4BTFA

Structure of mlkl
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
454
structure length
413
Chain Sequence
DKLGQIIKLGQLIYEQCEKMKYCRKQCQRLGNRVHGLLQPLQRLQAQGKKNLPDDITAALGRFDEVLKEANQQIEKFILFHEVNEKLRDVWEELLLLLQVPASWQQEDRQDAEEDGNENMKVILMQLQISVEEINKTLKQCSIPQDLQIKEIPKEHLGPPWTKLKTSKMSTIYRGEYHRSPVTIKVFNNPQAESVGIVRFTFNDEIKTMKKFDSPNILRIFGICIDQTVKPPEFSIVMEYCELGTLRELLDREKDLTMSVRSLLVLRAARGLYRLHHSETLHRNISSSSFLVAGGYQVKLAGFELSKTQNSISRTASSTIYVSPERLKNPFCLYDIKAEIYSFGIVLWEIATGKIPFEGCDSKKIRELVAEDKKQEPVGQDCPELLREIINECRAHEPSQRPSVDGILERLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MIXED LINEAGE KINASE DOMAIN-LIKE PROTEIN
publication title The Pseudokinase Mlkl Mediates Necroptosis Via a Molecular Switch Mechanism
pubmed doi rcsb
source organism Mus musculus
total genus 145
structure length 413
sequence length 454
ec nomenclature
pdb deposition date 2013-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4btfA02
1.20.930.20 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Adaptor protein Cbl, N-terminal domain 4btfA01
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4btfA03
4XYFA 4F9CA 2B0QA 3DK7A 2YERA 4XCUA 4FK3A 3TXOA 5AADA 5CANA 4QYHA 4O22A 1ZYSA 5TOZA 2QOFA 3O7LD 5CT0A 3TDWA 1YXUA 4LM5A 3T3UA 4D9UA 4EJNA 4F6UA 1U4DA 4USEA 4O82A 1H0VA 5IQHA 4DF3A 2H6DA 1G8SA 3MJ2A 5DPVA 1OM1A 3BUWB 3CP9A 5BUJA 4O27B 4GPLB 3GU6A 1YVJA 2LGCA 2WU6A 3PY1A 4M8TA 1V0OA 4IVAA 1X8BA 5CAVA 5E1SA 2NRUA 3FMLA 3NRMA 5L6WL 3UIBA 1H1SA 4AE9A 4I6HA 1JQHA 3BHUA 2ZYBA 3AC2A 3LPBA 1J1CA 1FINA 2V62A 2XBAA 1CM8A 3F61A 2VWVA 3ORIA 3BZ3A 3L9NA 4IWOA 3R1SA 2CHLA 2Y7JA 4E6CA 4RVMA 1M2PA 2BZHB 3AC5A 3LFBA 3UNZA 1WVXA 2QONA 4IZAA 1NVQA 4OT5A 4KSQA 4CRLA 2UV2A 5DEWA 5HG7A 4CKJA 4L53A 2Z7RA 5IUHA 2OF2A 1JSTA 3MPTA 1UNLA 3V5PA 1DS5A 2JEDA 1UNGA 4RBLA 2R3OA 3MB6A 3VRRA 4UWBA 3P0MA 4F63A 4WO5A 2Y4PA 1ZZ2A 1OMWA 1SVHA 2AC5A 5M44A 2ITPA 3W32A 3FLNC 4IM2A 5M57A 4Y5QA 5HIBA 1K9AA 4O7VA 2EU9A 3QQGA 3EN7A 2IZUA 2C6DA 3L8PA 2VRXA 2XS0A 5DRBA 4PNKA 5M53A 4NJDA 3GP0A 4FTLA 1GJOA 2HXQA 2YDKA 4X3JA 3GCVA 2ITZA 4FL1A 4E26A 3LXKA 4D1ZA 3ZFMA 4ZTLA 4G34A 1Z5MA 3WZDA 4EH9A 3RJCA 3EQDA 2QD9A 2JDOA 1FPUA 5LVPA 1Q62A 3PY3A 2QQ7A 3QTUA 2C5NA 4F6SA 4I4FA 2ETMA 3U51A 2C6OA 4O2ZA 4USDA 2XYNA 1MRUA 4IB0A 3H0ZA 3U9NA 4UXLA 4IMYA 4AP7A 1YDTE 4NTTA 3VULA 4MNEB 1KE5A 2F2CB 4N0SA 2WQBA 4J1RA 5EI2A 3VUTA 1JSVA 4LMNA 5ANKA 3TKHA 3A60A 1REKA 4PY1A 2WMAA 3OF0A 2IVVA 5HEZA 4KABA 3FAAA 3NUAA 4X3FC 1U59A 3R7VA 3PXYA 3LMGA 1XH7A 4BGGA 4QP2A 4TW9A 4QYFA 3UMWA 4CV9A 4DH3A 2R0IA 3DBCA 2BALA 4FUYA 4NT4A 3RPSA 4M97A 3TN8A 4DN5A 3C4XA 3NVKI 4MXOA 4IHPA 3Q9WA 1W83A 4FTRA 1U5QA 5IQEA 2WO6A 4WA9A 5AEPA 1KOAA 3P9JA 3Q5ZA 3FXXA 3HV4A 4OLIA 5BMMA 4CEGA 3U6HA 5C8KA 2XMYA 4FKGA 2CPKE 3DQWA 3I1AA 4G6OA 3QCYA 5CX9A 5IA3A 3R83A 1WZYA 3W2CA 1OPJA 4FICA 5AP3A 1J7IA 2Q83A 1APME 4B9DA 4NCTA 5AV2A 2Z2WA 4DEGA 4FGRA 3PZHA 1I44A 1YWNA 3IGGA 3QD3A 5BNJA 1H08A 4FTCA 3ZZWA 4P7EA 1JAMA 1GIIA 3WF8A 4FV6A 2QU6A 4EZ7A 4AUAA 4FG7A 1ZMWA 4AFJA 2PVFA 3CS9A 4OBPA 2I40A 4DGNA 4CG9A 1IAJA 5HBHA 4JRNA 1M17A 5L2QA 4O0UA 1R3CA 2BR1A 2YCFA 3ZLSA 4J8MA 1NY3A 3CGOA 5AV1A 5G1XA 3U54A 3FY2A 3TV6A 4AU8A 4KIKA 4E4MA 1LEZA 3O50A 3R7IA 2UZEA 4FKJA 4AGDA 1PXKA 2OZAA 4FSZA 4QPSA 3MJ1A 2W4KA 2R0UA 3BEAA 3U9CA 4C37A 4MK0A 2WMUA 2BILB 2W7XA 3FMDA 3GEQA 3OWLA 4PRJA 1Q61A 4HVSA 5A9UA 3RZBA 3ZM9A 2PMNX 5IUIA 4OBQA 3C4CA 1KE9A 1XBBA 4DG2E 3PRIA 3R63A 4XHKB 2X9EA 2RSVA 2WTCA 3UP7A 4EZ5A 3TUBA 5HE1A 1JBPE 3H9RA 2UZVA 4QTAA 3KKVA 3VUIA 2DQ7X 4CD0A 4ZLYA 3SGCA 2ITUA 5IA0A 4C33A 1ZMUA 2C4GA 3AT4A 5HBEA 3THBA 1KE7A 3SC1A 4UYNA 5A46A 2I7QA 4OT6A 3RWPA 3VW8A 5GJFA 2FYSA 5CYIA 3AMBA 1RJBA 2RF9A 1H1WA 4BGQA 4KS8A 4ANNA 4BIDA 1V1KA 4FZ7A 4EK8A 4MCVA 3NNWA 1STCE 3W33A 4FX3A 3IW7A 1FVRA 2XNGA 3VBVA 3P5KA 2R3NA 3FYJX 3QX2A 3OP0A 4UXQA 3N9XA 1PYXA 3HRBA 1DI9A 1JKLA 2Y4IB 4XUFA 3UOKA 2B9HA 2W1HA 4LOOA 5DG5A 3KN6A 4RX5A 3OTVA 5H3QA 2GQGA 5BPYA 3KF7A 4FIEA 4R5SA 5AP1A 3BHVA 3V01A 4D5KA 1DAYA 3HP5A 2O0UA 3JUHA 3U4UA 4CG8A 4BDBA 1Z9XA 2C3IB 4AW2A 4UMPA 3TZ7A 4D4YA 2BAKA 4LUDA 3BU6A 4ACGA 4I94A 4QP6A 4QYYA 4C4HA 4QMWA 4QMPA 4EYJA 5CEOA 3ZBFA 3EOCA 4IM0A 3P7BA 4RWLA 4E20A 4RJ8A 4BDIA 5M56A 4XNEA 1M14A 4RJ7A 4R8QA 3Q2MA 2J50A 5BYLA 5M4FA 2YACA 3PRFA 5CVFA 4F70A 3MFSA 4D28A 4DH8A 2G1TA 4KKGA 5AWMA 1XH4A 5ACBC 2FSMX 1PXLA 4DITA 4FKIA 2PTKA 1TQPA 4BRXA 3G0FA 1ND4A 3DBQA 4L7SA 3GU5A 3L8XA 3IOKA 3KB7A 3ZUVA 4EK5A 3EH9A 1RDQE 5JRQA 4O7YA 4JG8A 4R6VA 2VTHA 3FJQE 2WMWA 3RK7A 3PSDA 4C0TA 5M4IA 2C68A 3LQ8A 5IU2A 4KBCA 4DH5A 5IQAA 2FGIA 4C4FA 2F4JA 3FZTA 3COHA 4I0TA 4U5JA 4HZRA 1OL7A 3PVBA 5L8LA 3CPCA 4BHZA 4AZSA 4D0WA 4FVRA 5CSHA 5HCXA 4E6AA 2HY81 2PL0A 3PVUA 4HVGA 2WQEA 5AXIA 4ZTQA 2QLUA 4BCMA 4WT6A 4ZOGA 2XRWA 3IK3A 4ZJJA 1P5EA 4BCKA 2CMWA 3I5NA 4EZ3A 5M09A 4GK3A 4Y8DA 3DFCB 2YISA 5KKRB 4WUAA 3PVWA 4UMTA 2QG7A 1WBVA 4HYSA 5IMEA 3OHTA 4C3PA 5HI2A 4HOKA 3EQIA 3FQSA 4OTDA 5HO6A 4KBKA 3WF6A 5HORA 3TNIA 3S0OA 4FTMA 2HZNA 3PY0A 4QMVA 3WE4A 5AV0A 1URCA 4XG2A 3RZFA 1YWRA 4RJ4A 1UU8A 2WTKC 5CQUA 3WZEA 4B8MA 2C6MA 3V5QA 4ASEA 3R7GA 5DEYA 4IH8A 4R5YA 3T8OA 5F20A 4KIKB 2VAGA 4IC7A 3EJ1A 5DBXA 5AUVA 2OZAB 3P7CA 4GV1A 3EWHA 4QTBA 2I0YA 3ZEWA 1EH4A 3ZM4A 4BBEA 3PJCA 5ICPA 3HMOA 3OW3A 2NRYA 3FE3A 4RA5A 3F3VA 5LWMA 3OBJA 2ZMDA 3QC9A 4G9CA 2CGWA 4AA5A 3PPZA 3DKFA 5L3AA 2PUIA 3D7TA 3OT8A 2W99B 3PFQA 2YITA 4NM7A 3VRYA 4DFLA 2CBLA 3ZUTA 4UMRA 5DIAA 3ZMMA 2PE1A 2YA9A 2R3JA 4QD6A 1OVEA 5FXSA 4ALWA 1W0XC 4RX7A 1TVOA 3P79A 4TWPA 5HE3A 4YTCA 1W82A 1KSWA 3IDPA 5K4JA 5JK3A 5LMKA 4JVGA 3TTJA 3C0GA 3VJOA 3SKCA 5HO8A 5HG8A 2WMRA 3ZRKA 4BICA 4AF3A 5FEEA 4FNYA 4JX3A 5JKGA 3GCQA 1H26A 5C8NA 1SM2A 2VWWA 4MAOA 4OAUC 4KIOA 4GT5A 3JPVA 1NXKA 1OL1A 4J52A 4BCIA 1H1QA 1HOWA 3MVLA 5KMNA 2ZDTA 4EONA 2BDFA 1OPKA 4YJUA 4AWIA 3ZZEA 2C30A 2XEZA 4TPTA 4NWMA 2RGPA 2PVHA 3BUOB 4E5WA 2JDRA 3TG1A 4EH4A 2YN8A 3VO3A 4DINA 4FKRA 3A4PA 4DEBA 3VHEA 2AC3A 1R1WA 3RI1A 3LXNA 2BKZA 4HW7A 3H10A 3NCZA 2QC6A 2W1ZA 4MQ2A 4HPTE 4XX9A 3CJFA 5CEPA 3C5IA 4Q5EA 4YTHA 4NM5A 3DLZA 3O8UA 3RPOA 2QHNA 4KKEA 5TT7A 3MSSA 2VWXA 5ETAA 3C50A 3R9NA 4I21A 4CQEA 3Q60A 4LUEA 3H30A 2OO8X 4FTUA 1QL6A 1Y57A 2XNBA 3F66A 3FKNA 4J71A 3W8LA 2UZLA 4D2PA 4ZY5A 4H05A 4L44A 3JXWA 2C5VA 4IB3A 2NPQA 3ZS5A 5IMXA 3EQBA 3LQ3A 3SVVA 3ZO4A 5J7BA 2G2IA 3LCKA 1OL6A 5I4NA 2PULA 4YHFA 3QUDA 2GNHA 3AD6A 2XCHA 5HE2A 2IPXA 1YXTA 3OW4A 3LJ1A 3KCFA 4KRDA 3NPCA 2XM8A 5JGDA 4PTGA 5AAGA 5CXZA 2JKQA 4G31A 2PVNA 3MB7A 5E7RA 4S32A 4JIKA 4PDYA 4J95A 2XH5A 1H27A 5A14A 4UZHA 3R1QA 2HZIA 1L3RE 1WVYA 4P90A 2GNGA 3QKMA 3HNGA 4M13A 5F95A 1ZWSA 4C8BA 3UQFA 4EH2A 4GK2A 4CMOA 2JAMA 4DFZE 3D5VA 3M2WA 4G3CA 5CU6A 2OZOA 4PMPA 5J87A 3LFNA 2PMLX 4FZFB 2GQSA 5GIPE 4EH3A 5A6NA 2IO6A 3MWUA 3LCSA 1H01A 3BGQA 3EQCA 2P3GX 3EYGA 3PP0A 3HDMA 2VZ6A 3GOPA 2CKQA 3R22A 4J96A 4WBOA 3ZFYA 3PA4A 3R01A 4L8MA 3ZC6A 3QD2B 2YWVA 4K18A 1FVTA 2H96A 5TO8A 5GINE 1BMKA 2B1PA 3QRTA 4YLJA 1GZOA 4ENYA 2VX0A 1Q97A 3W1FA 4F65A 4D2SA 5CSPA 4P5ZA 1BYGA 2OXXA 3LIJA 3IECA 2J0JA 2RG6A 3QKKA 1Q3WA 4JX7A 4C62A 3OCTA 4DGOA 2HELA 2JBPA 3E3BX 5E8WA 3UG2A 2HXLA 5BVOA 3COMA 4IB5A 4ZZMA 4J53A 2PSQA 4BY9E 1WMKA 2PVRA 2V22A 4CFFA 2IG7A 1GZNA 3MYGA 3ENHA 2X4ZA 4YTIA 4K2RA 4RVLA 5H8EA 1LPUA 2A4LA 2E9VA 3FZPA 4XG8A 4YZBA 3SX9A 3V3VA 4JT3A 4KUJA 4RIOA 4U81A 4FKUA 4MXXA 2C1BA 2JKKA 3Q4UA 4EI4A 1G5SA 2PE0A 2GMXA 4X3FA 3D7TB 3RHKA 4IDTA 4EBWA 3MN3A 3MY0A 3NVMB 3T9TA 4V01A 3AGMA 4XS2A 4UBAA 5HD4A 2GFSA 1PW2A 4ITJA 3TWJA 3V8TA 1Q24A 3NUYA 2F7XE 3AD4A 3ORTA 3GQLA 3SV0A 4F0GA 4TTHB 4Q9SA 5FP6A 2VTTA 4JAJA 4M66A 4YMJA 3RPVA 2I0VA 4QP3A 4QMYA 3VS2A 4DC2A 3A99A 2RKUA 1L8TA 2NO3A 4O81A 5A54A 3UNKA 5CENA 2V7OA 1XHAA 4DLJA 5J8IA 1UU3A 2IVUA 2YIYA 3HRCA 3I4BA 4FV9A 4JDIA 4IWPA 5AP0A 4BIBA 4LL5A 4APPA 4QMNA 4QMZA 4TKSA 3MESA 3UZRA 3CKXA 3WZJA 5IA1A 5EI8A 4I4EA 3PFVA 5HZNA 4XG7A 1VYWA 3BLRA 4UALA 4EWHA 2JAVA 4TY1A 4IQ6A 4NL0A 3SD0A 2ITQA 2R5TA 4FTOA 3MPAA 4FV5A 4LV8A 3Q4CA 2OFVA 3AGLA 4BBMA 4TYJA 5DT3A 3EFWA 2B9JA 4FTTA 4P4CA 3G9LX 4UMQA 4HVHA 5CF4A 4QMXA 4R7BA 3QQHA 4E4LA 3F7WA 1V0PA 2VWYA 4QTCA 2UZNA 3ULIA 3BE2A 4TL0A 4USFA 5I9XA 3W2QA 5HX8A 4LGGA 1SVEA 4JIAA 5F1ZA 3ZEPA 5I5ZA 4ITIA 5HD7A 5CU4A 3G51A 3I6UA 4FSYA 4YJNA 3R9DA 4RPVA 2O2UA 5M4UA 2YDIA 2UW8A 4G2FA 3OFMA 4XRLA 5AUXA 1PMEA 5B7VA 3PVGA 2C6TA 2HW6A 3JYAA 3NDMA 2GNFA 2PMIA 3C4EA 3QYWA 3VUKA 2BHEA 5AR7A 5HCZA 3D9VA 4GFGA 5CF6A 4JOAA 3CD3A 2ITWA 3PE2A 1KV1A 3RPYA 5HLPA 1YVHA 3NYNA 5E1EA 2BIYA 2QOOA 4F64A 3ZRMA 3A7IA 3SOCA 4IFGA 3VBQA 3B2WA 2XNNA 3DT1A 2C3KA 3R71A 2EB3A 4YJOA 4PDPA 4C35A 4F7SA 3UO4A 3ITZA 4BTMA 5HESA 1B47A 2I1MA 3AQVA 3F3TA 4C4EA 3FUPA 3A8WA 5EYCA 4O38A 4PUZA 3I5ZA 4GG7A 5DOSA 1WBPA 2XVDA 3WYYA 4LQMA 1XO2B 5KCVA 2CNVA 3PSCA 4QOXA 3DZQA 4M12A 4EQMA 4AZVA 4BWKA 2OICA 2XK8A 3BI6A 4TWCA 1ZYDA 3GU8A 3OXZA 4GL9A 4M84A 5M55A 4QTEA 5EKNA 2CSNA 4R1VA 2EXCX 3POZA 4CRSA 4LFIA 5L2TA 5JFWA 2XJ1A 1UWHA 3ZXZA 4AQCA 4HYHA 2WXVA 5BVEA 2P4IA 2V0DA 3I7CA 3JY9A 4ZEGA 3S4QA 4BKJA 3ETAA 2GS7A 2YM3A 2C69A 1FMKA 5I9UA 2J0MB 3EFJA 4MX9A 3OT3A 3QHWA 2X8DA 3PTGA 4GU6A 4C2VA 5BVNA 3DXQA 4U3YA 4ZIMA 4IACA 4GIIA 4JLCA 4DH1A 3LLAA 2C0TA 4BDCA 3QBNA 4ANMA 2OXDA 4IE9A 3NW5A 3W55A 4DBXA 3FZ1A 4GUEA 4GKIA 2KTYA 3GUBA 3KVWA 3R21A 4H1MA 3QQLA 3V5WA 4MEDA 4CV8A 4EH8A 4JDKA 1OUYA 2VX1A 1J7LA 5KMLA 3SHEA 3IW5A 4L9IA 2RFNA 4I24A 2ZV8A 4JL9A 4X3FB 2P2HA 3HECA 4MHAA 4Y46A 5I9VA 2BRGA 4F7NA 4CQGA 1WBSA 1KV2A 4N4SA 3DV3A 5DWRA 4FEQA 3HV7A 3SQQA 2HCKA 2C0IA 4IJPA 3UTOA 3ZBXA 1O9UA 4E3CA 2RG5A 1YDSE 3ORNA 4HYIA 2UZDA 5I0BA 2ZB0A 3QQFA 4G9RA 4DG3E 5FEDA 5DNRA 2WKMA 4C59A 2JBOA 1XBAA 4XH6A 3G2FA 4P2KA 1LEWA 3HRFA 5DT4A 1JOWB 2BDJA 5E8ZA 3ZRLA 2J0LA 4RJ3A 1F0QA 3LCTA 3UC3A 5M4CA 3V8WA 2V55A 3BQCA 5IA4A 4RLLA 2VGPA 4FODA 2QOCA 3A62A 3BLHA 2C0OA 2ITYA 5DLSA 4I1ZA 4HCUA 5A4CA 3GGFA 5BUIA 2BZJA 3KRWA 4A4BA 4IEBA 3GVUA 3KREA 2JIVA 3EZVA 2YJRA 3Q53A 4HYUA 2UVXA 4D55A 5AX3A 2X7OA 4MVFA 5K5NA 3VN9A 3F3UA 4EHEA 4XLVA 4DHFA 2A2AA 2IWIA 3F5UA 3R2BA 5C26A 2YLFA 3HUBA 3V51A 2KULA 3IW8A 3TUDA 3CTHA 3TZ8A 5D11A 4KB8A 5E91A 4GT4A 3D5XA 5E8SA 1PRYA 1GOLA 1XH9A 3T3VA 4O7NA 4O7WA 5I3RA 2PVLA 3L9PA 2W5HA 1OBGA 1OZ1A 3LJ0A 3QX4A 3PP1A 2WD1A 4HGLA 2V5QA 4UEUA 4HCVA 3POOA 4RWIA 4QP7A 4A9UA 5BUEA 5J5TA 2EXEA 1KWPA 4FT7A 4DYMA 4A07A 4L3PA 3DAKA 4LOPA 2WIPA 5TR6A 3VJNA 3LLTA 2VTAA 3CQUA 4AGCA 2VO3A 3FQHA 3TKIA 1YW2A 5KUPA 5HICA 3PUPA 3DB6A 3FYKX 4IC8A 1URWA 2W1CA 1QCFA 2PZYA 2VTQA 3LXPA 1YXXA 4C7TA 3W8QA 2WFYA 5LQFA 4UWYA 3UZPA 2R64A 5E9EA 5IQBA 3C0IA 3P4KA 3R6XA 3OBGA 3UBDA 5LVNA 4KS7A 1G8AA 4DFXE 4PF4A 5D1JA 4O0SA 1IASA 4N57A 5GZ9A 2W1EA 5EI6A 3Q9XA 1Y91A 1IG1A 2BRBA 1S9JA 5A4QA 3JVRA 3R8MA 2CGVA 4EK6A 2PYWA 1R39A 1CTPE 1YI6A 4WIHA 3WF7A 2F49A 3MA3A 4LRKA 4IAAA 5IH5A 3OTUA 3MPMA 3Q4TA 4JNWA 3ALNA 5TKDA 4ONAA 5D41A 1S9IA 3ELJA 4YR8A 4ORKA 3KRLA 1JKKA 5JFVA 4GU9A 3ZOSA 2B54A 2CCIA 5CAUA 3P08A 3R7EA 2R3MA 3F2NA 1YI3A 3UPXA 3QTQA 5BVWA 3PJ3A 1RE8A 1WBWA 3CR0A 3RVGA 2BVAA 3QA8A 3KA0A 3V04A 2W5BA 4PPAA 2XIZA 2VTLA 5DYJA 4DLIA 2JGZA 3DZOA 4PL5A 4BZDA 3ORXA 2I6LA 4X2GA 5LMBA 4JBPA 3UIXA 2FB8A 1PMNA 3NW7A 2XK7A 3DU8A 2C6EA 1TQMA 2ZV7A 2R3HA 2WQOA 3DXNA 4XOYA 2BAJA 2XJ2A 3R8VA 4EQUA 2BUJA 1YXSA 2Z60A 4ZXTA 4CCUA 3QL8A 3IDBA 3WZKA 2YM8A 4F6WA 4YPDA 4J8NA 1OKVA 1WFCA 2ZV9A 3HLLA 3O0GA 4BB4A 3ZHPC 4L00A 5HLWA 3DAJA 2XK4A 4WOVA 3DKCA 1BI7A 4EC8A 1NVRA 4ZSAA 5A4EA 3KXZA 3M42A 4FKPA 3IOPA 4BCJA 3ZLWA 4QQCA 3MFRA 3CTQA 5HTCA 4KAOA 5AM7A 3ZO3A 5HX6A 4ZP5A 2X1NA 4L45A 4HVIA 5DT0A 4D1SA 4G3EA 4UZDA 3U4WA 3TZ9A 3O2MA 3CSVA 3O23A 4NH1A 3FMJA 5LMAA 5ANEA 2HOGA 5KMKA 3BYVA 3KL8A 1U5RA 1MQBA 3TNWA 4RJ6A 1IR3A 4GCJA 5AMNA 5IDNA 4FV4A 3W10A 4Y95A 1SMHA 1TQIA 4RQKA 2AUHA 4YSMA 4JBOA 3HZTA 5HG9A 2CGXA 3MFUA 4PDSA 5IEXA 5HHWA 4ANQA 4D9TA 3MI9A 4EK3A 3VF9A 3RM7A 2R3QA 3B2TA 3CEKA 3DCVA 2IW8A 4GKHA 1IA8A 4K11A 1H8FA 4QMLA 4QP1A 4O86A 4QQTA 4QTDA 3DQXA 5CXHA 1AD5A 3D15A 4FTJA 4PP7A 4CVAA 3VROA 4ERWA 3QTRA 4BF2A 4CMUA 2WTKB 3OC1A 3PWDA 2WTWA 2OIQA 4X21A 3AG9A 5IA5A 5GZ8A 4QMQA 3A7JA 4XV2A 3L9MA 3SXSA 4BCQA 5J79A 2CNQA 4AGUA 4LOQA 4FG9A 4O1PA 5AP2A 1JLUE 5GHVA 2UVZA 4MXAA 2R9SA 4NEUA 5DHJA 1MRYA 2GTMA 5DH3A 2ZB1A 4FKTA 4XV9A 4AZFA 4DEAA 4DFYA 1U46A 3ZCLA 4RVKA 1XBCA 2IW6A 4QMOA 4YZNA 4EKLA 2FUMA 4RFMA 2XNMA 5FG8A 3W2OA 4AOIA 4BWXA 2QLQA 3L1SA 3WARA 4B99A 3CIKA 4IJ9A 3FL4A 3E63A 4GVAA 3NEWA 4OUCA 4EQCA 4UV0A 3TNHA 3V5TA 5KMOA 4EOMA 3LMHA 4M69B 3MH3A 4WNMA 2ZMCA 1OIYA 4I23A 2B55A 2HWPA 2YLEA 2X4FA 4FUXA 3Q6WA 4FG8A 4ZSLA 2R7BA 3LCOA 1Q5KA 2UZUE 2OFUA 3AMYA 3IGOA 3FLQA 4PL3A 3CD8A 4MXZA 4EH7A 3RBWA 4GYIA 3K2LA 2NP8A 2FSOX 4X6QC 3V5JA 5EM8A 2VUWA 5LVMA 3Q04A 4C61A 3C4ZA 3D5UA 3REPA 2A0CX 4O0RA 4UY9A 2J4ZA 4QMSA 4QP9A 3HX4A 4O1OA 3UOHA 2XZSA 4JQ7A 2B9FA 3FQEA 5HG5A 3A7GA 4BWPA 2OH4A 5KMMA 5J9YA 2OIBA 5L8JA 4JQ8A 1OBDA 5CNNA 1RQQA 4BI1A 5FDPA 1H4LA 4H1JA 2OU7A 4KINA 4R7HA 3R7OA 4FK6A 3GFEA 4WHZA 4YZDA 4X2FA 3UQCA 4CFNA 2XIXA 3GU7A 3LFQA 5EYMA 4CGAA 3RK9A 3F9NA 2A27A 3DGKA 5H2UA 2PUPA 3PE1A 4Q5HA 2FSLX 4FNZA 4S31A 4DG0E 4GVJA 5FM3A 3F5XA 1E1VA 2PUUA 3D2KA 4EHGA 4QP4A 2VV9A 3LFEA 4A9SA 5DFPA 3AC4A 5EM7A 3KXXA 2XIRA 3QWJA 3VS3A 4FYOA 1M2QA 3UYSA 4PPBA 2HYYA 3QWKA 4I5MA 1Q8YA 4QYGA 5AFVA 1O6LA 3GT8A 1VZOA 4L67A 3TCPA 3MA6A 5HBJA 1YDRE 2EVAA 4MD7E 5AP5A 3VQUA 4A7CA 2C6IA 4OBOA 3WF9A 3KFAA 3NAXA 3LQ5A 2J2IB 2YCSA 4DGLC 4U44A 2VTIA 2VTNA 3MVMA 3VUMA 3VWAA 4NYEA 3CCNA 4ACHA 3FMNA 2BTSA 3BYOA 5CI7A 3GOKA 2J7TA 1OKYA 2UW5A 3DA6A 4OTRA 4QO9A 3ID6C 4YLKA 5EM6A 2BROA 3VS7A 5IUGA 2E9OA 3OEFX 4HGEA 2FO0A 4J7BA 3E3PA 3NUPA 3WOWA 3FHRA 2XKFA 3AC8A 4HJOA 5ANJA 4MTAA 1PMUA 4MF0A 3R02A 4O6LA 4H39A 3ZSIA 3G0EA 5HU9A 2PVMA 4CZTA 5LCJA 2QOLA 2C47A 4GK4A 1GNGA 1M7QA 2HW7A 5BMSA 2ITNA 4TNDA 3EKKA 3EQGA 2OK1A 3G9NA 1F5QA 1NT2A 2R7IA 3ORPA 3QXPA 4FOBA 4OTFA 5FWKK 3UOLA 4ASDA 3OUNB 4G17A 4OTHA 2GNJA 4U42A 3LFFA 4ZTMA 4N70A 4NM0A 1W84A 4NM3A 1GY3A 5ANOA 5CTPA 5CT7A 4YPSA 5KE0A 3NX8A 1PYEA 5A6OA 5JQ5A 3DJ7A 4V04A 3BUXB 1QPJA 3CE3A 3OWPA 4TYEA 4FT5A 4OTPA 1WBNA 2QHMA 5IKWA 2PVYA 5CF8A 1GZKA 2O8YA 3QCSA 2QU5A 3GBZA 5L6PA 1ZYLA 2Z02A 2OBJA 3VRNA 4DTAA 4R3PA 5AUTA 3IDCA 2QI8A 3O8PA 4ERKA 4FI1A 1QPEA 2QOKA 1YKRA 4X0MA 5JGAA 4RIYA 3OB1B 3VBXA 5CVHA 4YZMA 2XJ0A 5EKOA 4K9YA 2PE2A 4O84A 3DDQA 3OCBA 3QLFA 4GJ2A 2PY3A 1XH8A 1Z57A 5AV3A 4QNYA 2OLCA 2P2IA 2C5XA 5K0KA 2YJSA 3KN5A 5AUYA 1ZXEA 2Z7LA 3UVRA 3SXFA 2ONLC 1ZY4A 2GSFA 1W98A 5JZNA 3DK6A 4E5BA 4CCBA 3EN5A 2GHGA 4X2JA 2VO0A 3Q96A 2GS6A 3ZU7A 4G1WA 4LRJA 3QZHA 3VRPA 2W5AA 5LARA 4YJQA 2OI4X 3WIGA 4LG4A 5GNKA 4EJ7A 2P55A 3SW4A 2JIUA 3DPKA 2VN9A 4FTAA 3AC1A 4XP2A 4C34A 1B6CB 2ESMA 1BL7A 3R00A 5JT2A 2F57A 4BDGA 3MV5A 4O0TA 3RMFA 4KRCA 2RFSA 2WTIA 2GPHA 3PXKA 2Y6MA 5D7VA 5HKMA 4PTCA 4Y5HA 5IPJA 4IBMA 3W2SA 5CZHA 4FV0A 4L01A 3FMKA 3EKNA 2GDOA 4FIJA 5AR8A 2Q0NA 4AN2A 4BCFA 2FA2A 4ALUA 4CLJA 3VC4A 5IA2A 2XRUA 1H25A 5BVKA 4EHVA 5J9ZA 4U9AA 2J0KA 3TIYA 4W4VA 2OF4A 2ERZE 1E1XA 3COKA 3F5PA 1XKKA 3OZ6A 3QTIA 4CXAA 5CAOA 3QKLA 1JSUA 3D5WA 4S30A 4RVTA 1CKJA 4I0SA 5LWNA 5AAFA 3U6IA 4Y73A 2H34A 2C5YA 3DBDA 5IEVA 4PPCA 1ZOGA 2WQMA 3CJGA 3RGFA 1ZOEA 2JFLA 3N4UA 3BU3A 3Q3BA 5AP4A 4A4CA 2UZWE 3HV3A 4EH5A 4F0IA 3P23A 2HENA 4O7SA 3ZTXA 3ZNIA 2PHKA 2IW9A 5AUWA 4GIHA 4RJ5A 3EQRA 3BRBA 4MWHA 4BC6A 4YNEA 5JGBA 1CKPA 4U45A 3BHTA 5E8XA 3VW6A 4BDKA 1CSNA 3LFSA 4XBRA 3L8VA 2X7GA 4M7IA 3EMGA 3EQPA 4FL3A 4L6QA 5AM6A 5LCKA 1REJA 2J51A 2VTSA 3KC3A 5M08A 4O0XA 1UU9A 2CN8A 4OW8A 1Q99A 2XCKA 1IA9A 2GHMA 3C4WA 4F9YA 5CASA 3ATTA 4E73A 5FXRA 2WQNA 2ZAZA 4CFMA 5GIOE 3SA0A 1H1PA 4A9RA 4ASXA 4X6RA 4UWCA 1OITA 3DB8A 3I60A 2Y8OA 3UVQA 1NW1A 5IG1A 2C6LA 3E8CA 4FVQA 4W8EA 4ASZA 3MTFA 4AX8A 5I9ZA 3LFCA 4IM3A 5AR5A 1RW8A 1PKDA 4NCTC 2R3LA 3VVHA 4MWIA 4YURA 4D2RA 5BVDA 5E8VA 4GEOA 3TJDA 3NS9A 4AT3A 2RFEA 2BRHA 4M0ZA 2PZPA 3AT2A 4NTSA 3VAPA 2PUNA 2PMOX 4IAZA 3UO5A 1Y6AA 4NKAA 5BVFA 2YABA 3PPKA 4BCPA 4KNBA 5FTOA 3R8PA 5J3XA 4V0GA 3UPZA 4R3RA 4F7LA 5FM2A 3UC4A 4EK4A 4O7ZA 4BI0A 1U54A 1TKIA 2W17A 4I92A 3E7OA 4NSTA 5CAPA 4FC0A 1M7NA 4XMOA 2WTDA 1J7UA 3QU0A 1CKIA 1VJYA 2WIHA 4DCAA 4RZWA 4APCA 1SNUA 3MVHA 3FY0A 3KMUA 2JDVA 3UNJA 3R9RA 2E9PA 4FBXA 4C4JA 4W4XA 4U0IA 1M52A 2IN6A 3OXTA 3WYXA 2Q0BA 4O2PA 4TYHA 3I7BA 4AN3A 4F1TA 2IZSA 3F88A 2X2KA 5LVLA 4UYAA 4BDDA 4UMUA 3UODA 4II5A 4OTWA 3TACA 4IAKA 2GNLA 4C36A 3U87A 3ZO2A 1SNXA 3AOXA 4LYNA 4AZWA 3P86A 1HCKA 1FGIA 3ZONA 1YI4A 2REIA 2X0GA 2B53A 4JG6A 4RIYB 4WUNA 1ZZLA 3D4QA 5CEIA 4BTJA 4C02A 3I0QA 3O96A 4MD8E 4IX4A 2PPQA 2P0CA 3NYOA 4E7WA 4HVDA 5HKYA 4L42A 2CNUA 4R77A 1O6KA 2HIWA 3NIEA 4XG3A 1ZARA 5H8GA 4C3RA 4DFBA 3HAMA 4F9AA 5HQ0A 3TM0A 3OEZA 5K0XA 4QYEA 4FA2A 2Y1MA 2CLXA 4ZY4A 4BTKA 1YXVA 2UW4A 3VNTA 3CPBA 4HNFA 4CNHA 3NW6A 4U80A 3RP9A 5AV4A 3RNYA 3NGAA 2W06A 4JR3A 3TT0A 4LI5A 2A19B 3ULZA 3CKWA 3DAEA 3MY5A 4NIFA 4BI2A 4PMSA 2C1AA 1PHKA 5KX8A 3UDBA 3KXMA 5ETCA 4RFZA 1YHSA 4C2WA 4AW1A 3BUNB 4ID7A 1PXPA 2BDWA 4ZTSA 4DCEA 3NAYA 4WSQA 5FRIA 3MW1A 3TNPC 4AZTA 4PX6A 4I6BA 2PU8A 2G2FA 1H24A 3ZSHA 4LMUA 1KE8A 5C01A 1OI9A 4Y83A 4IAFA 3G6GA 4YJPA 2DWBA 4AE6A 3VS5A 1V0BA 2YHVA 4ZAUA 5KHXA 2W05A 2WHBA 4WG5A 5DR6A 3R8UA 5JEBA 3MTLA 3QRUA 4IZYA 4IVCA 4LV5A 4O96A 5AP7A 3E8DA 5L2IA 2UUEA 4AOJA 4RX8A 2J5FA 5JH6A 5IQCA 4N6YA 4MBIA 4DFUA 2VGOA 4QMTA 3DY7A 5IISA 3VUDA 1K2PA 3C7QA 3OB2B 2ZOQA 3DXPA 2H8HA 4CZYB 2UW6A 5CU3A 5HVJA 4B8LA 4O0YA 1J3HA 2CJMA 5FUTA 2F2UA 4U8ZA 4HPUE 4IWDA 3ROCA 4D4SA 3NNXA 3OROA 2JFMA 3I6WA 3ROYA 4XG9A 4I5HA 4RT7A 3CBLA 4BCOA 4JR7A 4M68A 2IJMA 3PIYA 4EOJA 4DTBA 3C0HA 4Z7HA 3FI3A 2YZLA 3E8NA 3PJ1A 5EDQA 1R78A 5ANIA 5C9CA 3HGKA 5BYYA 2QKWB 3EFLA 1NA7A 3HV6A 3OWKA 3ZSGA 4BTFA 3ZLXA 3H3CA 4YZCA 3WF5A 2VTRA 2YCQA 3EN6A 4BDJA 3RM6A 2SRCA 4PL4A 3BGPA 2CKPA 5EHLA 4FTKA 3R1NA 4DAWA 3FXZA 4XG4A 5CEMA 3BBTB 4MXCA 4FIIA 3NCGA 2E9UA 5LOHA 3QUEA 3FPQA 4GYGA 4DGMA 2UW9A 3QQUA 4HGTA 3CXWA 3BPRA 1H0WA 4QMMA 2X81A 5J95A 4FV3A 1QMZA 4FF8A 3KULA 4AG8A 4YNOA 3QQKA 4WRGA 3PLAE 1Y6BA 2BCJA 4IB1A 1OIRA 1ZYJA 3OP5A 1OKZA 4KIQA 5KBRA 2HZ4A 3SG9A 3UIUA 5ANGA 4V0GB 4ZS0A 3MIAA 3F3ZA 1U54B 2ITOA 3PXRA 3DKOA 5J5SA 4UX9A 2FSTX 3GNIB 2HAKA 5EM5A 5CALA 5KNJA 3QLGA 4ALVA 2GS2A 5J7HA 4JAIA 5K4IA 4W4YA 2B7AA 4ZLZA 1IAHA 5IH6A 1ZMVA 4TYHB 2RL5A 5TE0A 2QOIA 1LUFA 3UZTA 3KRJA 2IVTA 1Q8ZA 4BDFA 3ANQA 3ZDUA 3OS3A 1UNHA 2V7AA 3FZRA 4TZRA 3E92A 4BCNA 2W0JA 5EYKA 4U40A 4YGAA 1OB3A 3LFAA 2EXMA 4MXYA 4E5AX 2QOHA 3Q4ZA 3F6XA 1ZAOA 2XKEA 3FKOA 2QOBA 3DNDA 2W9FB 3AT3A 1UU7A 2VNYA 4CYIA 3UG1A 2C5OA 4O21A 3ATSA 5IF1A 5JSMA 4MF1A 1J1BA 4GFMA 3K3IA 1FMOE 1YOMA 1FGKA 1GZ8A 2WU7A 2VWBA 4TYIA 4L3LA 4BN1A 3RINA 5A4TA 5BX0A 1ZRZA 2VWIA 4MD9E 4FTNA 3KMWA 1YQJA 4FT9A 1F3MC 3BGZA 4NIFB 5CSWA 2E2BA 3RPRA 3QTWA 2BAQA 2J6MA 4GRBA 2BRNA 3Q9ZA 3I79A 1FQ1B 3B8QA 5HIEA 4I5PA 2QKRA 4ANBA 4UN0C 2OIDA 4J97A 4L46A 4S33A 1IEPA 4XG6A 3UYTA 4F9WA 4AXAA 2CGUA 1BUHA 4JBVA 3DDPA 5J1WA 3C4FA 4ZMFA 2BIKB 3S1HA 4GUBA 4JDHA 2HWOA 2JKMA 1G3NA 3F82A 2IZTA 3KU2A 3KY2A 3HEGA 5E90A 4G16A 1Q3DA 3PXQA 3FLSA 3G15A 4YO6A 4W9WA 3NLBA 4RX9A 4D2WA 4E6QA 1KUTA 3EN4A 3KXGA 1OGUA 2JLDA 2XF0A 3OY1A 4AW0A 5EW3A 4EOLA 3A4OX 4M69A 3NWWA 3BU5A 5HOAA 3ZYAA 1OECA 5CVGA 5AUZA 4G6NA 4I6QA 3E87A 3S2PA 5HTIA 3PA5A 4TNBA 3BWJA 2XM9A 5AA9A 5IQFA 5CAQA 2G01A 3OUKA 4RC3A 4K77A 3PJ8A 4OAVB 5HTBA 3NUUA 1UWJA 4EC9A 3V6SA 1OL2A 2XIYA 3VBWA 3R30A 5T6KA 4QMUA 4ANSA 2X9FA 3OOGA 5I9YA 4AW5A 4NFMA 3HL7A 4NJ3A 4Q9ZA 3DOGA 3Q6UA 3ZXTA 4BHNA 2ONLA 2X8EA 4EOIA 5A3XA 4ANOA 1QPDA 3GB2A 3LVPA 2W96B 5CF5A 4AZEA 3QC4A 3OCSA 4DEIA 4RA4A 5C8MA 3M1SA 3ALOA 4IX6A 3F2RA 3E7VA 4YHTA 3N51A 2EB2A 2YZAA 5HIDA 2OJ9A 4FSRA 3OXIA 4A4OA 4E1ZA 3M11A 5D12A 3RCDA 4U79A 4F09A 4Z3VA 4XP3A 3R9OA 1B39A 1H07A 4ITHA 5M07A 1VEBA 1Y8YA 3IW4A 1MUOA 3KXHA 4K0YA 4QRCA 3BWFA 3RK5A 4CKIA 4YC3A 1ATPE 4I0RA 3BHYA 1JKSA 5GZAA 2W9ZB 4R7IA 4ZJIA 4L7FA 4B0GA 4XLIA 3BYMA 3E88A 3D2IA 2OJGA 2W1FA 2PZRA 4CLIA 1WBOA 4RMZA 1Q8WA 4CZUA 5EQPA 2X6DA 4FT0A 5DE2A 3R7YA 4ZS4A 3GCSA 4FKQA 2H9VA 3DTWA 3KRRA 3KULB 2BZIB 1JNKA 4DEHA 5E4HA 2CN5A 3G90X 5IZFA 5EG3A 3CGFA 2WMBA 3NSZA 2VTJA 2B52A 3E62A 3EYHA 3T9IA 4C4GA 3TTIA 5CWZA 4GSBA 1UA2A 4I5CA 5LVOA 4X7QA 5EYDA 2YIXA 4KSPA 3FMHA 3QYZA 3KVXA 4PP9A 3EIDA 4AOTA 2QNJA 3LAUA 2WEIA 5EW8A 4FV8A 1PXIA 4IADA 4Y85A 3RCJA 3FLYA 4DBNA 4ZLOA 2CDZA 2QVSE 2YFXA 3F3WA 1ZYCA 2ZVAA 3F7ZA 3OWJA 3RHXA 3DJ6A 3PPJA 3GC7A 4BYJA 3NNUA 3OOMA 5J1VA 3SOAA 3OG7A 2R2PA 2WTJA 2GNIA 2ZM3A 3GC0A 5EDRA 3WE8A 4PWNA 5HNIX 2JDTA 4F7JA 1Q8UA 5K9IA 1NVSA 2OG8A 3CQWA 3II5A 3RAIA 4KBAA 4HNIA 4FKVA 1OUKA 3IW6A 5CEKA 1VYZA 2E9NA 5CI6A 4AFEA 2QG5A 3RAHA 3PXFA 5FDXA 4FMQA 4R1YA 5IQGA 4O6EA 2VWZA 3U8WA 2UW3A 4FNWA 3HMNA 5E92A 3FDNA 1Q41A 3LE6A 5JMSA 3GI3A 3PWYA 3QTZA 2YIWA 3HV5A 1ZLTA 3D7ZA 5H9BA 4NFNA 5AIRA 3PIZA 5KZIA 4U6RA 3ET7A 1OIUA 3C9WA 3ORMA 4BBFA 5AIKA 2WGJA 3IS5A 2C3LA 3UVPA 1YRPA 5EOLA 3MS9A 5C27A 3QA0A 3FLZA 3TNQB 4L68A 4DFNA 3A7HA 2VTMA 3G33A 3P1AA 4C57A 4G5PA 2J90A 5ANDA 4FNXA 2JKOA 4HZSA 4JQEA 3VS4A 3QRIA 3QD4A 5H8BA 4F99A 4M15A 4NU1A 3GENA 4IZ7A 4W8DA 4CT2A 3K5VA 3RTPA 2X2MA 3UJGA 5AAEA 4W9XA 1W7HA 2ITTA 3TKUA 4TWNA 1UKHA 2XA4A 5FP5A 4Z9LA 4KWPA 5EHOA 2CKOA 4EOSA 5DMZA 3DJ5A 4CFUA 1T45A 2QO2A 4IZ5A 2DYLA 5KMJA 5D10A 2VTPA 3BQRA 5EH0A 3FI8A 2UZBA 4ACCA 4H58A 3ZO1A 3NZ0A 4HGSA 4AA4A 1SZMA 3C51A 3BYUA 3F2AA 3FXWA 3F5GA 4FTQA 4IWQA 4QPAA 1M2RA 2WMTA 3SAYA 3LCDA 3AC3A 1IRKA 5DA3A 4BL1A 3COIA 2QR7A 2FH9A 3FI4A 1Q4LA 2XNPA 3H9OA 5FTQA 4AA0A 4CYJA 5JN2A 4PV0A 4WRSA 2DUVA 2GU8A 5C4LA 4BYIA 4JRVA 2QR8A 3E5AA 4OTGA 5DI1A 4WNOA 4BIEA 5L2SA 3PXZA 4EKKA 3W18A 3HA6A 4F08A 2R3IA 1DAWA 5FD2A 3VIDA 4YP8A 4F9BA 5E8UA 5B2LA 1P2AA 4JJRA 1LR4A 2G2HA 2UW7A 2W4JA 2RIOA 3L8SA 3PA3A 3TIZA 4EBVA 4EH6A 4QNAA 5E8YA 3LMIA 2XNEA 5B2KA 4IVBA 5J9LA 5LXMA 3DK3A 3QGYA 4XV3A 3TEIA 3SRVA 4W4WA 1JVPP 2UW0A 4J98A 4I20A 5T3QA 3R8ZA 2XB7A 3A61A 5EHYA 3KK9A 1BLXA 4BDHA 3C5UA 4WG3A 3QZIA 5T68A 2RFDA 4CFWA 4RGJA 3F69A 2X7FA 4IAYA 4YHJA 4KKHA 2Z7SA 5EQYA 3DLSA 3LOKA 2GCDA 2JDSA 3CY3A 4U43A 4GS6A 3LM0A 3ORKA 4I3ZA 3R04A 3EL8A 2R3GA 2YEXA 5L8KA 4XOZA 5GJGA 5CU0A 2XBJA 3FSKA 1BL6A 4BFMA 3PSBA 4QQ5A 3R2YA 3TDVA 3R0TA 4Z16A 4IX3A 4CSVA 3VBYA 1GIJA 2ERKA 3MIYA 3H9FA 3QRJA 5CY3A 1WBTA 4H3PA 3BHHA 3WILA 1P4OA 2W1IA 2YDJA 4V05A 1K3AA 4FV7A 1XH6A 4FZ6A 3O8TA 3K3JA 4IXPA 5JRSA 4WG4A 3SXRA 4BDEA 2YAKA 5FBNC 4M3QA 3HKOA 4GMYA 3Q9YA 3FEGA 4OTQA 3MFTA 4JG7A 3RNIA 3ZC5A 4F0FA 4FGBA 3WBLA 3VGOA 4LGDA 5JFSA 5FXQA 1GAGA 1FOTA 5F94A 2W1GA 4CFVA 2YIRA 3FSFA 4FSQA 4GJ3A 4EUUA 4NW5A 3QXOA 2GTNA 5L6OA 3OY3A 2XK6A 5HNGA 4BKZA 3ERKA 1OKWA 3EQHA 3PJ2A 3JR1A 4DE4A 3QCQA 4K8AA 3RALA 5HCYA 4FZDB 5CQWA 3CY2A 3O51A 2YAAA 4YSJA 4AGWA 1R0EA 5FQDC 3NYVA 2R3KA 5AR2A 3W16A 3HVCA 3SW7A 3V8SA 2VTOA 4FSMA 2J9MA 3ORZA 4FV2A 4X2KA 5CNOA 5FGKA 4K33A 3IONA 1KE6A 1Q8TA 4FSNA 4H3QA 1OPLA 4KD1A 4B6LA 2X2LA 3EB0A 3KGAA 4EOPA 5L2WA 3CTJA 2BRMA 4FZAB 4FKOA 5IDPA 1PMVA 3BLQA 3G6HA 3EFKA 4JI9A 3D83A 3KCKA 4TN6A 3QALE 3V5LA 4ZSEA 2XEYA 4D4RA 4BCGA 4LRMA 1P4FA 2GFCA 3ZDIA 2GQRA 2O64A 3MDYA 4NK9A 3R1YA 3VRZA 4ZZOA 4BZOA 3SG8A 2Z7QA 2YCRA 4M0YA 4LL0A 4JS8A 3BIZA 3U55A 1O6YA 4ZZNA 2UVYA 3PG3A 3RAWA 4EUTA 3ORLA 2HY0A 5DR2A 2F7EE 5FTGA 2HZ0A 5E8TA 3VQHA 3CLYA 3DNEA 3DS6A 4YZ9A 1T46A 3FMEA 4NW6A 3FL5A 2C6KA 4XRJA 2WMVA 3NNVA 4NZWB 5CLPA 4JDJA 2QCSA 3A7FA 3FPMA 5JQ8A 2F7ZE 5GJDA 3NR9A 2BFYA 2CKEA 5AUUA 3FZSA 2QODA 3MH0A 3S95A 2WPAA 1CDKA 1PF8A 2WMSA 4AS0A 1J91A 2VX3A 4IX5A 4E6DA 3LFDA 4ACDA 2Y4IC 2IVSA 5HU3A 3QZGA 4TXCA 5BYZA 3HMMA 1XR1A 2QOQA 3LKMA 1VR2A 3PYYA 3ACJA 3LM5A 3GCUA 4AN9A 5K5XA 4RIWA 3PG1A 4S2ZA 5IH4A 2XKCA 3PLSA 5DR9A 4FEVA 1E9HA 3DTCA 3BBWA 4IVDA 3AXWA 3VHKA 2O3PA 4DT8A 2OSCA 4D0XA 1H28A 5AP6A 1PXJA 4GT3A 4WKQA 5I3OA 4ZSJA 3LZBA 3VUGA 4A4XA 2XK3A 3TV7A 2Y1NA 4XJ0A 4ANLA 4YBKA 5F9EA 3SRVB 4BDAA 3OCGA 2UZOA 3PIXA 2ITXA 4RSSA 4WNPA 1PXNA 4FOCA 2QO7A 4RIXA 3H4JA 4ZK5A 1XQZA 4G3GA 2A1AB 1A9UA 2X39A 3QTXA 4IAIA 5HO7A 3HUCA 2ETKA 3QUPA 4FIFA 3BELA 4O91A 1XWSA 3RKBA 4EOOA 2PZIA 4EYMA 2J5EA 4XBUA 4DT9A 3QF9A 2XP2A 1DI8A 4PDOA 1JPAA 4LGHA 4GH2A 4C38A 2O5KA 1KOBA 3BV3A 3TJCA 4K1BA 3N4VA 4GFOA 5ETIA 2WELA 5AX9A 4MQ1A 3KEXA 3UE4A 2JC6A 3B8RA 4A4LA 4CT1A 3UOJA 4AAAA 3ANRA 3UQGA 2OWBA 4EWQA 3VS0A 5HE0A 4E4NA 2Y0AA 2BZKB 3WI6A 4P5QA 2ACXA 3JY0A 4WBBB 3DFAA 1DM2A 4RWJA 3Q2JA 4FKWA 2OH0E 2WMQA 2I0HA 3W2RA 4O7LA 4ZTNA 3C13A 3IQ7A 2YIQA 3BKBA 3IO7A 3AMAA 3FC2A 4FEWA 2J0IA 4RC4A 4G3DA 2YM5A 4IIRA 1YOJA 4OR5A 3LJ2A 5I9WA 5CEQA 4O0VA 5IEYA 1W8CA 4EHZA 2P33A 3ACKA 4RLKA 1PXOA 3FZOA 5B2MA 3OMVA 1HCLA 1BI8A 3QQJA 2BFXA 2EWAA 2ITVA 2X8IA 3QD0A 1I09A 2HK5A 5KKRC 4FL2A 3HP2A 3VUHA 5C03A 3K5UA 4A06A 1UV5A 4NKSA 2NNWB 3GC8A 2X6EA 3SDJA 2CLQA 2ZDUA 2B9IA 4TWOA 2C3JA 2BTRA 4ENXA 5IQIA 5K3YA 4BR3A 2G15A 3GFWA 1AQ1A 4L43A 2OGVA 3MY1A 2WEVA 3ODYX 4PMTA 3IG7A 3JS2A 2R3FA 1CMKE 3QCXA 1BKXA 4E4XA 3BV2A 4EORA 4H36A 5DRDA 3OD6X 1ZY5A 2OW3A 4R78A 2XYUA 4BCHA 1YHWA 2VO7A 4ZTHA 4XEYA 4D4VA 5KHWA 2WTVA 4FYNA 4YJSA 4EOQA 4U97A 4YLLA 5CZIA 3TZMA 4YU2A 3HMIA 3TI1A 5KO1A 4QQJA 5IQDA 3FBVA 2OXYA 4CFXA 4L52A 4QPMA 3TV4A 5LJJA 2YWPA 3P7AA 4U41A 4WSYA 4TYGA 4CKRA 3LHJA 3ZLYA 4A9YA 2OJIA 5ETFA 1ZOHA 4YJRA 4ARKA 3FI2A 4FVPA 1LP4A 3QAME 4FSTA 3R8LA 3HMPA 3O7LB 4G6LA 4RFYA 1MP8A 1YWVA 2EUFB 3ENMA 3QHRA 5DGZA 4DEEA 4JXFA 4BVUA 3NUSA 4J99A 4AT5A 3NYXA 3OVVA 4U7ZA 3BYSA 4XV1A 5TF9A 4G3FA 4YJTA 3E8EA 1A06A 4IDVA 1PY5A 4KIPA 2XUUA 4YC8A 1QPCA 2YM6A 2R4BA 5EOBA 4CTBA 5JFXA 3Q52A 3ZFXA 3PZEA 4FIGA 3EL7A 3O71A 4FKSA 2G9XA 3ODZX 3DBFA 3MH2A 2OKRA 5CSVA 4DH7A 3FC1X 3GC9A 5HKWA 2WB8A 1FBNA 4FE2A 5KMIA 3GQIA 4F1MA 4E8AA 3BEGA 3Q32A 3QZFA 4EEVA 1OL5A 5EW9A 4PNIA 2WNTA 2PVJA 4OTIA 2XIKA 2BKKA 2R3PA 4ZJVA 3U6JA 3FKLA 3KXNA 2LAVA 4MH7A 2I0EA 2Z8CA 1UKIA 3MGYA 2PWLA 2VD5A 4RIWB 1MQ4A 4QT1A 2OJFE 4FEUA 3QGWA 4IANA 2W1DA 4RRVA 3BUMB 3DKGA 3D14A 4MBJA 4G5JA 3EQFA 2O65A 2VU3A 4DTKA 1B38A 3BCEA 2PZ5A 2VO6A 3IPHA 2ETRA 3R73A 4KA3A 4MNFA 3R7UA 1OIQA 2JITA 5AR4A 3UMXA 3CC6A 4I41A 4TRLA 2BPMA 3KF4A 5M06A 4PQNA 2PVKA 3JVSA 3NMUF 3Q5IA 5FLFA 1WVWA 3FLWA 4D5HA 4RIXB 5AA8A 4CTCA 3QFVA 5ITAA 4O0WA 4F1OA 3VF8A 4F4PA 2JD5A 3BX5A 5HLNA 4IW0A 3FV8A 5HNBA 4K6ZA 5ACKA 3S3IA 3UO6A 5JZJA 2VWUA 5BQ0A 2QO9A 2WOUA 5HKZA 2IZRA 5HVKA 4YC6A 2VNWA 4D2TA 1R0PA 2UZTA 3NUXA 4Q2AA 3R9HA 4EL9A 3VRQA 2O63A 3D0EA 3ZUUA 1XJDA 5DVRA 3HDNA 3E64A 5B0XA 3TL8A 1GIHA 2JIIA 3MVJA 1A48A 2BHHA 4YJVA 2BMCA 3FHIA 3EN9A 3IKAA 4FTIA 3VS6A 1PJKA 4O7RA 2W4OA 3UP2A 4NUSA 4FIHA 5L4QA 3GXLA 3V6RA 5CU2A 3VS1A 5AR3A 2ZM1A 5G6VA 1UVRA 5C1QB 2CCHA 4YUQA 4O7TA 3HYHA 4WD5A 3A8XA 3KRXA 4M67A 3S00A 5C4KA 1SYKA 2Y9QA 1Y8GA 2DS1A 4E93A 4DA5A 3HAVA 3K54A 3G5DA 3AD5A 3PDTA 2WMXA 4XP0A 4BKYA 4ACMA 3L9LA 3WZUA 4PTEA 3UGCA 5CSXA 4YTFA 4C4IA 3O17A 2ZM4A 3DBEA 4M14A 4A9TA 3KK8A 3GU4A 4CMTA 4DGGA 1YHVA 4AT4A 3FWQA 3W2PA 2WAJA 4FEXA 2XKDA 3I81A 1FBVA 5EDPA 4TT7A 1WAKA 1SVGA 4U3ZA 5EK7A 4FV1A 5HVYA 4ZTRA 3RWQA 1MRVA 2XNOA 3CQEA 4FT3A 4MKCA 5A4LA 2ZV2A 4RC2A 5KBQA 3LXLA 4DEDA 4GW8A 4O83A 3R28A 1FVVA 2PK9A 4I22A 3ZH8A 3MBLA 4MBLA 2WZJA 5EFQA 5FEQA 4UB7A 2YM4A 5EQEA 3I0OA 3H0YA 4JBQA 4RG0A 4BGHA 4X2NA 5KZ0A 3FMMA 3KMMA 3QTSA 4B7TA 4MNEA 5M51A 5HGIA 4YBJA 3EZRA 4FSUA 4I6FA 4PMMA 2B4SB 5AJQA 4ZY6A 3UIMA 5D9HA 1PKGA 2YM7A 4I93A 1AGWA 4WNKA 1WCCA 1JWHA 4MYGA 3VBTA 4BZNA 2R3RA 3N4TA 1XH5A 4D58A 4D1XA 4HCTA 3TUCA 4QP8A 2XK9A 4RWKA 1PXMA 3C1XA 1H1RA 2FVDA 4RQVA 1JKTA 4C3FA 3P78A 4IFCA 2WOTA 5D7AA 4C58A 3HA8A 4ZSGA 4S34A 4L3JA 4YO4A 5CS6A 4Z7GA 5LMKC 1YOLA 3SLSA 4D2VA 4GG5A 2OJJA 4EOKA 4H3BA 4N6ZA 4OGRA 4FSWA 1ERKA 3KQ7A 4RZVA 3E93A 4AACA 1P14A 4B4LA 2ZJWA 3D94A 4FR4A 2GHLA 3RAKA 2F9GA 3MH1A 3A2CA 2AYPA 3NUNA 3QRKA 4FKLA 4Y72A 3PLFB 1H00A 3GCPA 4R3CA 5DN3A 4Z55A 5FBOA 3LW0A 5F4NA 2QURA 3EHAA 3NIZA 3WIKA 3BE9A 2Y6OA 4ZMEA 1BX6A
chains in the Genus database with same CATH superfamily
4XYFA 4F9CA 3D7FA 2B0QA 3DK7A 2YERA 4XCUA 4FK3A 3TXOA 5AADA 5CANA 4QYHA 4O22A 1ZYSA 5TOZA 2QOFA 3O7LD 5CT0A 3TDWA 1YXUA 4O4FA 4LM5A 3T3UA 4D9UA 4EJNA 4F6UA 1U4DA 4USEA 4O82A 4RR2B 1H0VA 5IQHA 4DF3A 2H6DA 1G8SA 3MJ2A 5DPVA 1OM1A 3BUWB 3CP9A 5BUJA 4O27B 4GPLB 3GU6A 1YVJA 2LGCA 2WU6A 3PY1A 4M8TA 4P44A 1V0OA 4P4EA 4IVAA 1X8BA 5CAVA 5E1SA 2NRUA 3FMLA 3NRMA 5L6WL 3UIBA 1H1SA 4AE9A 4I6HA 1JQHA 3BHUA 2ZYBA 3AC2A 3LPBA 1J1CA 1FINA 2V62A 2XBAA 1CM8A 3F61A 2VWVA 3ORIA 3BZ3A 3L9NA 4IWOA 3R1SA 2CHLA 2Y7JA 3BL9A 4E6CA 4RVMA 1M2PA 2BZHB 3AC5A 3LFBA 3UNZA 1WVXA 2QONA 4IZAA 1NVQA 4OT5A 4KSQA 4CRLA 2UV2A 5DEWA 5HG7A 4CKJA 4L53A 2Z7RA 5IUHA 2OF2A 1JSTA 3MPTA 1UNLA 3V5PA 1DS5A 2JEDA 1UNGA 4RBLA 2R3OA 3MB6A 3VRRA 4UWBA 3P0MA 4F63A 4WO5A 2Y4PA 1ZZ2A 1OMWA 1SVHA 2AC5A 5M44A 2ITPA 3W32A 3FLNC 4IM2A 5M57A 1W2CA 4Y5QA 5HIBA 1K9AA 4O7VA 2EU9A 3QQGA 4AXDA 3EN7A 2IZUA 2C6DA 3L8PA 2VRXA 2XS0A 5DRBA 4PNKA 5M53A 4NJDA 3GP0A 4FTLA 1GJOA 2HXQA 2YDKA 4X3JA 3GCVA 2ITZA 4FL1A 4E26A 3LXKA 4D1ZA 3ZFMA 4ZTLA 4G34A 1Z5MA 3WZDA 4EH9A 3RJCA 3EQDA 2QD9A 2JDOA 1FPUA 5LVPA 1Q62A 3PY3A 2QQ7A 3QTUA 2C5NA 4F6SA 4I4FA 2ETMA 3U51A 4P4DA 2C6OA 4O2ZA 4USDA 2XYNA 1MRUA 4IB0A 3H0ZA 3U9NA 4UXLA 4IMYA 4AP7A 1YDTE 4NTTA 3VULA 4MNEB 1KE5A 2F2CB 4N0SA 2WQBA 4J1RA 5EI2A 3VUTA 1JSVA 4LMNA 5ANKA 3TKHA 3A60A 1REKA 4PY1A 2WMAA 3OF0A 2IVVA 5HEZA 4KABA 3FAAA 3NUAA 4X3FC 1U59A 3R7VA 3PXYA 3LMGA 1XH7A 4BGGA 4QP2A 4TW9A 4QYFA 3UMWA 4CV9A 4DH3A 2R0IA 3DBCA 2BALA 4FUYA 4NT4A 3RPSA 4M97A 3TN8A 4DN5A 3C4XA 3NVKI 4MXOA 3NFFB 4IHPA 3Q9WA 1W83A 4FTRA 1U5QA 5IQEA 2WO6A 3AKLA 4WA9A 5AEPA 1KOAA 3P9JA 3Q5ZA 5BV3A 3FXXA 3HV4A 4OLIA 5BMMA 4CEGA 3U6HA 5C8KA 2XMYA 4FKGA 2CPKE 3DQWA 3I1AA 4G6OA 3QCYA 5CX9A 5IA3A 3R83A 1WZYA 3W2CA 1OPJA 4FICA 5AP3A 1J7IA 2Q83A 1APME 4B9DA 4NCTA 5AV2A 2Z2WA 4DEGA 4FGRA 3PZHA 1I44A 1YWNA 3IGGA 3QD3A 5BNJA 1H08A 4FTCA 3ZZWA 4P7EA 1JAMA 1GIIA 3WF8A 4FV6A 2QU6A 4EZ7A 4AUAA 4FG7A 1ZMWA 4AFJA 2PVFA 3CS9A 4OBPA 2I40A 4DGNA 4CG9A 1IAJA 5HBHA 4JRNA 1M17A 5L2QA 4O0UA 1R3CA 2BR1A 2YCFA 3ZLSA 4J8MA 1NY3A 3CGOA 5AV1A 5G1XA 3U54A 3FY2A 3TV6A 4AU8A 4KIKA 4E4MA 1LEZA 3O50A 3R7IA 2UZEA 4FKJA 4AGDA 1PXKA 2OZAA 4FSZA 4QPSA 3MJ1A 2W4KA 2R0UA 3BEAA 3U9CA 4C37A 4MK0A 2WMUA 2BILB 2W7XA 3FMDA 3GEQA 3OWLA 4PRJA 1Q61A 4HVSA 5A9UA 3RZBA 3ZM9A 2PMNX 5IUIA 4OBQA 3C4CA 1KE9A 1XBBA 4DG2E 3PRIA 3R63A 4XHKB 2X9EA 2RSVA 2WTCA 3UP7A 4EZ5A 3TUBA 5HE1A 1JBPE 3H9RA 2UZVA 4QTAA 3KKVA 3VUIA 2DQ7X 4CD0A 4ZLYA 2XAOA 2ITUA 5IA0A 4C33A 1ZMUA 2C4GA 3AT4A 5HBEA 3THBA 1KE7A 3SC1A 4UYNA 5A46A 2I7QA 4OT6A 3RWPA 3VW8A 5GJFA 2FYSA 5CYIA 3AMBA 1RJBA 2RF9A 1H1WA 4BGQA 4KS8A 4ANNA 4LDTA 4BIDA 1V1KA 1W2DA 4FZ7A 4MCVA 3NNWA 1STCE 3W33A 4FX3A 3IW7A 1FVRA 2XNGA 3VBVA 3P5KA 2R3NA 3FYJX 3QX2A 3OP0A 4UXQA 3ML1A 3N9XA 1PYXA 3HRBA 1DI9A 1JKLA 2Y4IB 4XUFA 3UOKA 2B9HA 2W1HA 4LOOA 5DG5A 3KN6A 4RX5A 3OTVA 5H3QA 2GQGA 5BPYA 3KF7A 4FIEA 4R5SA 5AP1A 3BHVA 3V01A 4D5KA 4NGNA 1DAYA 3HP5A 2O0UA 1Z9EA 2IF8A 3JUHA 3U4UA 4CG8A 4BDBA 1Z9XA 2C3IB 4AW2A 4UMPA 3TZ7A 4D4YA 2BAKA 4LUDA 3BU6A 4ACGA 4I94A 4QP6A 4QYYA 4C4HA 4QMWA 4QMPA 4EYJA 5CEOA 3ZBFA 3EOCA 4IM0A 3P7BA 4RWLA 4E20A 3W0PA 4RJ8A 4BDIA 5M56A 4XNEA 1M14A 4RJ7A 4R8QA 2DLAA 3Q2MA 2J50A 5BYLA 5M4FA 2YACA 3PRFA 5CVFA 4F70A 3MFSA 4D28A 4DH8A 2G1TA 4KKGA 5AWMA 1XH4A 5ACBC 2FSMX 1PXLA 4DITA 4FKIA 2PTKA 1TQPA 4BRXA 3G0FA 1ND4A 3DBQA 4L7SA 3GU5A 3L8XA 3IOKA 3KB7A 3ZUVA 4EK5A 3EH9A 1RDQE 5JRQA 4O7YA 4JG8A 4R6VA 2VTHA 3FJQE 2WMWA 4FRFA 3RK7A 3PSDA 4C0TA 5M4IA 2C68A 3LQ8A 5IU2A 4KBCA 4DH5A 5IQAA 2FGIA 4C4FA 2F4JA 3FZTA 3COHA 4I0TA 4U5JA 4HZRA 1OL7A 3PVBA 5L8LA 3CPCA 4BHZA 4AZSA 4D0WA 4FVRA 5CSHA 5HCXA 4E6AA 2HY81 2PL0A 3PVUA 4HVGA 2WQEA 5AXIA 4ZTQA 2QLUA 4BCMA 4WT6A 4ZOGA 2XRWA 3IK3A 4ZJJA 1P5EA 4BCKA 2CMWA 3I5NA 4EZ3A 5M09A 4GK3A 4Y8DA 3DFCB 2YISA 5KKRB 4WUAA 3PVWA 4UMTA 2QG7A 1WBVA 4HYSA 5IMEA 3OHTA 4C3PA 5HI2A 4HOKA 3EQIA 3FQSA 4OTDA 5HO6A 4KBKA 3WF6A 5HORA 3TNIA 3S0OA 4FTMA 2HZNA 3PY0A 4QMVA 3WE4A 5AV0A 1URCA 4XG2A 3RZFA 1YWRA 4RJ4A 1UU8A 2WTKC 5CQUA 3WZEA 4B8MA 2C6MA 3V5QA 4ASEA 3R7GA 5DEYA 4IH8A 4R5YA 3T8OA 5F20A 4KIKB 2VAGA 4IC7A 3EJ1A 5DBXA 5AUVA 4AXFA 2OZAB 3P7CA 4GV1A 3EWHA 4QTBA 2I0YA 3ZEWA 1EH4A 3ZM4A 4BBEA 3PJCA 5ICPA 3HMOA 3OW3A 2NRYA 3FE3A 4RA5A 3F3VA 5LWMA 3OBJA 2ZMDA 3QC9A 4G9CA 2CGWA 4AA5A 3PPZA 3DKFA 5L3AA 2PUIA 3D7TA 3OT8A 2W99B 3PFQA 2YITA 4NM7A 3VRYA 4DFLA 2CBLA 3ZUTA 4UMRA 5DIAA 3ZMMA 2PE1A 2YA9A 2R3JA 4QD6A 1OVEA 5FXSA 4ALWA 1W0XC 4RX7A 1TVOA 3P79A 4TWPA 5HE3A 4YTCA 1W82A 1KSWA 3IDPA 5K4JA 5JK3A 5LMKA 4JVGA 3TTJA 3C0GA 3VJOA 3SKCA 5HO8A 5HG8A 2WMRA 3ZRKA 4BICA 4AF3A 5FEEA 4FNYA 4JX3A 5JKGA 3GCQA 1H26A 5C8NA 1SM2A 2VWWA 4MAOA 4OAUC 4KIOA 4GT5A 3JPVA 1NXKA 1OL1A 4J52A 4BCIA 1H1QA 1HOWA 3MVLA 5KMNA 2ZDTA 4EONA 2BDFA 1OPKA 4YJUA 4AWIA 3ZZEA 2C30A 2XEZA 4TPTA 4NWMA 2RGPA 2PVHA 3BUOB 4E5WA 2JDRA 3TG1A 4EH4A 2YN8A 3VO3A 4DINA 4FKRA 3A4PA 4DEBA 3VHEA 2AC3A 1R1WA 2C6CA 3RI1A 3LXNA 2BKZA 4HW7A 3H10A 3NCZA 2QC6A 2W1ZA 4MQ2A 4HPTE 4XX9A 3CJFA 5CEPA 3C5IA 4Q5EA 4YTHA 4NM5A 3DLZA 3O8UA 3RPOA 2QHNA 4KKEA 5TT7A 3MSSA 2VWXA 5ETAA 3C50A 3R9NA 4I21A 4CQEA 3Q60A 4LUEA 3H30A 2OO8X 4FTUA 1QL6A 1Y57A 2XNBA 3F66A 3FKNA 4J71A 3W8LA 2UZLA 4D2PA 4ZY5A 4H05A 4L44A 3JXWA 2C5VA 4IB3A 3TYKA 2NPQA 3ZS5A 5IMXA 3EQBA 3LQ3A 3SVVA 4BPUB 3ZO4A 5J7BA 2G2IA 3LCKA 1OL6A 5I4NA 2PULA 4YHFA 3QUDA 2GNHA 3AD6A 2XCHA 5HE2A 2IPXA 1YXTA 3OW4A 3LJ1A 3KCFA 4KRDA 3NPCA 2XM8A 5JGDA 4PTGA 5AAGA 5CXZA 2A98A 2JKQA 4G31A 2PVNA 3MB7A 5E7RA 4S32A 4JIKA 4PDYA 4J95A 2XH5A 1H27A 5A14A 4UZHA 3R1QA 2HZIA 1L3RE 1WVYA 4P90A 2GNGA 3QKMA 3HNGA 4M13A 5F95A 1ZWSA 4C8BA 3UQFA 4EH2A 4GK2A 4CMOA 2JAMA 4DFZE 3D5VA 3M2WA 4G3CA 5CU6A 2OZOA 4PMPA 5J87A 3LFNA 2PMLX 4FZFB 2GQSA 5GIPE 4EH3A 5A6NA 2NYAA 2IO6A 3MWUA 3LCSA 1H01A 3BGQA 3EQCA 2P3GX 3EYGA 3PP0A 3HDMA 3SJXA 2VZ6A 3GOPA 2CKQA 3R22A 4J96A 4WBOA 3ZFYA 3PA4A 3R01A 4L8MA 3ZC6A 3QD2B 2YWVA 4K18A 1FVTA 2H96A 5TO8A 5GINE 1BMKA 2B1PA 3QRTA 4YLJA 1GZOA 4ENYA 2VX0A 1Q97A 3W1FA 4F65A 4D2SA 5CSPA 4P5ZA 1BYGA 2OXXA 3LIJA 3IECA 2J0JA 2RG6A 3QKKA 1Q3WA 4JX7A 4C62A 3OCTA 4DGOA 2HELA 2JBPA 3E3BX 5E8WA 3UG2A 2HXLA 5BVOA 3COMA 4IB5A 4ZZMA 4J53A 2PSQA 4BY9E 1WMKA 2PVRA 2V22A 4CFFA 2IG7A 1GZNA 3MYGA 3ENHA 2X4ZA 4YTIA 4K2RA 4RVLA 5H8EA 4DHJA 1LPUA 2A4LA 2E9VA 3FZPA 4XG8A 4YZBA 3SX9A 3V3VA 4JT3A 4KUJA 4RIOA 4U81A 4FKUA 4MXXA 2C1BA 2JKKA 3Q4UA 4EI4A 1G5SA 2PE0A 4NGPA 2GMXA 4X3FA 2AQXA 3D7TB 3RHKA 4IDTA 4EBWA 3MN3A 3MY0A 3NVMB 3T9TA 4V01A 3AGMA 4XS2A 4UBAA 5HD4A 2GFSA 1PW2A 4ITJA 3TWJA 3V8TA 1Q24A 1G8KA 3NUYA 2F7XE 3AD4A 3ORTA 3GQLA 3SV0A 4F0GA 4TTHB 4Q9SA 5FP6A 2VTTA 4JAJA 4M66A 4YMJA 3RPVA 2I0VA 4QP3A 4QMYA 3VS2A 4DC2A 3A99A 2RKUA 1L8TA 2NO3A 4O81A 5A54A 3UNKA 5CENA 5F09A 2V7OA 1XHAA 4DLJA 5J8IA 1UU3A 2IVUA 2YIYA 3HRCA 3I4BA 4FV9A 4JDIA 4IWPA 5AP0A 4BIBA 4LL5A 4APPA 4QMNA 4QMZA 4TKSA 3MESA 3UZRA 3CKXA 3WZJA 5IA1A 5EI8A 4I4EA 3PFVA 5HZNA 4XG7A 1VYWA 3BLRA 4UALA 4EWHA 2JAVA 4TY1A 4IQ6A 4NL0A 3SD0A 4OC4A 2ITQA 2R5TA 4FTOA 3MPAA 4FV5A 4LV8A 4OC5A 3Q4CA 2OFVA 3AGLA 4BBMA 4TYJA 5DT3A 3EFWA 2B9JA 4FTTA 4P4CA 3G9LX 4UMQA 4HVHA 5CF4A 4QMXA 4R7BA 3QQHA 4E4LA 3F7WA 1V0PA 2VWYA 4QTCA 2UZNA 3P5JC 3ULIA 3BE2A 4TL0A 4USFA 5I9XA 3W2QA 5HX8A 4LGGA 1SVEA 4JIAA 5F1ZA 3ZEPA 5I5ZA 4ITIA 4DHIB 5HD7A 5CU4A 3G51A 3I6UA 4FSYA 4YJNA 3R9DA 4RPVA 2O2UA 5M4UA 2YDIA 2UW8A 4G2FA 3OFMA 4XRLA 5AUXA 1PMEA 5B7VA 3PVGA 2C6TA 2HW6A 3JYAA 3NDMA 2GNFA 2PMIA 3C4EA 3QYWA 3VUKA 3W0MA 2BHEA 5AR7A 5HCZA 3D9VA 4GFGA 4O4EA 5CF6A 4JOAA 3CD3A 2ITWA 3PE2A 1KV1A 3RPYA 5HLPA 1YVHA 2C6PA 3NYNA 5E1EA 2BIYA 2QOOA 4F64A 3ZRMA 3A7IA 3SOCA 4IFGA 3VBQA 3B2WA 2XNNA 3DT1A 2C3KA 3R71A 2EB3A 4YJOA 4PDPA 4C35A 4F7SA 3UDZA 3UO4A 3ITZA 4BTMA 5HESA 1B47A 2I1MA 3AQVA 3F3TA 4C4EA 3FUPA 3A8WA 5EYCA 4O38A 4PUZA 3I5ZA 4GG7A 5DOSA 1WBPA 2XVDA 3WYYA 4LQMA 1XO2B 5KCVA 2CNVA 3PSCA 4QOXA 3DZQA 4M12A 4EQMA 4AZVA 4BWKA 2OICA 2XK8A 3BI6A 4TWCA 1ZYDA 3GU8A 3OXZA 4GL9A 4M84A 5M55A 4QTEA 5EKNA 2CSNA 4R1VA 2EXCX 3POZA 4CRSA 4LFIA 5L2TA 5JFWA 2XJ1A 1TFFA 1UWHA 3ZXZA 4AQCA 4HYHA 2WXVA 5BVEA 2P4IA 2V0DA 3I7CA 3JY9A 4ZEGA 3S4QA 4BKJA 3ETAA 2XAMA 2GS7A 2YM3A 2C69A 1FMKA 5I9UA 2J0MB 3EFJA 4MX9A 3OT3A 3QHWA 2X8DA 3PTGA 4GU6A 4C2VA 5BVNA 3DXQA 4U3YA 3BHXA 4ZIMA 4IACA 4GIIA 4JLCA 4DH1A 3LLAA 2C0TA 4BDCA 3QBNA 4ANMA 2OXDA 4IE9A 3NW5A 3W55A 4DBXA 3FZ1A 4GUEA 4GKIA 2KTYA 3GUBA 3KVWA 3R21A 4H1MA 3QQLA 3V5WA 4MEDA 4CV8A 4EH8A 4JDKA 1OUYA 2VX1A 1J7LA 5KMLA 3SHEA 3IW5A 4L9IA 2RFNA 4I24A 2ZV8A 4JL9A 4X3FB 2P2HA 3HECA 4MHAA 4Y46A 5I9VA 2BRGA 4F7NA 4CQGA 1WBSA 1KV2A 4N4SA 3W0SA 4NGQA 3DV3A 5DWRA 4FEQA 3HV7A 3SQQA 2HCKA 2C0IA 4IJPA 3UTOA 3ZBXA 1O9UA 4E3CA 2RG5A 1YDSE 3ORNA 4HYIA 2UZDA 3BXMA 5I0BA 2ZB0A 3QQFA 4G9RA 4DG3E 5FEDA 5DNRA 2WKMA 4C59A 2JBOA 1XBAA 4XH6A 3G2FA 4P2KA 1LEWA 3HRFA 5DT4A 1JOWB 2BDJA 5E8ZA 3ZRLA 2J0LA 4RJ3A 1F0QA 3LCTA 3UC3A 5M4CA 3V8WA 2V55A 3BQCA 5IA4A 4RLLA 2VGPA 4FODA 2QOCA 5BY0A 3A62A 3BLHA 2C0OA 2ITYA 5DLSA 4I1ZA 4HCUA 5A4CA 3GGFA 5BUIA 2BZJA 3KRWA 4A4BA 4IEBA 3GVUA 3KREA 2JIVA 3EZVA 2YJRA 3Q53A 4HYUA 2UVXA 4D55A 5AX3A 2X7OA 4MVFA 5K5NA 3VN9A 3F3UA 4EHEA 4XLVA 4DHFA 2A2AA 2IWIA 3F5UA 3R2BA 5C26A 2YLFA 3HUBA 3V51A 2KULA 3IW8A 3TUDA 3CTHA 3TZ8A 5D11A 4KB8A 5E91A 4GT4A 3D5XA 5E8SA 1PRYA 1GOLA 1XH9A 3T3VA 4O7NA 4O7WA 5I3RA 2PVLA 3L9PA 2W5HA 1OBGA 1OZ1A 3LJ0A 3QX4A 3PP1A 2WD1A 4HGLA 2V5QA 4UEUA 4HCVA 3POOA 4RWIA 4QP7A 5ELYA 3SJFA 4A9UA 5BUEA 5J5TA 1TZDA 2EXEA 1KWPA 4FT7A 4DYMA 4A07A 4L3PA 4AXCA 4NGTA 3DAKA 4LOPA 2WIPA 5TR6A 3VJNA 3LLTA 2VTAA 3CQUA 4AGCA 2VO3A 3FQHA 3TKIA 1YW2A 5KUPA 5HICA 3PUPA 3DB6A 3FYKX 4IC8A 1URWA 2W1CA 1QCFA 3OAKA 2PZYA 2VTQA 3LXPA 1YXXA 4C7TA 3W8QA 2WFYA 5LQFA 4UWYA 3UZPA 2R64A 5E9EA 5IQBA 3C0IA 3P4KA 3R6XA 3OBGA 3UBDA 5LVNA 4KS7A 1G8AA 4DFXE 4PF4A 5D1JA 4O0SA 1IASA 4N57A 5GZ9A 2W1EA 5EI6A 3Q9XA 1Y91A 1IG1A 2BRBA 1S9JA 5A4QA 3JVRA 3R8MA 2CGVA 4EK6A 5F13A 2PYWA 1R39A 1CTPE 1YI6A 4WIHA 3WF7A 2F49A 3MA3A 4LRKA 4IAAA 5IH5A 3OTUA 3MPMA 3Q4TA 4JNWA 3ALNA 5TKDA 4ONAA 5D41A 1S9IA 3ELJA 4YR8A 4ORKA 3SJGA 3KRLA 1JKKA 5JFVA 4GU9A 3ZOSA 2B54A 2CCIA 5CAUA 3P08A 3R7EA 2R3MA 3F2NA 1YI3A 3UPXA 3QTQA 5BVWA 3PJ3A 1RE8A 1WBWA 3CR0A 3RVGA 2BVAA 3QA8A 3KA0A 3V04A 2W5BA 4PPAA 2XIZA 2VTLA 5DYJA 4DLIA 2JGZA 3DZOA 4PL5A 4BZDA 3ORXA 2I6LA 4X2GA 5LMBA 4JBPA 3UIXA 2FB8A 1PMNA 3NW7A 2XK7A 3DU8A 2XPLA 4O4BB 2C6EA 1TQMA 2ZV7A 2R3HA 2WQOA 3DXNA 4XOYA 2BAJA 2XJ2A 3R8VA 4EQUA 2BUJA 3FF3A 1YXSA 2Z60A 4ZXTA 4CCUA 3QL8A 3IDBA 3WZKA 2YM8A 4F6WA 4YPDA 4J8NA 1OKVA 1WFCA 2ZV9A 3HLLA 3O0GA 1WJTA 4BB4A 3ZHPC 4L00A 5HLWA 3DAJA 2XK4A 4WOVA 3DKCA 1BI7A 4EC8A 1NVRA 4ZSAA 5A4EA 3KXZA 3M42A 4FKPA 3IOPA 4BCJA 3ZLWA 4QQCA 3MFRA 3CTQA 5HTCA 4KAOA 5AM7A 3TMOA 3ZO3A 5HX6A 4ZP5A 2X1NA 4L45A 4HVIA 5DT0A 4D1SA 4G3EA 4UZDA 3U4WA 3TZ9A 3O2MA 3CSVA 4BJJA 3O23A 4NH1A 3FMJA 5LMAA 5ANEA 2HOGA 4P4BA 5KMKA 3BYVA 3KL8A 1U5RA 1MQBA 3TNWA 4RJ6A 1IR3A 4GCJA 5AMNA 5IDNA 4FV4A 3W10A 4OC2A 4Y95A 1SMHA 1TQIA 4RQKA 2AUHA 4YSMA 4JBOA 3HZTA 5HG9A 2CGXA 3MFUA 4PDSA 5IEXA 3HPHE 5HHWA 4ANQA 4D9TA 3MI9A 4EK3A 3VF9A 3RM7A 2R3QA 3B2TA 3CEKA 3DCVA 2IW8A 4GKHA 1IA8A 4K11A 1H8FA 4QMLA 4QP1A 4O86A 4QQTA 4QTDA 3DQXA 5CXHA 1AD5A 3D15A 4FTJA 4PP7A 4CVAA 3VROA 4ERWA 3QTRA 4BF2A 4CMUA 2WTKB 3OC1A 3PWDA 2WTWA 2OIQA 4X21A 3AG9A 5IA5A 5GZ8A 4QMQA 3A7JA 4XV2A 3L9MA 3SXSA 4BCQA 5J79A 2CNQA 4AGUA 4LOQA 4FG9A 4O1PA 5AP2A 1JLUE 5GHVA 2UVZA 4LV7A 4MXAA 2R9SA 4NEUA 5DHJA 1MRYA 2GTMA 5DH3A 2ZB1A 4FKTA 4XV9A 4AZFA 4DEAA 4DFYA 1U46A 3ZCLA 4BPXB 4RVKA 1XBCA 2IW6A 4QMOA 4YZNA 4EKLA 2FUMA 4RFMA 2XNMA 5FG8A 3W2OA 4AOIA 4BWXA 2QLQA 3L1SA 3WARA 4B99A 3CIKA 4IJ9A 2OR4A 3FL4A 3E63A 4GVAA 3NEWA 4OUCA 4EQCA 4UV0A 3TNHA 3V5TA 5KMOA 4EOMA 3LMHA 4M69B 3MH3A 4WNMA 2ZMCA 1OIYA 4I23A 2B55A 2HWPA 2YLEA 2X4FA 4FUXA 3Q6WA 4FG8A 4ZSLA 2R7BA 3LCOA 1Q5KA 2UZUE 2OFUA 3AMYA 3IGOA 3FLQA 4PL3A 3CD8A 4MXZA 4EH7A 3RBWA 4JYWA 4GYIA 3K2LA 2NP8A 2FSOX 4X6QC 3V5JA 5EM8A 2VUWA 5LVMA 3Q04A 4C61A 3C4ZA 3D5UA 3REPA 2A0CX 4O0RA 4UY9A 2J4ZA 4QMSA 4X3RA 4QP9A 3HX4A 4O1OA 3UOHA 2XZSA 4JQ7A 2B9FA 3FQEA 5HG5A 3A7GA 4BWPA 2OH4A 5KMMA 5J9YA 2OIBA 3HMJG 5L8JA 4JQ8A 1OBDA 5CNNA 1RQQA 4BI1A 5FDPA 1H4LA 4H1JA 2OU7A 4KINA 4R7HA 3R7OA 4FK6A 3GFEA 2ZFYA 4WHZA 3AKKA 4YZDA 4X2FA 3UQCA 4CFNA 2XIXA 3GU7A 3LFQA 5EYMA 4CGAA 3RK9A 3F9NA 2A27A 3DGKA 5H2UA 3RBUA 3PE1A 2PUPA 4Q5HA 2JBJA 2FSLX 4FNZA 4S31A 4DG0E 4GVJA 5FM3A 3F5XA 1E1VA 2PUUA 3D2KA 4EHGA 4QP4A 2VV9A 3LFEA 4A9SA 5DFPA 3AC4A 5EM7A 2X0OA 2XIRA 3KXXA 3QWJA 3VS3A 4FYOA 1M2QA 3UYSA 4PPBA 2HYYA 3QWKA 4I5MA 1Q8YA 4QYGA 4OC0A 5AFVA 1O6LA 3GT8A 1VZOA 4L67A 3TCPA 3MA6A 5HBJA 1YDRE 2EVAA 4MD7E 5AP5A 4NGRA 3VQUA 4A7CA 2C6IA 4OBOA 3WF9A 3KFAA 3NAXA 3LQ5A 2XEGA 2J2IB 2YCSA 4DGLC 4U44A 2VTIA 2VTNA 3MVMA 2XARA 3VUMA 3VWAA 4NYEA 3CCNA 4ACHA 3FMNA 2BTSA 3BYOA 5CI7A 3GOKA 2J7TA 1OKYA 2UW5A 3DA6A 4OTRA 4QO9A 3ID6C 4YLKA 5EM6A 2BROA 3VS7A 2XANA 5IUGA 2E9OA 3OEFX 4HGEA 2FO0A 4J7BA 3E3PA 3NUPA 3WOWA 3FHRA 4BJJB 2XKFA 3AC8A 4HJOA 5ANJA 4MTAA 1PMUA 4MF0A 3R02A 4O6LA 4H39A 3ZSIA 3G0EA 5HU9A 2PVMA 4CZTA 5LCJA 2QOLA 2C47A 4GK4A 1GNGA 1M7QA 2HW7A 5BMSA 2ITNA 4TNDA 3EKKA 3EQGA 2OK1A 3G9NA 1F5QA 1NT2A 2R7IA 3ORPA 3QXPA 4FOBA 4OTFA 5FWKK 3UOLA 4ASDA 3OUNB 4G17A 4OTHA 2GNJA 4U42A 3LFFA 4ZTMA 4N70A 4NM0A 1W84A 4NM3A 1GY3A 5ANOA 5CTPA 5CT7A 4QDVA 4YPSA 5KE0A 3NX8A 1PYEA 5A6OA 5JQ5A 3DJ7A 4V04A 3BUXB 1QPJA 3CE3A 3OWPA 4TYEA 4FT5A 4OTPA 1WBNA 2QHMA 5IKWA 2PVYA 5CF8A 1GZKA 2O8YA 3QCSA 2QU5A 3GBZA 5L6PA 1ZYLA 2Z02