCA 4GT5A 3CKWA 2A27A 5HG7A 3DZQA 2XBJA 4S31A 3Q9ZA 1BYGA 4FYOA 5L6WL 1BL7A 3PZHA 1H07A 3NX8A 5DT0A 4WUNA 2W96B 3UIXA 4PP7A 3UBDA 2W1HA 3LMHA 4NUSA 5AR4A 3REPA 3UOLA 2PVFA 2G1TA 3DNDA 3QBNA 1Q24A 4AZFA 4MBIA 3NZ0A 3D0EA 3HV7A 2BZHB 4IH8A 4IX3A 3TZ9A 2C69A 2W1IA 2BRBA 4O4FA 5KZ0A 5CQUA 4OMEA 3LM0A 1FPUA 3FKOA 2QLUA 5I9YA 3BGQA 3F3UA 2WHBA 4O2ZA 2WTCA 3MBLA 4IC8A 1OVEA 5F95A 4ARKA 4BDFA 2XIZA 4M12A 2XMYA 5CNOA 4HYSA 1KOAA 2C47A 4RLLA 4LGHA 1YQJA 4AQCA 2EU9A 4FZ7A 4CV9A 2XPLA 4O82A 3UMWA 4IDVA 4KD1A 4XRLA 2B52A 4MD8E 5EQYA 4ANNA 3A7HA 4DT9A 3O8UA 3Q53A 3WYYA 4BR3A 2Y9QA 2XNEA 3AC3A 1OPKA 4BY9E 3NVKI 3O0GA 3C0IA 4BIBA 2CPKE 2QOIA 1ZYJA 1JSVA 1ZYSA 3W2PA 1F0QA 3DDPA 4FTNA 1SMHA 4YJVA 3R8VA 4DCAA 3A8XA 2JFLA 3UODA 5CTPA 1BKXA 3CTHA 5CU0A 3P0MA 3TWJA 3V01A 3R7IA 2IG7A 1B6CB 4L7FA 4FV4A 4ZTRA 3HECA 5CEMA 3MPAA 4EJNA 4K18A 4BPWB 5LWMA 4IWQA 3PFVA 4QMWA 3JVRA 5EM5A 4RJ3A 4XNEA 3R83A 4FK6A 4IB0A 4CEGA 4FTAA 4GG7A 4FTTA 1PMEA 3RAHA 3RM7A 2ESMA 3VVHA 4JRNA 4YP8A 4C4FA 5EHOA 4E93A 3ITZA 5E7RA 4D2WA 4YR8A 4W9WA 3JS2A 4LMNA 3MB6A 2O5KA 2QR8A 3LCTA 3SGCA 2IVUA 2VWXA 4AACA 4QQTA 2WAJA 1PXKA 4NU1A 3VRYA 4CFWA 2GQSA 4JG7A 4UB7A 5JEBA 3GVUA 4P5ZA 3GC8A 4O86A 2VU3A 4Z55A 5LMBA 3PWDA 4BBMA 4E5BA 5M51A 3PSCA 5LMAA 2BRHA 3Q4ZA 1GIIA 2OJGA 2A0CX 4BDBA 5K9IA 1BI8A 1Q62A 5CXZA 4D0WA 4C4IA 2Y1NA 4E73A 2C0IA 3Q32A 4DH7A 3OB2B 2C6OA 3NW5A 1MRVA 3VBWA 4EUUA 5EI2A 5HKWA 4AZTA 4RA4A 2BKKA 3VUDA 2JDVA 2PVJA 4JQ8A 2UW7A 3AT3A 1P4OA 4MQ1A 4ZXTA 4MCQA 2VTIA 3Q60A 3FE3A 4QO9A 4RIOA 1GJOA 3NAYA 4F7JA 3KKVA 3QKMA 3WI6A 4IC7A 5DEWA 1MUOA 4H3PA 4PY1A 3R22A 3DTCA 3AT4A 5F1ZA 5E8SA 3V51A 4UYAA 3MV5A 4RC2A 5CF6A 3RINA 1OL2A 5DBXA 2R3MA 4KBAA 2XKEA 2YA9A 4LMUA 3CQUA 4BTFA 4DH3A 4W4YA 2BRNA 1WBOA 2G9XA 4HOKA 4I6HA 4DEDA 4X7QA 3GXLA 4A06A 2R3LA 3BLQA 3AXWA 5IU2A 4U41A 2WTKB 4PP9A 3E92A 1ZRZA 4QQCA 4GT3A 3EQFA 3D7GA 1YXXA 2PVHA 4G16A 4NIFA 4QRCA 4OTIA 5A9UA 2RG5A 4KKEA 3QTWA 3QCXA 4GK2A 4U97A 4DEGA 4EWHA 3SJGA 4BWKA 3PVUA 3AD6A 3WIKA 4XG8A 3NW7A 1QL6A 4MCPA 1W84A 4UBAA 4R6VA 3FSFA 4PUZA 1R78A 1WCCA 2WU7A 1SZMA 2QOCA 3GCUA 3KXNA 4JG8A 2Z8CA 3UGCA 4BDHA 4AXCA 4DE4A 3EHAA 5BVKA 1LR4A 4I5PA 2EUFB 2P2HA 3D9VA 3HV6A 4J95A 1GZOA 1JSUA 4IFCA 4A7CA 4MEDA 5FD2A 1OL7A 4TYHB 4E6QA 4OC0A 3W2OA 4MK0A 2DS1A 3VBTA 2YLEA 2C0OA 3LW0A 4DEHA 2XUUA 3SV0A 2QVSE 2W5HA 2QOBA 3KMUA 2RFEA 4PMTA 3S9NA 2F49A 2ITVA 2R3IA 2RFDA 2XNBA 3OBJA 3SOCA 3MIYA 4LUEA 3WZDA 5B2LA 1F3MC 3AKJA 1ZOHA 3CP9A 4FSYA 2O2UA 2DQ7X 4U43A 5KCVA 2B9IA 1ND4A 1KOBA 4N0SA 2OOTA 3HV4A 4IWOA 3KULB 3E8DA 2QG7A 5M08A 1J7LA 3W0PA 4QMMA 3QTQA 1M2QA 4BPXB 5FGKA 2IZRA 4NIFB 3AD4A 1YXSA 5M07A 4PQNA 2ZDTA 3EZVA 4ZSLA 3HMOA 2DWBA 3DK3A 2C0TA 3L8PA 4BI2A 3MVJA 2PE1A 5CNNA 2XNNA 4XEYA 5AUUA 4AXFA 3LXKA 4JDIA 4AE6A 3T9TA 5DI1A 3VS2A 3LLTA 4QYFA 3Q6UA 4C4JA 4F7NA 3GQLA 4ZJJA 3FMKA 4UMPA 3UIUA 4ZY4A 5GHVA 2RKUA 1JKKA 4I24A 4FV1A 4UY9A 4ZAUA 4KINA 1V0OA 2Z2WA 3RBWA 1OUYA 1F5QA 4FF8A 3SJEA 3BEGA 4BTJA 3OAKA 2W1FA 3GFEA 3O2MA 3FBVA 1JAMA 1ZARA 1SVGA 4UWCA 5FTOA 2I0HA 2B55A 4ITHA 3PRFA 4KSQA 4I5HA 4XLIA 1UV5A 3BHHA 3S95A 5F4NA 4ANOA 4D9TA 4FGBA 4EHZA 3CKXA 3G51A 2WO6A 3HV3A 2N3AB 3W10A 4DCEA 3QQFA 5D29A 2W5BA 3JVSA 4YJNA 2PVVA 2F4JA 5KHXA 1O6KA 3MY5A 1DM2A 3BYVA 4MHAA 4TYHA 5AUYA 3RVGA 1W7HA 3HP5A 2Y4IC 3ZUVA 4ASEA 4FSWA 4L7SA 3EQPA 1NY3A 3ORTA 3W0SA 3FLYA 2R4BA 2UW9A 5IA0A 4KRDA 5KMKA 2C5VA 4OTDA 1XBBA 2J4ZA 1CX8A 4L01A 3H9OA 3KY2A 4DGLC 5JQ8A 4GUBA 4PPCA 5A6NA 2HIWA 3KCFA 3F2NA 1UU9A 3BELA 1G5SA 3R1SA 3W2SA 3CLYA 3GUBA 4W4XA 3BHYA 4FSUA 1W2DA 4BCPA 1P4FA 3FMHA 3V04A 4E7WA 4IM3A 4DEAA 4C33A 1Q3DA 2ITYA 5ANGA 3RCJA 3THBA 4FZAB 5CI6A 5HLPA 1P5EA 4EOOA 4JAIA 4A4CA 2XH5A 4TZRA 5DT3A 4J52A 1ZWSA 1KE8A 2XPOA 5EYCA 4BZDA 1XH9A 4LOQA 4FTCA 3CQWA 4MXCA 4BCIA 4EONA 4ACDA 1UU8A 3AKLA 4O96A 4R7HA 4YU2A 3FECA 3IONA 4YHJA 4RWJA 5DR2A 4ZTHA 1PY5A 3ZFXA 2ZOQA 1MRYA 4FKTA 2ACXA 5CXHA 4AA4A 3UNZA 4UX9A 4ZS0A 2YCQA 4FNXA 1Q4LA 3O51A 5C01A 2WEVA 3QYZA 3H9RA 4FG7A 4FZ6A 3VRQA 2YWVA 1LP4A 1HOWA 4LL0A 4J71A 2W17A 4F7SA 1WVYA 5AA8A 4QPAA 5IH6A 3QZGA 4AG8A 2C6GA 4I0RA 5E8UA 4GRBA 3DLSA 4QP4A 4F65A 2OXXA 4BCNA 4CKJA 4BDJA 4TY1A 4BDKA 3VQUA 4EI4A 2J9MA 4JX7A 3D94A 1FMKA 5IH5A 3R7UA 5H3QA 2JKQA 4OUCA 2X6EA 5T68A 4ACHA 1Y57A 4C4GA 2ITXA 2WTJA 3S1HA 3HKOA 4I21A 5CANA 4DF3A 3FYJX 1LEZA 5IA3A 2GNLA 2W05A 2X39A 4FI1A 4ZSGA 3WILA 4FKGA 5L8LA 4UZHA 4CFNA 5HOAA 4O27B 2WKMA 4HPTE 2VO7A 3POZA 2Q83A 5M44A 3IS5A 2AC3A 5DT4A 1IEPA 3BI0A 3C13A 2ZYBA 2XK9A 1Q41A 3RALA 1WBVA 3IOPA 4EOIA 1YRPA 2HZNA 4Y46A 5ETFA 3MWUA 5FUTA 2CLQA 3P08A 1WBTA 3IKAA 4IJ9A 2F7EE 4NGMA 3PYYA 4BDGA 4M3QA 1PW2A 2HW7A 5DG5A 3KN5A 4D1ZA 3TUCA 3SLSA 4FV7A 3UYTA 5D7AA 4YTCA 1KE7A 3KQ7A 3ORKA 4O7YA 2WOTA 3AC1A 1FOTA 3MH0A 1CDKA 3UG1A 3BHXA 3TKHA 4F64A 4RJ5A 3QTZA 1IRKA 3R00A 3V6RA 2J0IA 2IVSA 3JY9A 4EYJA 3EQBA 3PFQA 4JBOA 5HGIA 3OEFX 4F6UA 4OTGA 2BR1A 3MA6A 4Y73A 1UWHA 4DLJA 4N6ZA 4FIFA 4BVUA 4EH9A 4IWPA 4WNOA 3HYHA 5FM3A 3Q04A 1G8SA 2C30A 2GS7A 2WQNA 3ODZX 4IFGA 3DJ6A 4XS2A 1CSNA 2C4GA 3ANRA 3IK3A 3PY0A 3VO3A 4EZ5A 2WMTA 3AC2A 1YHVA 2WMBA 4FTMA 3PA5A 3RPRA 2JFMA 2EXCX 3QGYA 4PWNA 4U3YA 5M4UA 3CEKA 3VN9A 5J9LA 2YZLA 3CE3A 4ZK5A 4BF2A 2HZ0A 4RSSA 3W2QA 4B7TA 4MD9E 4OTWA 4NL0A 3R9HA 5DPVA 5JN2A 2PZYA 5BVDA 5H8EA 2CNVA 2Z02A 1W2FA 5IEVA 1URWA 2IF8A 4JQ7A 2OR4A 3D7TA 1STCE 4FC0A 3TIZA 2GS6A 3NNWA 4W4WA 4WBOA 3UDBA 3WARA 4C2VA 5JFWA 5AAEA 2YEXA 3K54A 2FA2A 4ID7A 4YJTA 4Q5HA 1XJDA 1I09A 2VTOA 4J1RA 4R7IA 4OC2A 2GU8A 2XIRA 2YISA 3LVPA 4GIIA 2PZIA 2QO2A 1NVRA 1XH4A 2UZDA 2W9FB 3G33A 1RDQE 3POOA 3R02A 4IB3A 5IMEA 4I6BA 2BIYA 3HP2A 3MPMA 2JKOA 3VF8A 4ENYA 2UW5A 1Q8ZA 3KRJA 4L44A 3PJ8A 4G6OA 4TNBA 4FVPA 5EG3A 3BUWB 5KMOA 1PMVA 2PULA 4JJRA 5AUXA 5KZIA 4NH1A 2O64A 2VTAA 3U8WA 4D28A 2XJ2A 3GU6A 2PUPA 2V55A 4LL5A 3UQCA 4H3QA 4PNKA 4DLIA 3NIZA 5CSWA 5D12A 5A46A 3NUXA 3SD0A 3O7LD 4QEBA 3BE9A 4TTHB 4EH4A 3RK7A 4R77A 4OC1A 4UMQA 5ACBC 3QA8A 2FSOX 4BPUB 4NKAA 4PL3A 2E9PA 1GZNA 3FLSA 3TTIA 4IQ6A 4QMTA 1ZMVA 3TJCA 1KE5A 3T9IA 1U5RA 3QC4A 1J7UA 1VZOA 1O6YA 3Q4UA 4QT1A 2PSQA 4TWCA 4EORA 3DCVA 3QFVA 3RNYA 3O8ZA 4DHZA 3EZRA 1ZYCA 4O7TA 3F61A 1QPJA 1XO2B 2WMXA 4LYNA 3O23A 3W33A 1BLXA 4U81A 4W8EA 4YUQA 4QP2A 4WHZA 5JFXA 1WFCA 2ETMA 4QP6A 5AJQA 3VNTA 2OJ9A 4JR7A 4KKGA 2ZV7A 4C36A 3PJCA 3UVQA 2X2MA 4ALWA 2CSNA 2J50A 1UNHA 4BGGA 2WU6A 4MBLA 4XG9A 1H0WA 4KIKB 4MVFA 2BVAA 2QHNA 5E4HA 1OUKA 2PUNA 2BDWA 3MVMA 4D4RA 5FLFA 4FTRA 4QMYA 3BQCA 4TWNA 4X21A 4AQKA 2H8HA 3GU5A 3QZFA 1OKZA 4QQJA 5CEIA 2UW8A 4WIHA 2PWLA 5ELYA 2ITZA 1XMLA 2CNQA 4MXYA 5CZHA 4CT2A 2C3IB 3UOJA 4IMYA 2B4SB 4U80A 1DI9A 4WRSA 2X0PA 2R3FA 4HVGA 5J1WA 1TFFA 5GJFA 5EQPA 5BYLA 3BHTA 3SG8A 1J91A 5E92A 3QKLA 3PVWA 3WBLA 4MX9A 4G6NA 2R3QA 5GJDA 5BPYA 5JZJA 3VS6A 2X8DA 4C8BA 4F1TA 2X8IA 4AA5A 4FIEA 4BKYA 4ONAA 4TNDA 5IA1A 2VGOA 2RF9A 2CDZA 1IAHA 3S00A 5HBEA 5CALA 4ITJA 4Q9ZA 4KWPA 3HPGG 3VS1A 3QF9A 1B39A 4MXOA 4AFEA 2BDJA 4C0TA 3MPTA 4D1XA 4W8DA 1QCFA 1VYWA 5AA9A 4FIJA 2QC6A 3F88A 3Q5ZA 5F94A 4AT3A 4CMOA 5CAOA 5CSPA 4GEOA 5HHWA 2C3JA 1ZXEA 1OB3A 4RWKA 5BUEA 4QMLA 3W55A 4FT0A 3GU7A 4B9DA 2YJSA 3MB7A 2FO0A 3WF5A 2ITQA 5IQHA 3GNIB 4YLJA 3T3UA 5EW9A 5TE0A 5DEYA 3CY2A 4LRJA 2C5NA 1Z9EA 2V5QA 2XRWA 3AQVA 4P90A 5E1SA 3U54A 4KS8A 3IO7A 3C4FA 2PMOX 4BJJA 3GC0A 2OJIA 4FK3A 1H1WA 5FWKK 4XV3A 1REJA 2QU6A 5A14A 2PZRA 2VRXA 5HKYA 5CT7A 3IDBA 2WIPA 4O7WA 5JK3A 4DEEA 2YABA 4YNOA 3N9XA 3FZRA 3ZLSA 1FVVA 3LJ1A 4BL1A 5HICA 5DR6A 3ENMA 3HDNA 3PIXA 5L6OA 2ZB1A 3QUEA 4OR5A 4B99A 4DHIB 3NUYA 5HCXA 4X6RA 4L3JA 3PRIA 4MWHA 3QD2B 2UVZA 3CC6A 1R0PA 2B1PA 2JAMA 4D1SA 4I6QA 3ZUTA 5KX8A 4X3RA 5EDQA 3TZMA 3H0ZA 5AIRA 4D4SA 4F9YA 2PZ5A 4FKSA 2PUIA 2Y0AA 2W1DA 3DDQA 2GHMA 3VS7A 4F08A 2WMRA 5T6KA 3I5NA 2V0DA 3FAAA 5A4CA 4RJ6A 1YDTE 5CT0A 3KRLA 3ZZEA 2XPPA 3EMGA 3CJGA 3IDCA 5HVKA 4CCUA 3KGAA 2YDKA 5EI8A 4HCTA 3RM6A 4DTBA 3UQFA 5M4IA 3EFKA 1Y6BA 3F9KC 1OPJA 2GMXA 2QKRA 3Q96A 3LHJA 5AM7A 1J1CA 5DOSA 1RJBA 3DKFA 3HRCA 3FLNC 1A48A 2XB7A 4ASDA 4EBWA 4L67A 4QMZA 5HCZA 1ST4A 2ONLA 2WZJA 1Q8TA 3BLHA 3HAMA 3TV4A 2J0KA 2H96A 1PKDA 1OL5A 4UWYA 4Y72A 4FSNA 2EB3A 1FGIA 3KL8A 4FSTA 2YAAA 4NGPA 2P3GX 3ZH8A 3DAKA 3V8TA 1G8AA 4ALUA 4NKSA 4JAJA 4F9WA 1PRYA 4XMOA 4RQKA 3VWAA 5DN3A 4XH6A 1Z5MA 3RPOA 2BAJA 3BZ3A 3PT1A 1VJYA 3R7EA 2XM9A 4FMQA 2B0QA 3UG2A 2PE2A 3ATSA 2CLXA 4P44A 2UZNA 3M1SA 2IW9A 4GFOA 4BCGA 5IDPA 2GDOA 3QTSA 5TO8A 4ZY5A 2OIBA 2E9VA 4L43A 5CASA 3ZS5A 3RGFA 3L8XA 5AIKA 2ZVAA 4PTCA 3GCVA 4HYUA 5LOHA 1YXVA 2ITPA 4XCUA 4D4VA 1NVQA 4FV2A 5C8MA 4IW0A 4C58A 2J5FA 4BGQA 3BYMA 5FP5A 5KO1A 3R01A 1ZYLA 3TKIA 4DFXE 3MESA 2WEIA 4BDCA 2OK1A 5CVFA 5I3RA 3HLLA 1XR1A 4OGRA 2F7XE 2R3OA 1ATPE 2UZBA 3PE1A 3QL8A 4QMSA 2WOUA 1S9JA 2G15A 5J1VA 3BBWA 4H05A 4BFMA 2PVNA 4HVIA 4AZSA 3SW4A 4ANBA 4I4FA 1GIHA 2HCKA 3KF7A 3BQRA 2P0CA 4O7RA 4FOCA 5HBHA 4AOIA 2O63A 4YJSA 4AW2A 4FBXA 4IVBA 3RMFA 5K0KA 4CGAA 3G6GA 4GFGA 4YZBA 2FSLX 4B0GA 4CLJA 3VRZA 2VTHA 1XH7A 3FEEA 3EN5A 2CMWA 5EK7A 3OT8A 5KMLA 4FKIA 4MNEA 5DE2A 4JRVA 4B8LA 4CRLA 2VTSA 4M7IA 3MSSA 1OL6A 3FEDA 3BX5A 3OOGA 1PYEA 4IADA 4C35A 1GNGA 4QYYA 5CI7A 2CKEA 3CJFA 5EDPA 5IDNA 2WMAA 3A2CA 1I44A 4QYGA 3LLAA 1H8FA 4XP0A 2VO3A 5C8KA 4YZCA 3EL8A 5DNRA 3OWLA 3QKKA 2IWIA 4GW8A 3VW8A 3NVMB 3AKKA 2OJFE 4LV5A 4EOQA 2XM8A 4XV2A 5JKGA 2AC5A 4LOPA 4LV8A 1VEBA 4EK6A 3UMXA 2GNGA 4PTEA 4C37A 5BMSA 3AC4A 3PJ1A 3F5GA 3QHWA 1L8TA 4UMTA 2QOKA 4MF1A 2YAKA 5AP4A 3OWKA 3QRUA 5CAUA 4YTIA 2XAMA 1OIUA 3R1QA 1U54B 2YM6A 3UTOA 4I0SA 3MH1A 2YERA 2HK5A 3EN9A 3OMVA 4GU9A 2IW6A 2UZEA 3NYOA 4FICA 3VROA 2A2AA 1PXMA 1ZZ2A 4K8AA 3S2PA 4EC9A 3O8TA 4MF0A 3F2AA 2JD5A 5HNBA 3DBDA 1YI3A 1FMOE 4Q5EA 2VAGA 1OGUA 3A7FA 3PXZA 4FOBA 3PPZA 3G0FA 4IVAA 4HZRA 4QP3A 3B2TA 3A4PA 5DLSA 4ENXA 5HIEA 5JT2A 4A9RA 4KSPA 1CKPA 4BHNA 2PVWA 3FEGA 4RRVA 2OG8A 2X2KA 3OTUA 3MY0A 3QYWA 3R8LA 4R1YA 2OLCA 4B8MA 5HLNA 4CKRA 2E9UA 3O17A 4DT8A 3SG9A 3A62A 4BDAA 3OC1A 4EK8A 4TWOA 3P7BA 5GNKA 3VJNA 2PVYA 5GZ8A 3VUKA 4WUAA 4R3PA 4DINA 4E4MA 2FYSA 3EL7A 2C1AA 4XG4A 2XF0A 4C59A 1OL1A 1W82A 4KRCA 1YOLA 3ID6C 4MH7A 1H27A 3ULZA 3NLBA 3UC4A 3LAUA 1YOMA 4BCJA 2GTMA 1YHSA 3HDMA 1DS5A 4IX4A 3QX4A 1Z8LA 3BKBA 4BBEA 4XP2A 4DDGA 2R7IA 3A99A 3HL7A 2VTMA 5F09A 2P33A 3R7GA 5ETAA 3EN6A 3MJ2A 4FKOA 3ZO3A 4ANQA 4E6DA 5EQEA 4CKIA 2Z7RA 4MTAA 3FI3A 4XBUA 4ZY6A 3VONA 3DLZA 3L9LA 1XMMA 4FSMA 1M2PA 3ALNA 3EQGA 3Q4TA 1LUFA 4F1OA 2YM4A 4G9RA 2QONA 3DZOA 3IW6A 2XVDA 3D7HA 1M7QA 4JI9A 4YBKA 4IIRA 4CZYB 4DH5A 3WE4A 3FXXA 2W4KA 4JVGA 4O7VA 3Q3BA 2QOFA 3G90X 4E20A 1XBCA 3D4QA 3D2IA 3EFJA 3GU4A 3LCOA 5DR9A 4ASXA 2UW6A 4Y5HA 2ZAZA 5IKWA 4KKHA 5DRBA 4ZTQA 3R2YA 4DH8A 4AAYA 4Q2AA 2HXLA 2VWVA 4L53A 3ORMA 3AC8A 3TXOA 4RVTA 3ZO1A 5LCJA 1U59A 4S2ZA 3KRRA 1URCA 2XARA 5JGAA 1WBSA 3Q52A 4L9IA 4DFUA 3RAKA 3DQXA 3GP0A 2VTJA 3COMA 2VX3A 3LCSA 5JRQA 3TUDA 4LQGA 4FEQA 3BPRA 4FV8A 5M4CA 4YZ9A 4CFXA 4FA2A 2ONLC 4MCRA 3ORZA 3BI1A 3U55A 3AC5A 3OVVA 4PRJA 4KBKA 4E4LA 4IAAA 3DXQA 1M17A 2BALA 3LFDA 4OTRA 3P7AA 4DG3E 3PTGA 4IX6A 3QTXA 2VWZA 4OAUC 1Z57A 2IZTA 4N4SA 4M67A 3W2CA 4EH8A 3RCDA 3JR1A 3O5AA 4F70A 4EQCA 4FZDB 3HMJG 2JKMA 4AT4A 5HTCA 1AQ1A 4YLKA 3W32A 2YIQA 5CLPA 2UZWE 4J7BA 3A7IA 4QMXA 3JY0A 4F1MA 4AU8A 4E6CA 2CKOA 3COKA 4QDEA 2VWYA 4IZ5A 3GU8A 3E3BX 4D2VA 4QP7A 4L52A 1UKIA 3DAEA 4YZMA 3SC1A 4EUTA 4O83A 4QOXA 4ANSA 1XH6A 4AZWA 5AXIA 5CZIA 2PZPA 3DJ7A 4D5HA 2OZAA 5I9VA 4U7ZA 3FDNA 2PK9A 4OBQA 2XIXA 4JR3A 2GTNA 2ZM3A 4F6SA 1SVHA 4CG9A 3UZPA 5CF4A 4JIKA 3PJ3A 4RQVA 4V05A 4CG8A 3KXGA 1JLUE 5HVYA 3BRBA 3G15A 3FV8A 2X2LA 3LIJA 4RVMA 2NO3A 2OI4X 3TV7A 2AEGA 2HYYA 3BWFA 3QQHA 4MWIA 4AA0A 5FRIA 3R71A 5EHLA 5M4FA 1SNXA 5FG8A 3MYGA 2YN8A 4GVAA 4NEUA 5I9WA 5C4LA 4MCVA 4FG8A 5D11A 5H2UA 4AOTA 3VUHA 2H9VA 5L4QA 2XPNA 1ZY5A 3U4WA 3R6XA 5EW3A 2HXQA 4RC3A 4F7LA 4BCKA 5EYKA 4A4BA 4PTGA 2QNJA 3FKNA 4I4EA 1YI6A 2IZUA 4IEBA 3IG7A 4C57A 3RHXA 2ERKA 3S0OA 3ZSGA 2I7QA 2X4FA 3I0QA 3LFQA 4U44A 2BHEA 3ROCA 1W0XC 4Y83A 1OIYA 3TEIA 2G2FA 4FKQA 4FSZA 4CTBA 1TKIA 5M56A 4NCTA 1JWHA 4WNKA 2GHGA 5B2KA 5HIDA 1HCKA 1YWRA 4V04A 3RHKA 3DPKA 4IZYA 3FMMA 2VO6A 2OZAB 4F0GA 5L6PA 1WVWA 4P4JA 3P78A 1YXUA 3VAPA 3IQ7A 4E8AA 1WVXA 5F13A 3V5JA 3GOPA 1E1VA 1OZ1A 1TQPA 3BWJA 4FODA 3RTPA 4H58A 2FB8A 4PL5A 3FQSA 4RFZA 4AP7A 4QMNA 2UVXA 3DXNA 2NYAA 4IAKA 4M69A 5EW8A 3OTVA 3TG1A 4FEVA 3NMUF 4NGSA 4QMOA 5TT7A 1XH8A 3OOMA 2J7TA 4CZTA 3F6XA 3FXZA 5L2SA 1JQHA 2PVRA 2OIQA 5EOBA 4XV1A 3W0NA 3T8OA 4MNEB 3F3VA 3PXYA 4X2JA 3GI3A 2GSFA 4G3EA 3E88A 4I23A 2UZTA 4D0XA 3TM0A 4LFIA 5HD7A 1L3RE 3K3JA 5AR8A 5GZAA 5HESA 5LARA 2JBKA 2ZDUA 3SXRA 2F2CB 2P4IA 5FEQA 2UVYA 2HY0A 3DV3A 3F7WA 3PP1A 3B2WA 4IXPA 1OBDA 3KRWA 3PXRA 4D4YA <